m6A Regulator Information

General Information of the m6A Regulator (ID: REG00007)
Regulator Name Methyltransferase-like 3 (METTL3)
Synonyms
N6-adenosine-methyltransferase catalytic subunit; hMETTL3; N6-adenosine-methyltransferase 70 kDa subunit; MT-A70; MTA70
    Click to Show/Hide
Gene Name METTL3
Sequence
MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTSGG
PKPSTASAVPELATDPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQDGVESLL
QKFAAQELIEVKRGLLQDDAHPTLVTYADHSKLSAMMGAVAEKKGPGEVAGTVTGQKRRA
EQDSTTVAAFASSLVSGLNSSASEPAKEPAKKSRKHAASDVDLEIESLLNQQSTKEQQSK
KVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFR
RIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVG
GDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIP
VLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGK
EHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNV
QPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL
    Click to Show/Hide
Family MT-A70-like family
Function
The METTL3-METTL14 heterodimer forms a N6-methyltransferase complex that methylates adenosine residues at the N(6) position of some RNAs and regulates various processes such as the circadian clock, differentiation of embryonic and hematopoietic stem cells, cortical neurogenesis, response to DNA damage, differentiation of T-cells and primary miRNA processing. In the heterodimer formed with METTL14, METTL3 constitutes the catalytic core. N6-methyladenosine (m6A), which takes place at the 5'-[AG]GAC-3' consensus sites of some mRNAs, plays a role in mRNA stability, processing, translation efficiency and editing. In embryonic stem cells (ESCs), m6A methylation of mRNAs encoding key naive pluripotency-promoting transcripts results in transcript destabilization, promoting differentiation of ESCs. Involved in the response to DNA damage: in response to ultraviolet irradiation, METTL3 rapidly catalyzes the formation of m6A on poly(A) transcripts at DNA damage sites, leading to the recruitment of POLK to DNA damage sites. M6A is also required for T-cell homeostasis and differentiation: m6A methylation of transcripts of SOCS family members (SOCS1, SOCS3 and CISH) in naive T-cells promotes mRNA destabilization and degradation, promoting T-cell differentiation. Inhibits the type I interferon response by mediating m6A methylation of IFNB. Mediates m6A methylation of Xist RNA, thereby participating in random X inactivation: m6A methylation of Xist leads to target YTHDC1 reader on Xist and promote transcription repression activity of Xist. M6A also regulates cortical neurogenesis. METTL3 mediates methylation of pri-miRNAs, marking them for recognition and processing by DGCR8. Acts as a positive regulator of mRNA translation independently of the methyltransferase activity. Its overexpression in a number of cancer cells suggests that it may participate in cancer cell proliferation by promoting mRNA translation.
    Click to Show/Hide
Gene ID 56339
Uniprot ID
MTA70_HUMAN
Regulator Type WRITER ERASER READER
Mechanism Diagram Click to View the Original Diagram
Target Genes Click to View Potential Target Genes of This Regulator
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
METTL3 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Browse Target Gene related Drug
72 kDa type IV collagenase (MMP2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 7.46E-01
p-value: 1.39E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.08E+00 GSE60213
Melanoma [ICD-11: 2C30]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Melanoma [ICD-11: 2C30]
Target Regulation Up regulation
Cell Process Cell invasion/migration
In-vitro Model
 451Lu Cutaneous melanoma Homo sapiens CVCL_6357
A-375 Amelanotic melanoma Homo sapiens CVCL_0132
A375-MA2 Amelanotic melanoma Homo sapiens CVCL_X495
MeWo Cutaneous melanoma Homo sapiens CVCL_0445
SK-MEL-2 Melanoma Homo sapiens CVCL_0069
WM164 Cutaneous melanoma Homo sapiens CVCL_7928
WM3211 Acral lentiginous melanoma Homo sapiens CVCL_6797
WM3918 Melanoma Homo sapiens CVCL_C279
WM793 Melanoma Homo sapiens CVCL_8787
Response Summary METTL3 is upregulated in human melanoma and plays a role in invasion/migration through MMP2. METTL3 overexpression promotes accumulation of 72 kDa type IV collagenase (MMP2) and N-cadherin in melanoma cells.
Retinopathy [ICD-11: 9B71]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [264]
Responsed Disease Retinopathy [ICD-11: 9B71]
Target Regulation Up regulation
In-vivo Model Mouse pups, along with their nursing mothers, were exposed to 75 ± 2% O2 in an incubator between postnatal day (P) 7 and P12 and were then returned to room air.
Abnormal spindle-like microcephaly-associated protein (ASPM)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Mouse testis Mus musculus
Treatment: Mettl3 knockout mouse testis
Control: Mouse testis
 GSE99771
Regulation
logFC: -3.99E+00
p-value: 5.74E-06
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.27E+00 GSE60213
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
Cell Process Cells growth
Cell metastasis
In-vitro Model
 SNU-449 Adult hepatocellular carcinoma Homo sapiens CVCL_0454
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hepg3b (Hepg3b were purchased from the American Type Culture Collection (ATCC, USA))
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary The N6-methyladenosine (m6A) modification of ASPM mRNA mediated by METTL3 promoted its expression in liver hepatocellular carcinoma.
Adenomatous polyposis coli protein (APC)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: 6.65E-01
p-value: 8.92E-49
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.14E+00 GSE60213
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Esophageal cancer [ICD-11: 2B70]
Target Regulation Down regulation
Pathway Response Wnt signaling pathway hsa04310
Cell cycle hsa04110
Glycolysis / Gluconeogenesis hsa00010
Cell Process Glycolysis
In-vitro Model
 TE-10 Esophageal squamous cell carcinoma Homo sapiens CVCL_1760
TE-1 Esophageal squamous cell carcinoma Homo sapiens CVCL_1759
KYSE-70 Esophageal squamous cell carcinoma Homo sapiens CVCL_1356
KYSE-450 Esophageal squamous cell carcinoma Homo sapiens CVCL_1353
KYSE-410 Esophageal squamous cell carcinoma Homo sapiens CVCL_1352
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
KYSE-180 Esophageal squamous cell carcinoma Homo sapiens CVCL_1349
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
KYSE-140 Esophageal squamous cell carcinoma Homo sapiens CVCL_1347
HET-1A Normal Homo sapiens CVCL_3702
In-vivo Model For the subcutaneous implantation model, 1 × 106 cells were injected subcutaneously into the flank regions of female BALB/c nude mice (4-5 weeks).
Response Summary m6A-RNA immunoprecipitation sequencing revealed that METTL3 upregulates the m6A modification of Adenomatous polyposis coli protein (APC), which recruits YTHDF for APC mRNA degradation. Our findings reveal a mechanism by which the Wnt/Bete-catenin pathway is upregulated in ESCC via METTL3/YTHDF-coupled epitranscriptomal downregulation of APC.
AF4/FMR2 family member 4 (AFF4)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -6.53E-01
p-value: 1.79E-17
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.64E+00 GSE60213
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Cell Process Glucose metabolism
Response Summary AF4/FMR2 family member 4 (AFF4), two key regulators of NF-Kappa-B pathway (IKBKB and RELA) and MYC were further identified as direct targets of METTL3-mediated m6A modification.overexpression of METTL3 significantly promoted Bladder cancer cell growth and invasion.
Angiopoietin-1 receptor (TEK)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: 3.39E+00
p-value: 6.45E-138
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 3.75E+00 GSE60213
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Cell Process Cellular proliferation and survival
In-vitro Model
 UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
T24 Bladder carcinoma Homo sapiens CVCL_0554
In-vivo Model For induction of BCa, 6-8-week-old mice were treated with drinking water containing 500 ug/ml BBN for 16 weeks and then given normal water for another 10 weeks. Tamoxifen was intraperitonelly injected to the mice with 0.08 mg/g of body weight each day for 3 days in order to inductively knock out the target gene.
Response Summary Deletion of Mettl3 leads to the suppression of Angiopoietin-1 receptor (TEK) and VEGF-A,ablation of Mettl3 in bladder urothelial attenuates the oncogenesis and tumor angiogenesis of bladder cancer.
Retinopathy [ICD-11: 9B71]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [264]
Responsed Disease Retinopathy [ICD-11: 9B71]
Target Regulation Up regulation
In-vivo Model Mouse pups, along with their nursing mothers, were exposed to 75 ± 2% O2 in an incubator between postnatal day (P) 7 and P12 and were then returned to room air.
Apoptosis regulator BAX (BAX)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Embryonic stem cells Mus musculus
Treatment: METTL3 knockout mESCs
Control: Wild type mESCs
 GSE156481
Regulation
logFC: -5.89E-01
p-value: 1.41E-07
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.02E+01 GSE60213
Enterovirus [ICD-11: 1A2Y]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Enterovirus [ICD-11: 1A2Y]
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Apoptosis hsa04210
Cell Process Cell proliferation and metastasis
Cell apoptosis
Cell autophagy
In-vitro Model
 Schwann cells (A type of glial cell that surrounds neurons)
Response Summary Knocking down METTL3 prevented Enterovirus 71-induced cell death and suppressed Enterovirus 71-induced expression of Apoptosis regulator BAX (BAX) while rescuing Bcl-2 expression after Enterovirus 71 infection. Knocking down METTL3 inhibited Enterovirus 71-induced expression of Atg5, Atg7 and LC3 II. Knocking down METTL3 inhibited Enterovirus 71-induced apoptosis and autophagy.
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Down regulation
Pathway Response Apoptosis hsa04210
PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
Response Summary Down-regulation of METTL3 inhibits the proliferation and mobility of human gastric cancer cells and leads to inactivation of the AKT signaling pathway, suggesting that METTL3 is a potential target for the treatment of human gastric cancer. METTL3 knockdown decreased Bcl2 and increased Apoptosis regulator BAX (BAX) and active Caspase-3 in gastric cancer cells, which suggested the apoptotic pathway was activated. METTL3 led to inactivation of the AKT signaling pathway in human gastric cancer cells, including decreased phosphorylation levels of AKT and expression of down-stream effectors p70S6K and Cyclin D1.
Apoptosis regulator Bcl-2 (BCL2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Th1 cell line Mus musculus
Treatment: METTL3 knockout splenic Th1 cells
Control: Wild type splenic Th1 cells
 GSE129648
Regulation
logFC: 7.38E-01
p-value: 3.55E-06
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 6.70E+00 GSE60213
Enterovirus [ICD-11: 1A2Y]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Enterovirus [ICD-11: 1A2Y]
Target Regulation Down regulation
Pathway Response Autophagy hsa04140
Apoptosis hsa04210
Cell Process Cell proliferation and metastasis
Cell apoptosis
Cell autophagy
In-vitro Model
 Schwann cells (A type of glial cell that surrounds neurons)
Response Summary Knocking down METTL3 prevented Enterovirus 71-induced cell death and suppressed Enterovirus 71-induced expression of BAX while rescuing Apoptosis regulator Bcl-2 (BCL2) expression after Enterovirus 71 infection. Knocking down METTL3 inhibited Enterovirus 71-induced expression of Atg5, Atg7 and LC3 II. Knocking down METTL3 inhibited Enterovirus 71-induced apoptosis and autophagy.
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation Up regulation
Pathway Response Apoptosis hsa04210
Cell Process Cell differentiation and apoptosis
In-vitro Model
 HSPC (Human hematopoietic stem cell)
In-vivo Model 500,000 selected cells were injected via tail vein or retro-orbital route into female NSG (6-8 week old) recipient mice that had been sublethally irradiated with 475 cGy one day before transplantation.
Response Summary METTL3 depletion in human myeloid leukemia cell lines induces cell differentiation and apoptosis and delays leukemia progression in recipient mice in vivo. Single-nucleotide-resolution mapping of m6A coupled with ribosome profiling reveals that m6A promotes the translation of c-MYC, Apoptosis regulator Bcl-2 (BCL2) and PTEN mRNAs in the human acute myeloid leukemia MOLM-13 cell line. Moreover, loss of METTL3 leads to increased levels of phosphorylated AKT.
B-cell lymphomas [ICD-11: 2A86]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease B-cell lymphomas [ICD-11: 2A86]
Target Regulation Up regulation
Pathway Response Apoptosis hsa04210
Autophagy hsa04140
Cell Process Cell proliferation and metastasis
Cell apoptosis
In-vitro Model
 ATDC-5 Mouse teratocarcinoma Mus musculus CVCL_3894
In-vivo Model For MIA + SAH control, S-adenosylhomocysteine (SAH), Mettl3 inhibitor (10 mg/kg) (MCE, NJ, USA) was injected intraperitoneally before MIA injection and maintained twice a week until mice were sacrificed.
Response Summary Mettl3 inhibitor, S-adenosylhomocysteine promoted the apoptosis and autophagy of chondrocytes with inflammation in vitro and aggravated the degeneration of chondrocytes and subchondral bone in monosodium iodoacetate (MIA) induced temporomandibular joint osteoarthritis mice in vivo. Bcl2 protein interacted with Beclin1 protein in chondrocytes induced by TNF-alpha stimulation. Mettl3 inhibits the apoptosis and autophagy of chondrocytes in inflammation through m6A/Ythdf1/Apoptosis regulator Bcl-2 (BCL2) signal axis which provides promising therapeutic strategy for temporomandibular joint osteoarthritis.
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Pathway Response Apoptosis hsa04210
PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
Response Summary Down-regulation of METTL3 inhibits the proliferation and mobility of human gastric cancer cells and leads to inactivation of the AKT signaling pathway, suggesting that METTL3 is a potential target for the treatment of human gastric cancer. METTL3 knockdown decreased Apoptosis regulator Bcl-2 (BCL2) and increased Bax and active Caspase-3 in gastric cancer cells, which suggested the apoptotic pathway was activated. METTL3 led to inactivation of the AKT signaling pathway in human gastric cancer cells, including decreased phosphorylation levels of AKT and expression of down-stream effectors p70S6K and Cyclin D1.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Up regulation
Pathway Response Apoptosis hsa04210
Cell Process Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model The mice were housed with filtered air, 12 h light/dark cycle, constant temperature (25℃), relative humidity (50±5%) and free access to food and water. In order to establish a human NSCLC xenograft model, 5×106 H1299, sh-METTL3-H1299 and METTL3 stably overexpressed H1299 cells (2×106 per mouse) were subcutaneously injected into mice. Tumor growth was observed daily. Tumor volume was calculated as follows: 0.5× (length × width2). At 24 days post-inoculation, the maximum diameter exhibited by a single subcutaneous tumor was 15 mm and mice were anesthetized by intraperitoneal administration of sodium pentobarbital (50 mg/kg), then sacrificed by cervical dislocation.
Response Summary METTL3 regulated cellular growth, survival and migration in non-small cell lung cancer. METTL3 promoted non-small cell lung cancer progression by modulating the level of Apoptosis regulator Bcl-2 (BCL2).
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Pathway Response Apoptosis hsa04210
Cell Process Cell apoptosis
In-vitro Model
 MCF-10A Normal Homo sapiens CVCL_0598
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MDA-MB-453 Breast adenocarcinoma Homo sapiens CVCL_0418
MDA-MB-468 Breast adenocarcinoma Homo sapiens CVCL_0419
In-vivo Model Mice were maintained at 22 ± 2 ℃ with a humidity of 35 ± 5% under a 12 h light and 12 h dark cycle, with free access to water and food. For the HFD experiment, female control (Ftoflox/flox) and adipose-selective fto knockout (Fabp4-Cre Ftoflox/flox, fto-AKO) mice were fed with high-fat diet (60% fat in calories; Research Diets, D12492) for the desired periods of time, and food intake and body weight were measured every week after weaning (at 3 weeks of age).
Response Summary Apoptosis regulator Bcl-2 (BCL2) acted as the target of METTL3, thereby regulating the proliferation and apoptosis of breast cancer.
Dentofacial anomalies [ICD-11: DA0E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease Temporomandibular joint disorders [ICD-11: DA0E.8]
Target Regulation Up regulation
Pathway Response Apoptosis hsa04210
Autophagy hsa04140
Cell Process Cell proliferation and metastasis
Cell apoptosis
In-vitro Model
 ATDC-5 Mouse teratocarcinoma Mus musculus CVCL_3894
In-vivo Model For MIA + SAH control, S-adenosylhomocysteine (SAH), Mettl3 inhibitor (10 mg/kg) (MCE, NJ, USA) was injected intraperitoneally before MIA injection and maintained twice a week until mice were sacrificed.
Response Summary Mettl3 inhibitor, S-adenosylhomocysteine promoted the apoptosis and autophagy of chondrocytes with inflammation in vitro and aggravated the degeneration of chondrocytes and subchondral bone in monosodium iodoacetate (MIA) induced temporomandibular joint osteoarthritis mice in vivo. Bcl2 protein interacted with Beclin1 protein in chondrocytes induced by TNF-alpha stimulation. Mettl3 inhibits the apoptosis and autophagy of chondrocytes in inflammation through m6A/Ythdf1/Apoptosis regulator Bcl-2 (BCL2) signal axis which provides promising therapeutic strategy for temporomandibular joint osteoarthritis.
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [267]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Responsed Drug Celastrol Preclinical
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
AsPC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
In-vivo Model AsPC-1 cells suspended in 100 μl of PBS (2 × 106 cells/100 μl) were injected subcutaneously into the lateral flank of the mice, which were randomly divided into solvent group (n = 6), 1.0 mg/kg of celastrol group (n = 6) and 3.0 mg/kg of celastrol group (n = 6). The administration of celastrol was performed by intraperitoneal injection into tumor-bearing mice every 2 day after 10 day inoculation. The tumor sizes were monitored with calipers every 5 days, and the tumor volume was calculated with the formula: Volume (mm3) = 1/2 × length × width2.
Injuries of spine or trunk [ICD-11: ND51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [268]
Responsed Disease Spinal cord injury [ICD-11: ND51.2]
Responsed Drug STM2457 Investigative
 Drug Info 
Target Regulation Down regulation
In-vitro Model
 PC12 Rat adrenal gland pheochromocytoma Rattus norvegicus CVCL_0481
In-vivo Model Rats were anesthetized with intraperitoneal injection of 1% sodium pentobarbital (20 mg/kg). For constructing a rat spinal cord hemisection model, the spinal colon was marked on the T9 spinous process and the skin was incised until exposing the T9-10 spinous process. The spinal cord was completely exposed by biting the vertebral plate with biting forceps. The spinal cord was cut on one side with ophthalmic scissors centered on the central canal of the spinal cord.
Aspartate--tRNA ligase, cytoplasmic (DARS)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3 knockout liver
Control: Wild type liver cells
 GSE198513
Regulation
logFC: -5.90E-01
p-value: 7.45E-13
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.22E+00 GSE60213
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [13]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Pathway Response Autophagy hsa04140
Cell Process Cell autophagy
In-vitro Model
 SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
End1/E6E7 Normal Homo sapiens CVCL_3684
DoTc2 4510 Cervical carcinoma Homo sapiens CVCL_1181
Ca Ski Cervical squamous cell carcinoma Homo sapiens CVCL_1100
C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
Response Summary DARS-AS1 was validated to facilitate DARS translation via recruiting METTL3 and METTL14, which bound with DARS mRNA Aspartate--tRNA ligase, cytoplasmic (DARS) mRNA 5' untranslated region (5'UTR) and promoting its translation. The present study demonstrated that the 'HIF1-Alpha/DARS-AS1/DARS/ATG5/ATG3' pathway regulated the hypoxia-induced cytoprotective autophagy of cervical cancer(CC) and is a promising target of therapeutic strategies for patients afflicted with CC.
ATP-binding cassette sub-family C member 9 (ABCC9)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: -1.97E+00
p-value: 5.10E-08
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 6.69E+00 GSE60213
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [14]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Down regulation
Pathway Response ABC transporters hsa02010
Wnt signaling pathway hsa04310
Ubiquitin mediated proteolysis hsa04120
Cell Process Ubiquitination degradation
In-vitro Model
 CNE-1 Normal Homo sapiens CVCL_6888
CNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_6889
In-vivo Model A total of 2 × 106 cells was mixed with 0.2 ml PBS (pH 7.4) and 30% (v/v) Matrigel matrix (BD Biosciences).
Response Summary TRIM11 regulates nasopharyngeal carcinoma drug resistance by positively modulating the Daple/beta-catenin/ATP-binding cassette sub-family C member 9 (ABCC9) signaling pathway. TRIM11 enhanced the multidrug resistance in NPC by inhibiting apoptosis in vitro and promoting cisplatin (DDP) resistance in vivo. METTL3-mediated m6A modification caused the upregulation of TRIM11 via IGF2BP2 in NPC drug-resistant cells.
ATP-binding cassette sub-family D member 1 (ABCD1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MOLM-13 cell line Homo sapiens
Treatment: shMETTL3 MOLM13 cells
Control: MOLM13 cells
 GSE98623
Regulation
logFC: -9.42E-01
p-value: 1.69E-05
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 8.82E+00 GSE60213
Renal cell carcinoma [ICD-11: 2C90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [15]
Responsed Disease Renal cell carcinoma of kidney [ICD-11: 2C90.0]
Target Regulation Up regulation
Pathway Response ABC transporters hsa02010
Cell Process Cell migration and spheroid formation
In-vitro Model
 786-O Renal cell carcinoma Homo sapiens CVCL_1051
A-498 Renal cell carcinoma Homo sapiens CVCL_1056
In-vivo Model A498 cells (1 × 106 cells) were resuspended in 100 uL of PBS and subcutaneously injected into the axillary fossa of nude mice (BALB/c-nude, 4 weeks old).
Response Summary Knockdown of METTL3 in clear cell renal cell carcinoma cell line impaired both cell migration capacity and tumor spheroid formation in soft fibrin gel, a mechanical method for selecting stem-cell-like tumorigenic cells. METTL3 knockdown cells and functional studies confirmed that translation of ATP-binding cassette sub-family D member 1 (ABCD1).
ATPase family AAA domain-containing protein 2 (ATAD2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line DKO-1 cell line Homo sapiens
Treatment: METTL3 knockdown DKO-1 cell
Control: DKO-1 cell
 GSE182382
Regulation
logFC: 6.62E-01
p-value: 6.71E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.75E+00 GSE60213
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [16]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Target Regulation Up regulation
Cell Process Cell proliferation and invasion
Cell apoptosis
In-vitro Model
 HOS Osteosarcoma Homo sapiens CVCL_0312
MG-63 Osteosarcoma Homo sapiens CVCL_0426
SaOS-2 Osteosarcoma Homo sapiens CVCL_0548
U2OS Osteosarcoma Homo sapiens CVCL_0042
Response Summary METTL3 functions as an oncogene in the growth and invasion of osteosarcoma by regulating ATPase family AAA domain-containing protein 2 (ATAD2), suggesting a potential therapeutic target for osteosarcoma treatment.
Autophagy protein 5 (ATG5)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line CT26 cell line Mus musculus
Treatment: METTL3 knockout CT26 cells
Control: CT26 cells
 GSE142589
Regulation
logFC: -9.09E-01
p-value: 4.91E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 8.30E+00 GSE60213
Enterovirus [ICD-11: 1A2Y]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Enterovirus [ICD-11: 1A2Y]
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cell proliferation and metastasis
Cell apoptosis
Cell autophagy
In-vitro Model
 Schwann cells (A type of glial cell that surrounds neurons)
Response Summary Knocking down METTL3 prevented Enterovirus 71-induced cell death and suppressed Enterovirus 71-induced expression of Bax while rescuing Bcl-2 expression after Enterovirus 71 infection. Knocking down METTL3 inhibited Enterovirus 71-induced expression of Autophagy protein 5 (ATG5), Atg7 and LC3 II. Knocking down METTL3 inhibited Enterovirus 71-induced apoptosis and autophagy.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [17]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Sorafenib Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response FoxO signaling pathway hsa04068
Autophagy hsa04140
Cell Process Cell autophagy
Response Summary METTL3 can sensitise hepatocellular carcinoma cells to sorafenib through stabilising forkhead box class O3 (FOXO3) in an m6A-dependent manner and translated by YTHDF1, thereby inhibiting the transcription of autophagy-related genes, including ATG3, Autophagy protein 5 (ATG5), ATG12, and ATG16L1.
Lung cancer [ICD-11: 2C25]
In total 3 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Chloroquine Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model
 Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as Autophagy protein 5 (ATG5), ATG7, LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Gefitinib Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model
 Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as Autophagy protein 5 (ATG5), ATG7, LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Beta-Elemen Phase 3
 Drug Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model
 Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as Autophagy protein 5 (ATG5), ATG7, LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Testicular cancer [ICD-11: 2C80]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Testicular cancer [ICD-11: 2C80]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cellular Processes
Cellular Transport
Cellular catabolism
Cell autophagy
In-vitro Model
 Tcam-2/DDP (Cisplatin-resistant TCam-2 cell line)
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary m6A methyltransferase METTL3 regulates autophagy and sensitivity to cisplatin by targeting Autophagy protein 5 (ATG5) in seminoma. The use of autophagy inhibitors 3-MA could reverse the protective effect of METTL3 on TCam-2 cells.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Testicular cancer [ICD-11: 2C80]
Responsed Drug 3-Methyladenine Investigative
 Drug Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cellular Processes
Cellular Transport
Cellular catabolism
Cell autophagy
In-vitro Model
 Tcam-2/DDP (Cisplatin-resistant TCam-2 cell line)
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary m6A methyltransferase METTL3 regulates autophagy and sensitivity to cisplatin by targeting Autophagy protein 5 (ATG5) in seminoma. The use of autophagy inhibitors 3-MA could reverse the protective effect of METTL3 on TCam-2 cells.
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [270]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Responsed Drug Spautin 1 Preclinical
 Drug Info 
Target Regulation Up regulation
In-vivo Model For tumor growth assay, 2 × 106 OS cells in 100 μL medium were injected into the nude mice subcutaneously. For tumor metastasis assay, we injected medium containing 2 × 106 cells through the caudal vein. An IVIS200 imaging system (Caliper Life Science, USA) was used to image and assess the OS metastasis. For pharmacological inhibition of USP13, mice bearing xenografts were treated with Spautin-1 (40 mg/kg/day i.p.) or vehicle for 2 weeks.
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [271]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Autophagy-related protein 16-1 (ATG16L1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line CT26 cell line Mus musculus
Treatment: METTL3 knockout CT26 cells
Control: CT26 cells
 GSE142589
Regulation
logFC: -8.44E-01
p-value: 3.07E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.03E+00 GSE60213
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [17]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Sorafenib Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response FoxO signaling pathway hsa04068
Autophagy hsa04140
Cell Process Cell autophagy
Response Summary METTL3 can sensitise hepatocellular carcinoma cells to sorafenib through stabilising forkhead box class O3 (FOXO3) in an m6A-dependent manner and translated by YTHDF1, thereby inhibiting the transcription of autophagy-related genes, including ATG3, ATG5, ATG7, ATG12, and Autophagy-related protein 16-1 (ATG16L1).
Basic leucine zipper transcriptional factor ATF-like 2 (BATF2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: -2.08E+00
p-value: 6.32E-06
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.91E+00 GSE60213
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [20]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Down regulation
Pathway Response p53 signaling pathway hsa04115
In-vitro Model
 SNU-216 Gastric tubular adenocarcinoma Homo sapiens CVCL_3946
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
In-vivo Model A total of 5 × 106 stably transfected HGC-27 cells were subcutaneously injected into the right axillary fossa of nude mice. Tumor volume was measured every 3 days and calculated with the following formula: V = (L × W2)/2 cm2 (V, tumor volume; L, length; W, width). The mice were sacrificed at 3-4 weeks after injection, and the tumors were weighed. For the lung metastasis model, 5 × 106 stably transfected HGC-27 cells were injected into the tail veins of nude mice. Forty-five days later, the mice were sacrificed, and the lungs were dissected to examine the histopathological metastatic loci. The peritoneal dissemination ability of GC cells was evaluated via intraperitoneal injection. A total of 5 × 106 stably transfected HGC-27 cells in 500 uL of PBS were injected into the peritoneal cavity of BALB/c nude mice. Mice were carefully monitored until they were killed at 4 weeks, at which point peritoneal metastases were examined and recorded.
Response Summary N6-methyladenosine (m6A) modification of Basic leucine zipper transcriptional factor ATF-like 2 (BATF2) mRNA by METTL3 repressed its expression in gastric cancer.
Beta-catenin-interacting protein 1 (CTNNBIP1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -1.02E+00
p-value: 3.20E-17
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.17E+00 GSE60213
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [21]
Responsed Disease Glioma [ICD-11: 2A00.0]
Target Regulation Up regulation
In-vitro Model
 T98G Glioblastoma Homo sapiens CVCL_0556
LN-229 Glioblastoma Homo sapiens CVCL_0393
LN-18 Glioblastoma Homo sapiens CVCL_0392
HEB (human normal glial cell line HEB were obtained from Tongpai (Shanghai) biotechnology co., LTD (Shanghai, China))
A-172 Glioblastoma Homo sapiens CVCL_0131
Response Summary METTL3-mediated m6A modification upregulated circDLC1 expression, and circDLC1 promoted Beta-catenin-interacting protein 1 (CTNNBIP1) transcription by sponging miR-671-5p, thus repressing the malignant proliferation of glioma.
Broad substrate specificity ATP-binding cassette transporter ABCG2 (BCRP/ABCG2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -9.03E-01
p-value: 2.29E-02
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 4.88E+00 GSE60213
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [22]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Doxil Approved
 Drug Info 
Target Regulation Up regulation
Cell Process Cell growth and death
Cell apoptosis
In-vitro Model
 ADR-resistant MCF-7 (MCF-7/ADR) cells (Human breast cancer doxorubicin-resistant cell line)
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
In-vivo Model Cell suspensions (2 × 106 cells/mL) made with MCF-7/ADR cells stably expressing METTL3 and/or miR-221-3p inhibitor were subcutaneously implanted into each mouse. One week later, xenografted mice were injected with 0.1 mL ADR (25 mg/kg, intraperitoneal injection) twice a week.
Response Summary METTL3 promotes adriamycin resistance in MCF-7 breast cancer cells by accelerating pri-microRNA-221-3p maturation in a m6A-dependent manner. METTL3 knockdown was shown to reduce the expression of miR-221-3p by reducing pri-miR-221-3p m6A mRNA methylation, reducing the expression of MDR1 and Broad substrate specificity ATP-binding cassette transporter ABCG2 (BCRP/ABCG2), and inducing apoptosis. Identified the METTL3/miR-221-3p/HIPK2/Che-1 axis as a novel signaling event that will be responsible for resistance of BC cells to ADR.
Cadherin-1 (CDH1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -7.84E-01
p-value: 1.59E-117
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 4.00E+00 GSE60213
Idiopathic interstitial pneumonitis [ICD-11: CB03]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [23]
Responsed Disease Pulmonary Fibrosis [ICD-11: CB03.4]
Pathway Response Adherens junction hsa04520
Cell Process Epithelial-mesenchymal transition
Response Summary PM2.5 exposure increased the levels of METTL3-mediated m6A modification of Cadherin-1 (CDH1) mRNA. PM2.5 exposure triggered EMT progression to promote the pulmonary fibrosis via miR-494-3p/YTHDF2 recognized and METTL3 mediated m6A modification.
Cadherin-2 (CDH2/N-cadherin)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 8.67E-01
p-value: 3.90E-33
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 4.52E+00 GSE60213
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [24]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 Neural progenitor cells (NPCs) (The progenitor cells of the CNS)
NP69 (A human immortalized nasopharyngeal epithelial)
HNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_FA07
HNE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_0308
CNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_6889
CNE-1 Normal Homo sapiens CVCL_6888
In-vivo Model 1 × 105 HNE2 cells (with or without METTL3 knockdown) were labeled with luciferase gene and injected into the tail vein of the nude mice.
Response Summary METTL3 activated the luciferase activity of TOPflash (a reporter for beta-catenin/TCF signaling), and downregulation of METTL3 inhibited the expression of beta-catenin/TCF target genes vimentin and Cadherin-2 (CDH2/N-cadherin), which are two regulators of epithelial-mesenchymal transition. METTL3 silencing decreased the m6A methylation and total mRNA levels of Tankyrase, a negative regulator of axin. METTL3 is a therapeutic target for NPC.
Melanoma [ICD-11: 2C30]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Melanoma [ICD-11: 2C30]
Target Regulation Up regulation
Cell Process Cell invasion/migration
In-vitro Model
 451Lu Cutaneous melanoma Homo sapiens CVCL_6357
A-375 Amelanotic melanoma Homo sapiens CVCL_0132
A375-MA2 Amelanotic melanoma Homo sapiens CVCL_X495
MeWo Cutaneous melanoma Homo sapiens CVCL_0445
SK-MEL-2 Melanoma Homo sapiens CVCL_0069
WM164 Cutaneous melanoma Homo sapiens CVCL_7928
WM3211 Acral lentiginous melanoma Homo sapiens CVCL_6797
WM3918 Melanoma Homo sapiens CVCL_C279
WM793 Melanoma Homo sapiens CVCL_8787
Response Summary METTL3 is upregulated in human melanoma and plays a role in invasion/migration through MMP2. METTL3 overexpression promotes accumulation of MMP2 and Cadherin-2 (CDH2/N-cadherin) in melanoma cells.
Catenin beta-1 (CTNNB1/Beta-catenin)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Embryonic stem cells Mus musculus
Treatment: METTL3 knockout mESCs
Control: Wild type mESCs
 GSE156481
Regulation
logFC: -8.46E-01
p-value: 2.97E-40
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.37E+00 GSE60213
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [24]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 Neural progenitor cells (NPCs) (The progenitor cells of the CNS)
NP69 (A human immortalized nasopharyngeal epithelial)
HNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_FA07
HNE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_0308
CNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_6889
CNE-1 Normal Homo sapiens CVCL_6888
In-vivo Model 1 × 105 HNE2 cells (with or without METTL3 knockdown) were labeled with luciferase gene and injected into the tail vein of the nude mice.
Response Summary METTL3 activated the luciferase activity of TOPflash (a reporter for beta-catenin/TCF signaling), and downregulation of METTL3 inhibited the expression of Catenin beta-1 (CTNNB1/Beta-catenin)/TCF target genes vimentin and N-cadherin, which are two regulators of epithelial-mesenchymal transition. METTL3 silencing decreased the m6A methylation and total mRNA levels of Tankyrase, a negative regulator of axin. METTL3 is a therapeutic target for NPC.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [25]
Responsed Disease Hepatoblastoma [ICD-11: 2C12.01]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process RNA stability
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
QSG-7701 Endocervical adenocarcinoma Homo sapiens CVCL_6944
In-vivo Model 5 × 106 cells were subcutaneously injected into the left or right flank of each mouse.
Response Summary METTL3 is significantly up-regulated in Hepatoblastoma(HB) and promotes HB development.m6A mRNA methylation contributes significantly to regulate the Wnt/beta-catenin pathway. Reduced m6A methylation can lead to a decrease in expression and stability of the Catenin beta-1 (CTNNB1/Beta-catenin).
Spina bifida [ICD-11: LA02]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [26]
Responsed Disease Neural tube defect [ICD-11: LA02.Z]
Target Regulation Down regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Cell apoptosis
In-vitro Model
 HT22 Normal Mus musculus CVCL_0321
In-vivo Model The mice were maintained on a 12-h light/dark cycle (lights on from 8:00 a.m. to 8:00 p.m.). On day 7.5 of pregnancy (E7.5), ethionine (Sigma-Aldrich, USA) was intraperitoneally injected only once at a dose of 500 mg/kg to establish the NTDs embryo model. And SAM (MedChemExpress, USA) was intraperitoneally injected only once at a dose of 30 mg/kg. The same dose was intraperitoneally injected to the pregnant mice for control group.
Response Summary SAM not only played a compensatory role, but also led to m6A modification changes in neural tube development and regulation. Ethionine affected m6A modification by reducing SAM metabolism. METTL3 is enriched in HT-22 cells, and METTL3 knockdown reduces cell proliferation and increases apoptosis through suppressing Wnt/Catenin beta-1 (CTNNB1/Beta-catenin) signaling pathway. Overexpression of ALKBH5 can only inhibit cell proliferation, but cannot promote cell apoptosis.
Chronic kidney disease [ICD-11: GB61]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [276]
Responsed Disease Chronic kidney disease [ICD-11: GB61]
In-vitro Model
 HK-2 [Human kidney] Normal Homo sapiens CVCL_0302
In-vivo Model Mice were injected with empty vector (pcDNA3) or Flag-tagged METTL3 expression vector (pFlag-METTL3) at 2 days after UUO or 4 days after UIRI, respectively. The expression of transgene was validated by Western blotting or immunostaining for Flag-tagged METTL3 fusion protein.
Cellular tumor antigen p53 (TP53/p53)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: 1.12E+00
p-value: 1.48E-02
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.05E+00 GSE60213
Solid tumour/cancer [ICD-11: 2A00-2F9Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [27]
Responsed Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Responsed Drug Arsenite Phase 2
 Drug Info 
Target Regulation Up regulation
Pathway Response p53 signaling pathway hsa04115
In-vitro Model
 HaCaT Normal Homo sapiens CVCL_0038
Response Summary METTL3 significantly decreased m6A level, restoring Cellular tumor antigen p53 (TP53/p53) activation and inhibiting cellular transformation phenotypes in the arsenite-transformed cells. m6A downregulated the expression of the positive p53 regulator, PRDM2, through the YTHDF2-promoted decay of PRDM2 mRNAs. m6A upregulated the expression of the negative p53 regulator, YY1 and MDM2 through YTHDF1-stimulated translation of YY1 and MDM2 mRNA. This study further sheds light on the mechanisms of arsenic carcinogenesis via RNA epigenetics.
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [28]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation Down regulation
Pathway Response p53 signaling pathway hsa04115
Cell cycle hsa04110
Apoptosis hsa04210
Cell Process Cell apoptosis
Cells in G3/M phase decreased
In-vitro Model
 THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
MOLT-4 Adult T acute lymphoblastic leukemia Homo sapiens CVCL_0013
Kasumi-1 Myeloid leukemia with maturation Homo sapiens CVCL_0589
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
HL-60 Adult acute myeloid leukemia Homo sapiens CVCL_0002
HEL Erythroleukemia Homo sapiens CVCL_0001
CCRF-CEM C7 T acute lymphoblastic leukemia Homo sapiens CVCL_6825
HEK293T Normal Homo sapiens CVCL_0063
Response Summary METTL3 and METTL14 play an oncogenic role in acute myeloid leukemia(AML) by targeting mdm2/Cellular tumor antigen p53 (TP53/p53) signal pathway. The knockdown of METTL3 and METTL14 in K562 cell line leads to several changes in the expression of p53 signal pathway, including the upregulation of p53, cyclin dependent kinase inhibitor 1A (CDKN1A/p21), and downregulation of mdm2.
Colon cancer [ICD-11: 2B90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [29]
Responsed Disease Colon cancer [ICD-11: 2B90]
Target Regulation Up regulation
Pathway Response p53 signaling pathway hsa04115
Cell Process Protein signaling
In-vitro Model
 SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
WiDr Colon adenocarcinoma Homo sapiens CVCL_2760
Response Summary The produced p53 R273H mutant protein resulted in acquired multidrug resistance in colon cancer cells. Either silencing METTL3 expression by using small interfering RNA (siRNA) or inhibiting RNA methylation with neplanocin A suppressed m6A formation in Cellular tumor antigen p53 (TP53/p53) pre-mRNA, and substantially increased the level of phosphorylated p53 protein (Ser15) and its function in cells heterozygously carrying the R273H mutation, thereby re-sensitizing these cells to anticancer drugs.
Liver cancer [ICD-11: 2C12]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [30]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Apatinib Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response p53 signaling pathway hsa04115
Apoptosis hsa04210
Cell Process Cell apoptosis
In-vitro Model
 QGY-7701 Human papillomavirus-related endocervical adenocarcinoma Homo sapiens CVCL_6859
HHL-5 Normal Homo sapiens CVCL_S956
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model Nude mice (4-6 week-old) were administered sterile water and feed in a specific pathogen-free barrier. Using a 1-mL syringe, 1 × 107 HEPG2 cells were subcutaneously inoculated into the right axilla of nude mice to build the HCC xenograft model. When the tumor volume reached 50 mm3, the nude mice were randomly divided into 1 control (n = 4) and 3 treatment groups (n = 4 each). RG7112, apatinib, and RG7112 + apatinib were administered to the treatment groups and an equal volume of dimethyl sulfoxide to the control group by daily gavage for 14 d. The tumor length (L) and width (W) were measured on alternate days using vernier calipers. The following formula was used to calculate the tumor volume: volume (mm3) = 0.5 × L × W × W. At the end of the experiment, the nude mice were killed by CO2 overdose anesthesia. The tumors were dissected and weighed using a precision balance, and the tumor tissue was stored in liquid nitrogen for further analysis.
Response Summary Cellular tumor antigen p53 (TP53/p53) n6-methyladenosine (m6A) played a decisive role in regulating Hepatocellular carcinoma(HCC) sensitivity to chemotherapy via the p53 activator RG7112 and the vascular endothelial growth factor receptor inhibitor apatinib. p53 mRNA m6A modification blockage induced by S-adenosyl homocysteine or siRNA-mediated METTL3 inhibition enhanced HCC sensitivity to chemotherapy.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [30]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug RG7112 Phase 1
 Drug Info 
Target Regulation Up regulation
Pathway Response p53 signaling pathway hsa04115
Apoptosis hsa04210
Cell Process Cell apoptosis
In-vitro Model
 QGY-7701 Human papillomavirus-related endocervical adenocarcinoma Homo sapiens CVCL_6859
HHL-5 Normal Homo sapiens CVCL_S956
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model Nude mice (4-6 week-old) were administered sterile water and feed in a specific pathogen-free barrier. Using a 1-mL syringe, 1 × 107 HEPG2 cells were subcutaneously inoculated into the right axilla of nude mice to build the HCC xenograft model. When the tumor volume reached 50 mm3, the nude mice were randomly divided into 1 control (n = 4) and 3 treatment groups (n = 4 each). RG7112, apatinib, and RG7112 + apatinib were administered to the treatment groups and an equal volume of dimethyl sulfoxide to the control group by daily gavage for 14 d. The tumor length (L) and width (W) were measured on alternate days using vernier calipers. The following formula was used to calculate the tumor volume: volume (mm3) = 0.5 × L × W × W. At the end of the experiment, the nude mice were killed by CO2 overdose anesthesia. The tumors were dissected and weighed using a precision balance, and the tumor tissue was stored in liquid nitrogen for further analysis.
Response Summary Cellular tumor antigen p53 (TP53/p53) n6-methyladenosine (m6A) played a decisive role in regulating Hepatocellular carcinoma(HCC) sensitivity to chemotherapy via the p53 activator RG7112 and the vascular endothelial growth factor receptor inhibitor apatinib. p53 mRNA m6A modification blockage induced by S-adenosyl homocysteine or siRNA-mediated METTL3 inhibition enhanced HCC sensitivity to chemotherapy.
Renal cell carcinoma [ICD-11: 2C90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [277]
Responsed Disease Renal cell carcinoma [ICD-11: 2C90]
Responsed Drug Erianin Investigative
 Drug Info 
Target Regulation Down regulation
Acute ischemic stroke [ICD-11: 8B11]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [278]
Responsed Disease Acute ischemic stroke [ICD-11: 8B11]
Responsed Drug Remimazolam Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
Senescent cell [ICD-11: MG2A]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [279]
Responsed Disease Senescent cell [ICD-11: MG2A]
In-vitro Model
 WI-38 Normal Homo sapiens CVCL_0579
In-vivo Model 1 μg of labeled RNA was incubated with 500 μg of cell lysates from WI-38 cells at the indicated PDL.
Collagen alpha-1 (III) chain (COL3A1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 2.13E+00
p-value: 6.01E-268
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 3.39E+00 GSE60213
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [31]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Down regulation
In-vitro Model
 MDA-MB-468 Breast adenocarcinoma Homo sapiens CVCL_0419
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
Response Summary METTL3 could down-regulate the expression of Collagen alpha-1 (III) chain (COL3A1) by increasing its m6A methylation, ultimately inhibiting the metastasis of TNBC cells.
Collagenase 3 (MMP13)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line DKO-1 cell line Homo sapiens
Treatment: METTL3 knockdown DKO-1 cell
Control: DKO-1 cell
 GSE182382
Regulation
logFC: 9.33E-01
p-value: 3.02E-02
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 4.73E+00 GSE60213
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [32]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Target Regulation Up regulation
Cell Process Inflammatory response and apoptosis
In-vitro Model
 ATDC-5 Mouse teratocarcinoma Mus musculus CVCL_3894
In-vivo Model The right knee joint of each OA mouse was injected with 1U of type VII collagenase over two consecutive days to obtain experimental OA joint, and the control mice received the equal volume of physiological saline.
Response Summary METTL3 has a functional role in mediates osteoarthritis progression by regulating NF-Kappa-B signaling and ECM synthesis in chondrocytes that shed insight on developing preventive and curative strategies for OA by focusing on METTL3 and mRNA methylation. Silencing of METTL3 promotes degradation of extracellular matrix (ECM) by reducing the expression of Collagenase 3 (MMP13) and Coll X, elevating the expression of Aggrecan and Coll II.
CUB domain-containing protein 1 (CDCP1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 6.56E-01
p-value: 5.99E-11
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.49E+00 GSE60213
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [34]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
In-vitro Model
 UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
T24 Bladder carcinoma Homo sapiens CVCL_0554
SV-HUC-1 Normal Homo sapiens CVCL_3798
RWPE-1 Normal Homo sapiens CVCL_3791
NSTC2 (Nickel-induced transformation of human cells)
MC-SV-HUC T-2 Ureteral tumor cell Homo sapiens CVCL_6418
16HBE14o- Normal Homo sapiens CVCL_0112
In-vivo Model To test for malignant transformation, 1×107 cells were inoculated subcutaneously in the dorsal thoracic midline of ten NOD/SCID mice (Weitong Lihua Experimental Animal Technology Co. Ltd). Tumor formation and growth were assessed every 3 days.
Response Summary m6A methyltransferase METTL3 and demethylases ALKBH5 mediate the m6A modification in 3'-UTR of CDCP1 mRNA. METTL3 and CUB domain-containing protein 1 (CDCP1) are upregulated in the bladder cancer patient samples and the expression of METTL3 and CDCP1 is correlated with the progression status of the bladder cancers.
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [281]
Responsed Disease Gastric cancer [ICD-11: 2B72]
In-vitro Model
 HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
Cyclin-dependent kinase inhibitor 1 (CDKN1A)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 7.88E-01
p-value: 3.07E-21
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 9.39E+00 GSE60213
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [28]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation Up regulation
Pathway Response p53 signaling pathway hsa04115
Cell cycle hsa04110
Cell Process Cell apoptosis
Cells in G4/M phase decreased
In-vitro Model
 THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
MOLT-4 Adult T acute lymphoblastic leukemia Homo sapiens CVCL_0013
Kasumi-1 Myeloid leukemia with maturation Homo sapiens CVCL_0589
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
HL-60 Adult acute myeloid leukemia Homo sapiens CVCL_0002
HEL Erythroleukemia Homo sapiens CVCL_0001
CCRF-CEM C7 T acute lymphoblastic leukemia Homo sapiens CVCL_6825
HEK293T Normal Homo sapiens CVCL_0063
Response Summary METTL3 and METTL14 play an oncogenic role in acute myeloid leukemia(AML) by targeting mdm2/p53 signal pathway. The knockdown of METTL3 and METTL14 in K562 cell line leads to several changes in the expression of p53 signal pathway, including the upregulation of p53, cyclin dependent kinase inhibitor 1A (CDKN1A/Cyclin-dependent kinase inhibitor 1 (CDKN1A)), and downregulation of mdm2.
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [36]
Responsed Disease Esophageal squamous cell carcinoma [ICD-11: 2B70.1]
Target Regulation Down regulation
Pathway Response Cell cycle hsa04110
Cell Process Arrest cell cycle at G2/M phase
In-vitro Model
 TE-1 Esophageal squamous cell carcinoma Homo sapiens CVCL_1759
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
In-vivo Model Totally 5 × 106 ESCC cells after treatment were administered to randomized animals by the subcutaneous route (right flank) in 200 uL DMEM. Tumor measurement was performed every other day. At study end (at least 3 weeks), the animals underwent euthanasia, and the tumors were extracted for histology.
Response Summary METTL3 modulates the cell cycle of Esophageal squamous cell carcinoma(ESCC) cells through a Cyclin-dependent kinase inhibitor 1 (CDKN1A)-dependent pattern. METTL3-guided m6A modification contributes to the progression of ESCC via the p21-axis.
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [37]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Down regulation
In-vitro Model
 ZR-75-1 Invasive breast carcinoma Homo sapiens CVCL_0588
SUM1315MO2 Invasive breast carcinoma of no special type Homo sapiens CVCL_5589
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
HBL-100 Normal Homo sapiens CVCL_4362
BT-474 Invasive breast carcinoma Homo sapiens CVCL_0179
In-vivo Model About 1 × 107 stable METTL3 overexpression and negative control SUM-1315 cells were injected subcutaneously into the axilla of the female BALB/C nude mice (4-6 weeks old, 18-20 g, 10 mice/group). One week after injection, the two groups, METTL3 OE and NC, were then randomly allocated into the control group and experimental group (5 mice/group), which were treated with PBS or metformin (250 mg/kg/dose, respectively). PBS or metformin was administered every 2 days via intraperitoneal injection.
Response Summary METTL3 is able to promote breast cancer cell proliferation by regulating the Cyclin-dependent kinase inhibitor 1 (CDKN1A) expression by an m6A-dependent manner. Metformin can take p21 as the main target to inhibit such effect.
Ageing-related disease [ICD-11: 9B10-9B60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [283]
Responsed Disease Ageing-related disease [ICD-11: 9B10-9B60]
Target Regulation Up regulation
In-vitro Model
 HCT 116 TP53(-/-) Colon carcinoma Homo sapiens CVCL_HD97
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Cytochrome P450 1B1 (CYP1B1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 1.33E+00
p-value: 1.93E-05
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.72E+00 GSE60213
Urinary/pelvic organs injury [ICD-11: NB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [38]
Responsed Disease Injury of kidney [ICD-11: NB92.0]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell apoptosis
In-vitro Model
 NRK-52E Normal Rattus norvegicus CVCL_0468
In-vivo Model Rats were anesthetized and incised through the midline of the abdomen, and the left renal vertebral arch and arteries were blocked for 45 min, thereby resulting in left kidney ischemia. At the same time, the right kidney was removed, further aggravating the degree of left kidney injury.
Response Summary METTL3 contributes to renal ischemia-reperfusion injury by regulating Foxd1 methylation. When METTL3 was inhibited, m6A levels were accordingly decreased and cell apoptosis was suppressed in the H/R in vitro model. Based on MeRIP sequencing, transcription factor activating enhancer binding protein 2-alpha (tfap2a), Cytochrome P450 1B1 (CYP1B1), and forkhead box D1 (foxd1) were significantly differentially expressed, as was m6A, which is involved in the negative regulation of cell proliferation and kidney development.
Death-associated protein kinase 2 (DAPK2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -2.25E+00
p-value: 1.26E-07
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 6.83E+00 GSE60213
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [39]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Down regulation
In-vitro Model
 NCI-H838 Lung adenocarcinoma Homo sapiens CVCL_1594
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
In-vivo Model The nude mice were maintained under pathogen-free conditions and kept under timed lighting conditions mandated by the committee with food and water provided ad libitum. For xenograft experiments, nude mice were injected subcutaneously with 5 × 106 cells resuspended in 0.1 mL PBS. When a tumor was palpable, it was measured every 3 days.
Response Summary Cigarette smoking induced aberrant N6-methyladenosine modification of Death-associated protein kinase 2 (DAPK2), which resulted in decreased DAPK2 mRNA stability and expression of its mRNA and protein. This modification was mediated by the m6A "writer" METTL3 and the m6A "reader" YTHDF2. BAY 11-7085, a NF-Kappa-B signaling selective inhibitor, was shown to efficiently suppressed downregulation of DAPK2-induced oncogenic phenotypes of NSCLC cells.
Developmentally-regulated GTP-binding protein 1 (DRG1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Pancreatic islets Mus musculus
Treatment: Mettl3 knockout mice
Control: Mettl3 flox/flox mice
 GSE155612
Regulation
logFC: 6.62E-01
p-value: 3.32E-04
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.01E+01 GSE60213
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [40]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Target Regulation Up regulation
Cell Process Cell cycle
Cell apoptosis
In-vitro Model
 143B Osteosarcoma Homo sapiens CVCL_2270
hFOB 1.19 Normal Homo sapiens CVCL_3708
MG-63 Osteosarcoma Homo sapiens CVCL_0426
SaOS-2 Osteosarcoma Homo sapiens CVCL_0548
U2OS Osteosarcoma Homo sapiens CVCL_0042
Response Summary ELAVL1 knockdown impaired the stability of DRG1 mRNA, thereby reducing both the mRNA and protein levels of Developmentally-regulated GTP-binding protein 1 (DRG1). In all, DRG1 exerted tumorigenic effects in osteosarcoma, and the up-regulation of DRG1 in OS was induced by METTL3 and ELAVL1 in an m6A-dependent manner.
DNA polymerase kappa (Pol Kappa/POLK)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: 8.09E-01
p-value: 1.19E-26
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.90E+00 GSE60213
Exposure to radiation [ICD-11: PH73]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [41]
Responsed Disease Exposure to radiation [ICD-11: PH73]
Target Regulation Up regulation
Cell Process DNA repair
Nucleotide excision repair (hsa03420)
In-vitro Model
 A-375 Amelanotic melanoma Homo sapiens CVCL_0132
U2OS Osteosarcoma Homo sapiens CVCL_0042
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
MEF (Mouse embryonic fibroblasts)
U2OS Osteosarcoma Homo sapiens CVCL_0042
Response Summary Methylation at the 6 position of adenosine (m6A) in RNA is rapidly (within 2 min) and transiently induced at DNA damage sites in response to ultraviolet irradiation. This modification occurs on numerous poly(A)+ transcripts and is regulated by the methyltransferase METTL3 and the demethylase FTO. DNA DNA polymerase kappa (Pol Kappa/POLK), which has been implicated in both nucleotide excision repair and trans-lesion synthesis, required the catalytic activity of METTL3 for immediate localization to ultraviolet-induced DNA damage sites.
DNA replication licensing factor MCM6 (MCM6)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3-deficient liver
Control: Wild type liver cells
 GSE197800
Regulation
logFC: 2.47E+00
p-value: 3.65E-08
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.92E+00 GSE60213
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [42]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 GES-1 Normal Homo sapiens CVCL_EQ22
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
MKN74 Gastric tubular adenocarcinoma Homo sapiens CVCL_2791
pGCC (Primary GC cells)
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
In-vivo Model A total of 2 × 106 GC cells were injected into the flank of nude mice in a 1:1 suspension of BD Matrigel (BD Biosciences) in phosphate-buffered saline (PBS) solution.
Response Summary In gastric cancer, several component molecules (e.g., MCM5, DNA replication licensing factor MCM6 (MCM6), etc.) of MYC target genes were mediated by METTL3 via altered m6A modification.
E3 ubiquitin-protein ligase TRIM7 (TRIM7)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: -1.54E+00
p-value: 1.28E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 7.18E+00 GSE60213
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [43]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Target Regulation Down regulation
Pathway Response Ubiquitin mediated proteolysis hsa04120
Cell Process Proteasome pathway degradation
In-vitro Model
 U2OS Osteosarcoma Homo sapiens CVCL_0042
SaOS-2 Osteosarcoma Homo sapiens CVCL_0548
MG-63 Osteosarcoma Homo sapiens CVCL_0426
HOS Osteosarcoma Homo sapiens CVCL_0312
hFOB 1.19 Normal Homo sapiens CVCL_3708
In-vivo Model MG63 cells transduced with lentivirus expressing shTRIM7 or shNC, and SAOS2 cells transduced with lentivirus expressing TRIM7, BRMS1, TRIM7 plus BRMS1 or control vector, were injected via the tail vein into the nude mice (1 × 106 cells/mouse) (n = 11 per group).
Response Summary E3 ubiquitin-protein ligase TRIM7 (TRIM7) mRNA stability was regulated by the METTL3/14-YTHDF2-mRNA in a decay-dependent manner. TRIM7 plays a key role in regulating metastasis and chemoresistance in osteosarcoma through ubiquitination of BRMS1.
eIF4E-binding protein 1 (4EBP1/EIF4EBP1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MOLM-13 cell line Homo sapiens
Treatment: shMETTL3 MOLM13 cells
Control: MOLM13 cells
 GSE98623
Regulation
logFC: 8.71E-01
p-value: 3.32E-08
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 9.71E+00 GSE60213
Retina cancer [ICD-11: 2D02]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [44]
Responsed Disease Retinoblastoma [ICD-11: 2D02.2]
Responsed Drug Rapamycin Approved
 Drug Info 
Target Regulation Down regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
mTOR signaling pathway hsa04150
Cell Process Cell proliferation
Cell migration
Cell invasion
Cell apoptosis
In-vitro Model
 WERI-Rb-1 Retinoblastoma Homo sapiens CVCL_1792
Y-79 Retinoblastoma Homo sapiens CVCL_1893
In-vivo Model To establish a subcutaneous tumour model in nude mice, 2 × 107 Y79 cells (METTL3 knockdown group: shNC, shRNA1 and shRNA2; METTL3 up-regulated group: NC and METLL3) were resuspended in 1 mL of pre-cooled PBS, and 200 uL of the cell suspension was injected subcutaneously into the left side of the armpit to investigate tumour growth (4 × 106 per mouse).
Response Summary METTL3 promotes the progression of retinoblastoma through PI3K/AKT/mTOR pathways in vitro and in vivo. METTL3 has an impact on the PI3K-AKT-mTOR-P70S6K/eIF4E-binding protein 1 (4EBP1/EIF4EBP1) pathway. The cell proliferation results show that the stimulatory function of METTL3 is lost after rapamycin treatment.
Endoplasmic reticulum chaperone BiP (Grp78)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: -9.73E-01
p-value: 3.50E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.24E+00 GSE60213
Diseases of the musculoskeletal system [ICD-11: FC0Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [45]
Responsed Disease Diseases of the musculoskeletal system [ICD-11: FC0Z]
Target Regulation Down regulation
Pathway Response RNA degradation hsa03018
Cell Process RNA stability
In-vitro Model
 MC3T3-E1 Normal Mus musculus CVCL_0409
Response Summary METTL3 knockdown enhanced Endoplasmic reticulum chaperone BiP (Grp78) expression through YTHDF2-mediated RNA degradation, which elicited ER stress, thereby promoting osteoblast apoptosis and inhibiting cell proliferation and differentiation under LPS-induced inflammatory condition.
Ephrin type-A receptor 2 (EphA2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 6.09E-01
p-value: 1.09E-18
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.66E+00 GSE60213
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [46]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Pathway Response PI3K-Akt signaling pathway hsa04151
In-vitro Model
 SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
NCM460 Normal Homo sapiens CVCL_0460
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
In-vivo Model A total of 8 × 106 wild-type (WT) or METTL3-knockdown cells were injected into the dorsal flanks of 6-week-old nude mice. Seven mice were randomly selected to calculate the volume according to the following formula: V = (width2 × length)/2. Mice were euthanized three weeks after injection and tumors removed, weighed, fixed, and embedded for immunohistochemical analysis.
Response Summary Ephrin type-A receptor 2 (EphA2) and VEGFA targeted by METTL3 via different IGF2BP-dependent mechanisms were found to promote vasculogenic mimicry (VM) formation via PI3K/AKT/mTOR and ERK1/2 signaling in CRC.
Far upstream element-binding protein 1 (FUBP1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line DKO-1 cell line Homo sapiens
Treatment: METTL3 knockdown DKO-1 cell
Control: DKO-1 cell
 GSE182382
Regulation
logFC: 6.14E-01
p-value: 4.72E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.31E+00 GSE60213
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [47]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Calu-1 Lung squamous cell carcinoma Homo sapiens CVCL_0608
HEK293T Normal Homo sapiens CVCL_0063
HOP-62 Lung adenocarcinoma Homo sapiens CVCL_1285
In-vivo Model For the in vivo tumorigenicity assay, female BALB/c nude mice (ages 4-5 weeks) were randomly divided into two groups (n = 6/group). Calu1 cells (4 × 106) that had been stably transfected with sh-LCAT3 or scramble were implanted subcutaneously into the nude mice. Tumor growth was measured after one week, and tumor volumes were calculated with the following formula: Volume (cm3) = (length × width2)/2. After four weeks, the mice were euthanized, and the tumors were collected and weighed. For the in vivo tumor invasion assay, 1.2 × 106 scramble or shLCAT3 cells were injected intravenously into the tail vein of nude mice (n = 6/group). 1.5 mg luciferin (Gold Biotech, St Louis, MO, USA) was administered once a week for 4 weeks, to monitor metastases using an IVIS@ Lumina II system (Caliper Life Sciences, Hopkinton, MA, USA).
Response Summary LCAT3 upregulation is attributable to N6-methyladenosine (m6A) modification mediated by methyltransferase like 3 (METTL3), leading to LCAT3 stabilization. LCAT3 as a novel oncogenic lncRNA in the lung, and validated the LCAT3-Far upstream element-binding protein 1 (FUBP1)-MYC axis as a potential therapeutic target for lung adenocarcinomas.
Fatty acid synthase (FASN)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LNCaP cell line Homo sapiens
Treatment: shMETTL3 LNCaP cells
Control: shControl LNCaP cells
 GSE147884
Regulation
logFC: -6.03E-01
p-value: 2.01E-249
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.26E+00 GSE60213
Type 2 diabetes mellitus [ICD-11: 5A11]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [48]
Responsed Disease Type 2 diabetes mellitus [ICD-11: 5A11]
Target Regulation Up regulation
Pathway Response Insulin resistance hsa04931
Cell Process Lipid metabolism
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model Hepatocyte-specific METTL3 knockout mice (TBG-Cre, METTL3 fl/fl) were generated by crossing mice with TBG-Cre Tg mice. METTL3 flox (METTL3 fl/fl) and hepatocyte-specific METTL3 knockout mice (TBG-Cre, METTL3 fl/fl) were used for experiments.
Response Summary Type 2 diabetes (T2D) is characterized by lack of insulin, insulin resistance and high blood sugar. METTL3 silence decreased the m6A methylated and total mRNA level of Fatty acid synthase (FASN), subsequently inhibited fatty acid metabolism. The expression of Acc1, Acly, Dgat2, Ehhadh, Fasn, Foxo, Pgc1a and Sirt1, which are critical to the regulation of fatty acid synthesis and oxidation were dramatically decreased in livers of hepatocyte-specific METTL3 knockout mice.
Forkhead box protein D1 (FOXD1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 8.07E-01
p-value: 2.88E-13
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 6.40E+00 GSE60213
Urinary/pelvic organs injury [ICD-11: NB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [38]
Responsed Disease Injury of kidney [ICD-11: NB92.0]
Target Regulation Down regulation
Cell Process Cell proliferation
Cell apoptosis
In-vitro Model
 NRK-52E Normal Rattus norvegicus CVCL_0468
In-vivo Model Rats were anesthetized and incised through the midline of the abdomen, and the left renal vertebral arch and arteries were blocked for 45 min, thereby resulting in left kidney ischemia. At the same time, the right kidney was removed, further aggravating the degree of left kidney injury.
Response Summary METTL3 contributes to renal ischemia-reperfusion injury by regulating Forkhead box protein D1 (FOXD1) methylation. When METTL3 was inhibited, m6A levels were accordingly decreased and cell apoptosis was suppressed in the H/R in vitro model. Based on MeRIP sequencing, transcription factor activating enhancer binding protein 2-alpha (tfap2a), cytochrome P-450 1B1 (cyp1b1), and forkhead box D1 (foxd1) were significantly differentially expressed, as was m6A, which is involved in the negative regulation of cell proliferation and kidney development.
G1/S-specific cyclin-E1 (CCNE1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -1.64E+00
p-value: 3.22E-09
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 6.94E+00 GSE60213
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [49]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process Cell proliferation
Arrest cell cycle at G1 phase
In-vitro Model
 HT29 Colon cancer Mus musculus CVCL_A8EZ
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
In-vivo Model LoVo cells (5 × 106 cells/ 200 uL PBS) stably transfected with METTL3 knockdown lentiviral vector or control vector were respectively injected subcutaneously into the left flank of each mouse.
Response Summary METTL3 promotes colorectal cancer proliferation by stabilizing G1/S-specific cyclin-E1 (CCNE1) mRNA in an m6A-dependent manner, representing a promising therapeutic strategy for the treatment of CRC.
H/ACA ribonucleoprotein complex subunit DKC1 (DKC1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Pancreatic islets Mus musculus
Treatment: Mettl3 knockout mice
Control: Mettl3 flox/flox mice
 GSE155612
Regulation
logFC: 6.68E-01
p-value: 1.04E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.61E+00 GSE60213
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [50]
Responsed Disease Liver cancer [ICD-11: 2C12]
Target Regulation Down regulation
In-vitro Model
 Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model Athymic BALB/c mice were injected with LCSC cells at the armpit area subcutaneously. The mice were then sacrificed and the tumors recovered.
Response Summary CircMEG3 inhibits the expression of m6A methyltransferase METTL3 dependent on HULC. Moreover, CircMEG3 inhibits the expression of H/ACA ribonucleoprotein complex subunit DKC1 (DKC1), a component of telomere synthetase H/ACA ribonucleoprotein (RNP; catalyst RNA pseudouracil modification) through METTL3 dependent on HULC. These observations provide important basic information for finding effective liver cancer therapeutic targets.
Heat shock protein HSP 90-alpha (HSP90/HSP90AA1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HUVEC cell line Homo sapiens
Treatment: shMETTL3 HUVEC cells
Control: shScramble HUVEC cells
 GSE157544
Regulation
logFC: 6.51E-01
p-value: 1.12E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.19E+00 GSE60213
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [51]
Responsed Disease Glioma [ICD-11: 2A00.0]
Target Regulation Down regulation
Cell Process Cell migration and proliferation
In-vitro Model
 U251 (Fibroblasts or fibroblast like cells)
Response Summary m6A regulated cell proliferation by influencing apoptosis of U251 cells through regulating Heat shock protein HSP 90-alpha (HSP90/HSP90AA1) expression. m6A level was decreased in glioma tissue, which was caused by decreased METTL3 and increased FTO levels.
Hepatocyte nuclear factor 1-alpha (HNF1A/TCF1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: -1.64E+00
p-value: 4.47E-50
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 6.55E+00 GSE60213
Thyroid Cancer [ICD-11: 2D10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [52]
Responsed Disease Thyroid Cancer [ICD-11: 2D10]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Cell migratory
In-vitro Model
 B-CPAP Thyroid gland carcinoma Homo sapiens CVCL_0153
Nthy-ori 3-1 Normal Homo sapiens CVCL_2659
TPC-1 Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
Response Summary Silence of METTL3 inhibited migratory ability and Wnt activity in TPC-1 cells. METTL3 positively regulated the enrichment abundance of Hepatocyte nuclear factor 1-alpha (HNF1A/TCF1) in anti-IGF2BP2. TCF1 was responsible for METTL3-regulated thyroid carcinoma progression via the m6A methylation.
Hepatoma-derived growth factor (HDGF)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -6.20E-01
p-value: 6.85E-14
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.03E+00 GSE60213
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [53]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Pathway Response Glycolysis / Gluconeogenesis hsa00010
Cell Process Glycolysis
In-vitro Model
 HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
NCI-N87 Gastric tubular adenocarcinoma Homo sapiens CVCL_1603
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
In-vivo Model Mice 8 weeks after splenic portal vein injection of BGC823 cells with METTL3 overexpression or vector-transfected cells.
Response Summary Elevated METTL3 expression promotes tumour angiogenesis and glycolysis in Gastric cancer. P300-mediated H3K27 acetylation activation in the promoter of METTL3 induced METTL3 transcription, which stimulated m6A modification of Hepatoma-derived growth factor (HDGF) mRNA, and the m6A reader IGF2BP3 then directly recognised and bound to the m6A site on HDGF mRNA and enhanced HDGF mRNA stability.
Hexokinase-2 (HK2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -2.06E+00
p-value: 3.79E-111
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.17E+00 GSE60213
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [54]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Glycolysis / Gluconeogenesis hsa00010
Cell Process Glucose metabolism
Response Summary METTL3 stabilizes Hexokinase-2 (HK2) and SLC2A1 (GLUT1) expression in colorectal cancer through an m6A-IGF2BP2/3- dependent mechanism.
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [55]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Up regulation
Pathway Response Glycolysis / Gluconeogenesis hsa00010), Central carbon metabolism in cancer
Cell Process Glycolysis
In-vitro Model
 SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
HT-3 Cervical carcinoma Homo sapiens CVCL_1293
Ca Ski Cervical squamous cell carcinoma Homo sapiens CVCL_1100
C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
In-vivo Model Five-week-old male nude BALB/C mice were applied for this animal studies and fed with certified standard diet and tap water ad libitum in a light/dark cycle of 12 h on/12 h off.The assay was performed in accordance with the National Institutes of Health Guide for the Care and Use of Laboratory Animals. Stable transfection of METTL3 knockdown (sh-METTL3) or negative control (sh-blank) in SiHa cells (5 × 106 cells per 0.1 mL) were injected into the flank of mice.
Response Summary METTL3 enhanced the Hexokinase-2 (HK2) stability through YTHDF1-mediated m6A modification, thereby promoting the Warburg effect of CC, which promotes a novel insight for the CC treatment.
High mobility group protein HMGI-C (HMGA2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 4.44E+00
p-value: 5.85E-138
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.68E+00 GSE60213
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [56]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
Pathway Response Transcriptional misregulation in cancer hsa05202
Cell Process Epithelial-mesenchymal transition
Cell autophagy
In-vitro Model
 Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
In-vivo Model To create the xenograft neoplasm system, 40 male BALB/c nude mice aged 5 weeks were randomly separated into sh-NC, sh-circHPS5, sh-circHPS5+CTRL, and sh-circHPS5+SAH groups (n = 5 for each group). HCC cells were subcutaneously injected into the axilla of the nude mice.
Response Summary In hepatocellular carcinoma, METTL3 could direct the formation of circHPS5, and specific m6A controlled the accumulation of circHPS5. YTHDC1 facilitated the cytoplasmic output of circHPS5 under m6A modification. CircHPS5 can act as a miR-370 sponge to regulate the expression of High mobility group protein HMGI-C (HMGA2) and further accelerate hepatocellular carcinoma cell tumorigenesis.
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [57]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 MDA-MB-468 Breast adenocarcinoma Homo sapiens CVCL_0419
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
In-vivo Model Eighteen BALB/C female nude mice aged 4-5 weeks and weighing 15-18 g were randomly assigned into three groups of six mice. The MCF-7 cell lines stably transfected with sh-NC + oe-NC, sh-METTL3 + oe-NC and sh-METTL3 + oe-HMGA2 were selected for subcutaneous establishment of the BC cell line MCF-7 as xenografts in the nude mice. For this purpose, MCF-7 cell lines in the logarithmic growth stage were prepared into a suspension with a concentration of about 1 × 107 cells/ml. The prepared cell suspension was injected into the left armpit of the mice, and the subsequent tumor growth was recorded.
Response Summary Silencing METTL3 down-regulate MALAT1 and High mobility group protein HMGI-C (HMGA2) by sponging miR-26b, and finally inhibit EMT, migration and invasion in BC, providing a theoretical basis for clinical treatment of BC.
Macular disorders [ICD-11: 9B75]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [296]
Responsed Disease Macular disorders [ICD-11: 9B75.04]
Target Regulation Up regulation
Histone-lysine N-methyltransferase EZH2 (EZH2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -1.23E+00
p-value: 1.10E-12
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.01E+00 GSE60213
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [58]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Down regulation
Cell Process Cell viability
In-vitro Model
 BEAS-2B Normal Homo sapiens CVCL_0168
C666-1 Nasopharyngeal carcinoma Homo sapiens CVCL_7949
SUNE1 Nasopharyngeal carcinoma Homo sapiens CVCL_6946
Response Summary METTL3 was highly expressed in nasopharyngeal carcinoma tissues, which inhibited Histone-lysine N-methyltransferase EZH2 (EZH2) expression by mediating m6A modification of EZH2 mRNA.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [59]
Responsed Disease Lung cancer [ICD-11: 2C25]
Target Regulation Up regulation
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Response Summary Simvastatin induces METTL3 down-regulation in lung cancer tissues, which further influences EMT via m6A modification on Histone-lysine N-methyltransferase EZH2 (EZH2) mRNA and thus inhibits the malignant progression of lung cancer.
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [60]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Pathway Response Adherens junction hsa04520
In-vitro Model
 MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary METTL3 is upregulated in Breast Cancer. It could regulate the protein level of Histone-lysine N-methyltransferase EZH2 (EZH2) through m6A modification to promote EMT and metastasis in BCa cells, thereafter aggravating the progression of BCa.
Congenital pneumonia [ICD-11: KB24]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [61]
Responsed Disease Congenital pneumonia [ICD-11: KB24]
Target Regulation Up regulation
Pathway Response JAK-STAT signaling pathway hsa04630
Cell Process Inflammation
In-vitro Model
 HPBM (Human Peripheral Blood Monocytes)
Response Summary METTL3 promotes inflammation and cell apoptosis in a pediatric pneumonia model by regulating Histone-lysine N-methyltransferase EZH2 (EZH2).
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [298]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Responsed Drug Temozolomide Approved
 Drug Info 
Pathway Response RNA degradation hsa03018
Cell Process mRNA decay
In-vitro Model
 U251 (Fibroblasts or fibroblast like cells)
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
In-vivo Model Used to inject 10 uL of the U87 MG-TMZ_R-luc cell suspension in the striatum at a depth of 3 mm from the dural surface. One week after the injection of the tumor cells, 40 mg/kg/day of TMZ in saline was administered for over 2 weeks by intraperitoneal injection.
Response Summary Uncover the fundamental mechanisms underlying the interplay of m6 A RNA modification and histone modification in Temozolomide resistance and emphasize the therapeutic potential of targeting the SOX4/EZH2/METTL3 axis in the treatment of TMZ-resistant glioblastoma.
Homeobox protein Nkx-3.1 (NKX3-1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 1.12E+00
p-value: 7.44E-16
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 7.11E+00 GSE60213
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [62]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Down regulation
Pathway Response Oxidative phosphorylation hsa00190
In-vitro Model
 VCaP Prostate carcinoma Homo sapiens CVCL_2235
RWPE-1 Normal Homo sapiens CVCL_3791
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
DU145 Prostate carcinoma Homo sapiens CVCL_0105
22Rv1 Prostate carcinoma Homo sapiens CVCL_1045
In-vivo Model Approximately 2 × 106 PCa cells (PC-3 shNC, shYTHDF2, shMETTL3 cell lines) per mouse suspended in 100 uL PBS were injected in the flank of male BALB/c nude mice (4 weeks old). During the 40-day observation, the tumor size (V = (width2×length ×0.52)) was measured with vernier caliper. Approximately 1.5 × 106 PCa cells suspended in 100 uL of PBS (PC-3 shNC, shYTHDF2, and shMETTL3 cell lines) per mouse were injected into the tail vein of male BALB/c nude mice (4 weeks old). The IVIS Spectrum animal imaging system (PerkinElmer) was used to evaluate the tumor growth (40 days) and whole metastasis conditions (4 weeks and 6 weeks) with 100 uL XenoLight D-luciferin Potassium Salt (15 mg/ml, Perkin Elmer) per mouse. Mice were anesthetized and then sacrificed for tumors and metastases which were sent for further organ-localized imaging as above, IHC staining and hematoxylin-eosin (H&E) staining.
Response Summary Knock-down of YTHDF2 or METTL3 significantly induced the expression of LHPP and Homeobox protein Nkx-3.1 (NKX3-1) at both mRNA and protein level with inhibited phosphorylated AKT. YTHDF2 mediates the mRNA degradation of the tumor suppressors LHPP and NKX3-1 in m6A-dependent way to regulate AKT phosphorylation-induced tumor progression in prostate cancer.
Homeodomain-interacting protein kinase 2 (HIPK2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -1.67E+00
p-value: 2.62E-66
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.33E+00 GSE60213
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [22]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Doxil Approved
 Drug Info 
Target Regulation Up regulation
Cell Process Cell growth and death
Cell apoptosis
In-vitro Model
 ADR-resistant MCF-7 (MCF-7/ADR) cells (Human breast cancer doxorubicin-resistant cell line)
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
In-vivo Model Cell suspensions (2 × 106 cells/mL) made with MCF-7/ADR cells stably expressing METTL3 and/or miR-221-3p inhibitor were subcutaneously implanted into each mouse. One week later, xenografted mice were injected with 0.1 mL ADR (25 mg/kg, intraperitoneal injection) twice a week.
Response Summary METTL3 promotes adriamycin resistance in MCF-7 breast cancer cells by accelerating pri-microRNA-221-3p maturation in a m6A-dependent manner. METTL3 knockdown was shown to reduce the expression of miR-221-3p by reducing pri-miR-221-3p m6A mRNA methylation, reducing the expression of MDR1 and BCRP, and inducing apoptosis. Identified the METTL3/miR-221-3p/Homeodomain-interacting protein kinase 2 (HIPK2)/Che-1 axis as a novel signaling event that will be responsible for resistance of BC cells to ADR.
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [299]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Responsed Drug Verbascoside Investigative
 Drug Info 
In-vitro Model
 SCC-9 Tongue squamous cell carcinoma Homo sapiens CVCL_1685
UM1 Tongue squamous cell carcinoma Homo sapiens CVCL_VH00
Insulin-like growth factor I (IGF1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line DKO-1 cell line Homo sapiens
Treatment: METTL3 knockdown DKO-1 cell
Control: DKO-1 cell
 GSE182382
Regulation
logFC: -2.21E+00
p-value: 2.40E-02
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 6.27E+00 GSE60213
Ageing-related disease [ICD-11: 9B10-9B60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [63]
Responsed Disease Ageing-related disease [ICD-11: 9B10-9B60]
Target Regulation Up regulation
Pathway Response Nucleotide excision repair hsa03420
Cell Process DNA repair and mitochondrial stress
In-vitro Model
 Mouse fibroblasts (Major cellular components of loose connective tissue)
Response Summary The long-lived endocrine mutants - Snell dwarf, growth hormone receptor deletion and pregnancy-associated plasma protein-A knockout - all show increases in the N6-adenosine-methyltransferases (METTL3/14) that catalyze 6-methylation of adenosine (m6A) in the 5' UTR region of select mRNAs. In addition, these mice have elevated levels of YTHDF1, which recognizes m6A and promotes translation by a cap-independent mechanism. Augmented translation by cap-independent pathways facilitated by m6A modifications contribute to the stress resistance and increased healthy longevity of mice with diminished GH and Insulin-like growth factor I (IGF1) signals.
Integrin subunit beta 3 (ITGB3)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -3.38E+00
p-value: 2.43E-215
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.57E+00 GSE60213
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [64]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation and metastasis
In-vitro Model
 5-8F Nasopharyngeal carcinoma Homo sapiens CVCL_C528
6-10B Nasopharyngeal carcinoma Homo sapiens CVCL_C529
C666-1 Nasopharyngeal carcinoma Homo sapiens CVCL_7949
CNE-1 Normal Homo sapiens CVCL_6888
CNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_6889
HK1 Nasopharyngeal carcinoma Acipenser baerii CVCL_YE27
HNE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_0308
HONE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_8706
N2Tert (The human immortalized nasopharyngeal epithelial cell lines)
NP69 (A human immortalized nasopharyngeal epithelial)
S18 Nasopharyngeal carcinoma Homo sapiens CVCL_B0U9
S26 Nasopharyngeal carcinoma Homo sapiens CVCL_B0UB
SUNE1 Nasopharyngeal carcinoma Homo sapiens CVCL_6946
In-vivo Model For the tumor growth model, 1 × 106 HNE1-Scrambled or HNE1-shFAM2225A 2# cells were injected into the axilla of the mice, and the tumor size was measured every 3 days.
Response Summary FAM225A functioned as a competing endogenous RNA (ceRNA) for sponging miR-590-3p and miR-1275, leading to the upregulation of their target Integrin subunit beta 3 (ITGB3), and the activation of FAK/PI3K/Akt signaling to promote Nasopharyngeal carcinoma cell proliferation and invasion. FAM225A showed lower RNA stability after silencing of METTL3.
Interstitial collagenase (MMP1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -1.11E+00
p-value: 1.30E-35
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 8.91E+00 GSE60213
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [33]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Target Regulation Up regulation
Cell Process Inflammatory response
In-vitro Model
 SW1353 Primary central chondrosarcoma Homo sapiens CVCL_0543
Response Summary METTL3 is involved in OA probably by regulating the inflammatory response. METTL3 overexpression affects extracellular matrix degradation in OA by adjusting the balance between TIMPs and Interstitial collagenase (MMP1).
Kelch-like ECH-associated protein 1 (KEAP1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: -1.79E+00
p-value: 1.23E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.17E+00 GSE60213
Diseases of the urinary system [ICD-11: GC2Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [65]
Responsed Disease Diseases of the urinary system [ICD-11: GC2Z]
Responsed Drug Colistin Approved
 Drug Info 
Target Regulation Down regulation
Cell Process Oxidative stress
Cell apoptosis
In-vivo Model The 60 female Kunming mice were divided into two groups (n = 30): control group (injection of physiological saline through the caudal vein) and colistin group (injection of 15 mg/kg colistin, twice a day, with an eight-hour interval).
Response Summary m6A methylation was involved in oxidative stress-mediated apoptosis in the mechanism of colistin nephrotoxicity. METTL3-mediated m6A methylation modification is involved in colistin-induced nephrotoxicity through apoptosis mediated by Kelch-like ECH-associated protein 1 (KEAP1)/Nrf2 signaling pathway.
Leukocyte surface antigen CD47 (CD47)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 1.18E+00
p-value: 9.07E-25
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 4.98E+00 GSE60213
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [66]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
HCCLM3 Adult hepatocellular carcinoma Homo sapiens CVCL_6832
Response Summary METTL3/IGF2BP1/Leukocyte surface antigen CD47 (CD47) mediated EMT transition contributes to the incomplete ablation induced metastasis in HCC cells.
MAP kinase signal-integrating kinase 2 (MNK2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 1.09E+00
p-value: 4.06E-29
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.25E+00 GSE60213
Muscular dystrophies [ICD-11: 8C70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [67]
Responsed Disease Muscular dystrophies [ICD-11: 8C70]
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
C2C12 Normal Mus musculus CVCL_0188
In-vivo Model For mouse muscle injury and regeneration experiment, tibialis anterior (TA) muscles of 6-week-old male mice were injected with 25 uL of 10 uM cardiotoxin (CTX, Merck Millipore, 217503), 0.9% normal saline (Saline) were used as control. The regenerated muscles were collected at day 1, 3, 5, and 10 post-injection. TA muscles were isolated for Hematoxylin and eosin staining or frozen in liquid nitrogen for RNA and protein extraction.
Response Summary m6A writers METTL3/METTL14 and the m6A reader YTHDF1 orchestrate MAP kinase signal-integrating kinase 2 (MNK2) expression posttranscriptionally and thus control ERK signaling, which is required for the maintenance of muscle myogenesis and contributes to regeneration.
Metalloproteinase inhibitor 1 (TIMP-1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -1.77E+00
p-value: 2.62E-61
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.26E+00 GSE60213
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [33]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Target Regulation Down regulation
Cell Process Inflammatory response
In-vitro Model
 SW1353 Primary central chondrosarcoma Homo sapiens CVCL_0543
Response Summary METTL3 is involved in OA probably by regulating the inflammatory response. METTL3 overexpression affects extracellular matrix degradation in OA by adjusting the balance between Metalloproteinase inhibitor 1 (TIMP-1) and MMPs.
Vascular disorders of the liver [ICD-11: DB98]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [307]
Responsed Disease Vascular disorders of the liver [ICD-11: DB98.8]
Metalloproteinase inhibitor 2 (TIMP2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 6.36E-01
p-value: 3.68E-18
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.22E+00 GSE60213
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [33]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Target Regulation Down regulation
Cell Process Inflammatory response
In-vitro Model
 SW1353 Primary central chondrosarcoma Homo sapiens CVCL_0543
Response Summary METTL3 is involved in OA probably by regulating the inflammatory response. METTL3 overexpression affects extracellular matrix degradation in OA by adjusting the balance between Metalloproteinase inhibitor 2 (TIMP2) and MMPs.
Chronic kidney disease [ICD-11: GB61]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [68]
Responsed Disease Chronic kidney disease [ICD-11: GB61.Z]
Target Regulation Up regulation
Pathway Response Notch signaling pathway hsa04330
In-vitro Model
 MPC-5 Normal Mus musculus CVCL_AS87
In-vivo Model After 7 days of acclimatization, STZ, dissolved in 0.1 M citrate buffer, was intraperitoneally administered daily to mice at a dose of 50 mg/kg after 12 h of food deprivation each day for 5 consecutive days. The type 1 mice diabetic mice were randomly separated into four groups (n = 5-8): AAV9-scramble-control group; AAV9-scramble-STZ; AAV9-shRNA-control; and AAV9-shRNA-STZ group (Hanbio Biotechnology, China). The 50 UL titer of 1 × 1012 virus was injected into the renal pelvis using an insulin needle and maintained there for 2 to 3 s. The type 2 diabetic mice were randomly separated into four groups (n = 5-8): AAV9-scramble-db/m group; AAV9-scramble-db/db group; AAV9-shRNA-db/m group; and AAV9-shRNA-db/db group (Hanbio Biotechnology, China). The 100 UL titer of 1 × 1012 virus was injected into the tail vein using an insulin needle and maintained there for 2 to 3 s. Blood glucose was monitored weekly in mice. At the end of 12 weeks, the 24-h urine samples were collected from the mice kept in metabolic cages.
Response Summary METTL3 modulated Notch signaling via the m6A modification of Metalloproteinase inhibitor 2 (TIMP2) in IGF2BP2-dependent manner and exerted pro-inflammatory and pro-apoptotic effects. This study suggested that METTL3-mediated m6A modification is an important mechanism of podocyte injury in DN.
Methylated-DNA--protein-cysteine methyltransferase (MGMT)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: -1.79E+00
p-value: 2.16E-20
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 5.15E+00 GSE60213
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [69]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Responsed Drug Temozolomide Approved
 Drug Info 
Target Regulation Down regulation
Pathway Response Nucleotide excision repair hsa03420
Cell Process DNA repair
In-vitro Model
 U251 (Fibroblasts or fibroblast like cells)
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
In-vivo Model Subcutaneously injected shMETTL3 or shNC-expressing U87-MG-TMZ cells into BALB/c NOD mice. After confirmation of GBM implantation, mice were treated with TMZ (66 mg/kg/d, 5 d per week, for 3 cycles).
Response Summary Two critical DNA repair genes (Methylated-DNA--protein-cysteine methyltransferase (MGMT) and APNG) were m6A-modified by METTL3, whereas inhibited by METTL3 silencing or DAA-mediated total methylation inhibition, which is crucial for METTL3-improved temozolomide resistance in glioblastoma cells.
Glioblastoma multiforme [ICD-11: XH0MB1]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [287]
Responsed Disease Glioblastoma multiforme [ICD-11: XH0MB1]
Target Regulation Up regulation
In-vitro Model
 GSC11 Glioblastoma Homo sapiens CVCL_DR55
GSC23 Glioblastoma Homo sapiens CVCL_DR59
In-vivo Model To establish the xenograft model of GSCs in mice, GSCs or METTL3 knocking-down GSCs (v/v = 1:1) were subcutaneously inoculated into the right posterior limb of BALB/c nude mice (5 × 106 cells/mice, 4-week-old, female, body weight of 20 g). Tumor volume was measured with calipers every 3 days. The tumor size was calculated using the formula: (a2 × b)/2 (a: width in mm, b: length in mm). After about 27 days, all mice were sacrificed under general anesthesia and the xenografts were harvested for further pathological study.
Methylcytosine dioxygenase TET1 (TET1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 1.21E+00
p-value: 3.76E-06
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 6.94E+00 GSE60213
Chronic pain [ICD-11: MG30]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [70]
Responsed Disease Chronic pain [ICD-11: MG30]
Target Regulation Down regulation
Response Summary Downregulated spinal cord METTL3 coordinating with YTHDF2 contributes to the modulation of inflammatory pain through stabilizing upregulation of Methylcytosine dioxygenase TET1 (TET1) in spinal neurons.
Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B/LC3B-II)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 6.38E-01
p-value: 4.93E-09
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.34E+00 GSE60213
Enterovirus [ICD-11: 1A2Y]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Enterovirus [ICD-11: 1A2Y]
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cell proliferation and metastasis
Cell apoptosis
Cell autophagy
In-vitro Model
 Schwann cells (A type of glial cell that surrounds neurons)
Response Summary Knocking down METTL3 prevented Enterovirus 71-induced cell death and suppressed Enterovirus 71-induced expression of Bax while rescuing Bcl-2 expression after Enterovirus 71 infection. Knocking down METTL3 inhibited Enterovirus 71-induced expression of Atg5, Atg7 and Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B/LC3B-II). Knocking down METTL3 inhibited Enterovirus 71-induced apoptosis and autophagy.
Lung cancer [ICD-11: 2C25]
In total 3 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Chloroquine Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model
 Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, ATG7, LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B/LC3B-II). beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Gefitinib Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model
 Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, ATG7, LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B/LC3B-II). beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Beta-Elemen Phase 3
 Drug Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model
 Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, ATG7, LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B/LC3B-II). beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Mitogen-activated protein kinase 14 (p38/MAPK14)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: -3.87E+00
p-value: 1.84E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.30E+00 GSE60213
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [71]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Target Regulation Up regulation
In-vitro Model
 SCC-25 Tongue squamous cell carcinoma Homo sapiens CVCL_1682
SCC-15 Tongue squamous cell carcinoma Homo sapiens CVCL_1681
In-vivo Model Male BALB/c-nu/nu mice, 9-10 weeks of age, were acclimatized for a week prior to the experiments. Nude mice (6 each group) were subcutaneously inoculated with 4 × 106 SCC-25 or SCC-15 cells through an injection into the center of the back, which consistently caused tumor formation within 1 week of inoculation. To monitor the initial tumor appearance, animals were observed every day. After tumor appeared, measurements were made every week with a caliper. After 28 days, mice were sacrificed and tumors were dissected out to be weighed.
Response Summary High METTL3 expression was positively correlated with more severe clinical features of OSCC tumors. Furthermore, METTL3-KD and cycloleucine, a methylation inhibitor, decreased m6A levels and down-regulated Mitogen-activated protein kinase 14 (p38/MAPK14) expression in OSCC cells.
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [72]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
Pathway Response MAPK signaling pathway hsa04010
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
KM12 Colon carcinoma Homo sapiens CVCL_1331
Response Summary METTL3 played a tumor-suppressive role in Colorectal cancer cell proliferation, migration and invasion through Mitogen-activated protein kinase 14 (p38/MAPK14)/ERK pathways, which indicated that METTL3 was a novel marker for CRC carcinogenesis, progression and survival.
Mutated in multiple advanced cancers 1 (PTEN)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 9.60E-01
p-value: 1.46E-37
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.25E+00 GSE60213
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation Up regulation
Cell Process Cell differentiation and apoptosis
Apoptosis (hsa04210)
In-vitro Model
 HSPC (Human hematopoietic stem cell)
In-vivo Model 500,000 selected cells were injected via tail vein or retro-orbital route into female NSG (6-8 week old) recipient mice that had been sublethally irradiated with 475 cGy one day before transplantation.
Response Summary METTL3 depletion in human myeloid leukemia cell lines induces cell differentiation and apoptosis and delays leukemia progression in recipient mice in vivo. Single-nucleotide-resolution mapping of m6A coupled with ribosome profiling reveals that m6A promotes the translation of c-MYC, BCL2 and Mutated in multiple advanced cancers 1 (PTEN) mRNAs in the human acute myeloid leukemia MOLM-13 cell line. Moreover, loss of METTL3 leads to increased levels of phosphorylated AKT.
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [73]
Responsed Disease Chronic myeloid leukaemia [ICD-11: 2B33.2]
Target Regulation Down regulation
Pathway Response Autophagy hsa04140
Cell Process RNA stability
Cell autophagy
In-vitro Model
 K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KCL-22 Chronic myelogenous leukemia Homo sapiens CVCL_2091
In-vivo Model In the control mice or ADR mice group, the parental or chemo-resistant K562 cells were infected with LV-shCtrl. In the ADR + shLINC00470 group, the chemo-resistant K562 cells were infected with LV- shLINC00470. These cells were injected, respectively, into these 5-week-old mice subcutaneously.
Response Summary The molecular mechanism underlying the effect of LINC00470 on chronic myelocytic leukaemia by reducing the Mutated in multiple advanced cancers 1 (PTEN) stability via RNA methyltransferase METTL3, thus leading to the inhibition of cell autophagy while promoting chemoresistance in CML.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [74]
Responsed Disease Lung cancer [ICD-11: 2C25]
Target Regulation Down regulation
In-vitro Model
 NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
In-vivo Model Four-week-old BALB/c nude mice were randomly divided into three groups: (1) vector group, (2) vector + Bete-elemene group, and (3) Bete-elemene + METTL3 group. Nude mice were raised in an SPF level animal house and were free to eat and drink. Mice in the vector group were subcutaneously injected with lung cancer cells transfected with empty vector and did not receive Bete-elemene administration, and this group was implemented as the negative control. Following establishing orthotopic xenografts by using A549 or H1299 cells transfected with empty vector, mice in the vector + Bete-elemene group underwent intraperitoneal injection with Bete-elemene once a day. For the subcutaneous transplanted model, A549 or H1299 cells transfected with METTL3-overexpressing vector were inoculated into mice from the Bete-elemene + METTL3 group. Then, mice were intraperitoneally administrated with Bete-elemene once a day. Three weeks later, all the animals were euthanized with CO2. Xenografts were removed and weighted after mice were euthanatized.
Response Summary Bete-elemene exerted the restrictive impacts on the cell growth of lung cancer in vivo and in vitro through targeting METTL3. Bete-elemene contributed to the augmented PTEN expression via suppressing its m6A modification.
Pulmonary hypertension [ICD-11: BB01]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [75]
Responsed Disease Pulmonary hypertension due to lung disease or hypoxia [ICD-11: BB01.2]
Target Regulation Down regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process Cell apoptosis
In-vitro Model
 PASMC cell line (Pulmonary artery smooth muscle cell)
In-vivo Model 10 rats were divided into control and HPH group. In detail, 5 rats of the hypoxia groups were exposed to hypoxia (10%O2) chamber (AiPu XBS-02B, China) for 4 weeks. In addition, 5 rats of control group were kept under normoxic conditions (21% O2) for 4 weeks. Rats were housed in standard polypropylene cages under controlled photocycle (12 h light/12 h dark) under 22-25 ℃ temperature.
Response Summary METTL3/YTHDF2/Mutated in multiple advanced cancers 1 (PTEN) axis exerts a significant role in hypoxia induced PASMCs proliferation, providing a novel therapeutic target for hypoxic pulmonary hypertension.
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [241]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Down regulation
Myc proto-oncogene protein (MYC)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LNCaP cell line Homo sapiens
Treatment: shMETTL3 LNCaP cells
Control: shControl LNCaP cells
 GSE147884
Regulation
logFC: -6.39E-01
p-value: 4.30E-103
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.10E+00 GSE60213
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation Up regulation
Cell Process Cell differentiation and apoptosis
Apoptosis (hsa04210)
In-vitro Model
 HSPC (Human hematopoietic stem cell)
In-vivo Model 500,000 selected cells were injected via tail vein or retro-orbital route into female NSG (6-8 week old) recipient mice that had been sublethally irradiated with 475 cGy one day before transplantation.
Response Summary METTL3 depletion in human myeloid leukemia cell lines induces cell differentiation and apoptosis and delays leukemia progression in recipient mice in vivo. Single-nucleotide-resolution mapping of m6A coupled with ribosome profiling reveals that m6A promotes the translation of Myc proto-oncogene protein (MYC), BCL2 and PTEN mRNAs in the human acute myeloid leukemia MOLM-13 cell line. Moreover, loss of METTL3 leads to increased levels of phosphorylated AKT.
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [77]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Target Regulation Up regulation
Pathway Response RNA degradation hsa03018
Cell Process RNA stability
In-vitro Model
 CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
NHOK (Normal oral keratinocytes)
SCC-15 Tongue squamous cell carcinoma Homo sapiens CVCL_1681
SCC-25 Tongue squamous cell carcinoma Homo sapiens CVCL_1682
TSCCa Endocervical adenocarcinoma Homo sapiens CVCL_VL15
In-vivo Model The stable transfection of SCC25 cells (1 × 107 cells in 0.1 mL) with lenti-sh-METTL3 or blank vectors was injected subcutaneously into BALB/c nude mice.
Response Summary In oral squamous cell carcinoma, YTH N6-methyladenosine RNA binding protein 1 (YTH domain family, member 1 [YTHDF1]) mediated the m6A-increased stability of Myc proto-oncogene protein (MYC) mRNA catalyzed by METTL3.
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [42]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 GES-1 Normal Homo sapiens CVCL_EQ22
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
MKN74 Gastric tubular adenocarcinoma Homo sapiens CVCL_2791
pGCC (Primary GC cells)
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
In-vivo Model A total of 2 × 106 GC cells were injected into the flank of nude mice in a 1:1 suspension of BD Matrigel (BD Biosciences) in phosphate-buffered saline (PBS) solution.
Response Summary In gastric cancer, several component molecules (e.g., MCM5, MCM6, etc.) of Myc proto-oncogene protein (MYC) target genes were mediated by METTL3 via altered m6A modification.
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [79]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Cell Process Cell proliferation
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
Caco-2 Colon adenocarcinoma Homo sapiens CVCL_0025
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model METTL3 stable knockdown or overexpression HCT116 cells were collected and resuspended at a density of 5 × 106 or 3 × 106 cells per 150 uL PBS.
Response Summary METTL3 exerted its function through enhancing Myc proto-oncogene protein (MYC) expression, at least partially in an m6A-IGF2BP1-dependent manner. Knockdown of METTL3 suppressed colorectal cancer cell proliferation in vitro and in vivo.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [47]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Calu-1 Lung squamous cell carcinoma Homo sapiens CVCL_0608
HEK293T Normal Homo sapiens CVCL_0063
HOP-62 Lung adenocarcinoma Homo sapiens CVCL_1285
In-vivo Model For the in vivo tumorigenicity assay, female BALB/c nude mice (ages 4-5 weeks) were randomly divided into two groups (n = 6/group). Calu1 cells (4 × 106) that had been stably transfected with sh-LCAT3 or scramble were implanted subcutaneously into the nude mice. Tumor growth was measured after one week, and tumor volumes were calculated with the following formula: Volume (cm3) = (length × width2)/2. After four weeks, the mice were euthanized, and the tumors were collected and weighed. For the in vivo tumor invasion assay, 1.2 × 106 scramble or shLCAT3 cells were injected intravenously into the tail vein of nude mice (n = 6/group). 1.5 mg luciferin (Gold Biotech, St Louis, MO, USA) was administered once a week for 4 weeks, to monitor metastases using an IVIS@ Lumina II system (Caliper Life Sciences, Hopkinton, MA, USA).
Response Summary LCAT3 upregulation is attributable to N6-methyladenosine (m6A) modification mediated by methyltransferase like 3 (METTL3), leading to LCAT3 stabilization. LCAT3 as a novel oncogenic lncRNA in the lung, and validated the LCAT3-FUBP1-Myc proto-oncogene protein (MYC) axis as a potential therapeutic target for lung adenocarcinomas.
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [81]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 LNCaP C4-2 Prostate carcinoma Homo sapiens CVCL_4782
DU145 Prostate carcinoma Homo sapiens CVCL_0105
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
Response Summary METTL3 enhanced Myc proto-oncogene protein (MYC) expression by increasing m6A levels of MYC mRNA transcript, leading to oncogenic functions in prostate cancer.
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Cell Process Glucose metabolism
Response Summary AF4/FMR2 family member 4 (AFF4), two key regulators of NF-Kappa-B pathway (IKBKB and RELA) and Myc proto-oncogene protein (MYC) were further identified as direct targets of METTL3-mediated m6A modification.overexpression of METTL3 significantly promoted Bladder cancer cell growth and invasion.
Polycystic kidney disease [ICD-11: GB81]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [82]
Responsed Disease Polycystic kidney disease [ICD-11: GB81]
Target Regulation Up regulation
In-vitro Model
 mIMCD-3 Normal Mus musculus CVCL_0429
In-vivo Model The clone, with one wild-type Mettl3 allele and one L1L2_Bact_P cassette inserted allele, was injected into C57BL/6 blastocysts. Mettl3-targeted mouse line was established from a germline-transmitting chimera. The chimeric mouse was crossed to C57BL/6 Flp mice to excise the neomycin resistance system.
Response Summary Mettl3 activates the cyst-promoting c-Myc and cAMP pathways through enhanced Myc proto-oncogene protein (MYC) and Avpr2 mRNA m6A modification and translation. Thus, Mettl3 promotes Autosomal dominant polycystic kidney disease and links methionine utilization to epitranscriptomic activation of proliferation and cyst growth.
Diffuse large B-cell lymphomas [ICD-11: 2A81]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [311]
Responsed Disease Diffuse large B-cell lymphomas [ICD-11: 2A81]
Target Regulation Up regulation
In-vitro Model
 SU-DHL-4 Diffuse large B-cell lymphoma Homo sapiens CVCL_0539
DB Diffuse large B-cell lymphoma germinal center B-cell type Homo sapiens CVCL_1168
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [312]
Responsed Disease Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
Target Regulation Up regulation
In-vitro Model
 Eca-109 Esophageal squamous cell carcinoma Homo sapiens CVCL_6898
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
In-vivo Model BALB/c-nu mice (5-6 weeks) were purchased from Sun Yat-sen University (SYSU) Animal Center. The mice were housed in a pathogen-free environment at the SYSU Animal Center. To establish a human ESCC xenograft model, 20 BALB/c-nu mice were randomly assigned to four groups, with each group consisting of five mice. Two groups of mice received a subcutaneous injection of either 2.0 × 106 Eca109 cells or 2.0 × 106 sh-METTL3-Eca109 cells. Tumor development was monitored daily. After one week, each mice was subjected to intratumoral injection of 10 μl PBS or Fn (1.0 × 107 CFU) once every two days, three times a week. The mice were sacrifices at the end of two weeks after the injection, and subsequently, the tumor, liver, and lungs were surgically removed. The following formula was used to determine tumor volume: 0.5× (length × width2).
Myeloid differentiation primary response protein MyD88 (MYD88)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MOLM-13 cell line Homo sapiens
Treatment: shMETTL3 MOLM13 cells
Control: MOLM13 cells
 GSE98623
Regulation
logFC: -1.07E+00
p-value: 1.83E-13
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.16E+00 GSE60213
Pulpitis [ICD-11: DA09]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [83]
Responsed Disease Pulpitis [ICD-11: DA09]
Target Regulation Down regulation
Pathway Response MAPK signaling pathway hsa04010
Cell Process Alternative splicing
Response Summary Knocked down METTL3 and demonstrated that METTL3 depletion decreased the expression of inflammatory cytokines and the phosphorylation of IKK-alpha/beta, p65 and IKappa-B-alpha in the NF-Kappa-B signalling pathway as well as p38, ERK and JNK in the MAPK signalling pathway in LPS-induced HDPCs. METTL3 inhibits the LPS-induced inflammatory response of HDPCs by regulating alternative splicing of Myeloid differentiation primary response protein MyD88 (MYD88).
Skeletal anomaly [ICD-11: LD24]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [84]
Responsed Disease Skeletal anomaly [ICD-11: LD24]
Target Regulation Up regulation
Pathway Response Central carbon metabolism in cancer hsa05230
Cell Process Glucose metabolism
In-vitro Model
 Mesenchymal stem cell line (NP tissues were used to isolate NP cells)
Response Summary METTL3 positively regulates expression of Myeloid differentiation primary response protein MyD88 (MYD88), a critical upstream regulator of NF-Kappa-B signaling, by facilitating m6A methylation modification to MYD88-RNA, subsequently inducing the activation of NF-Kappa-B which is widely regarded as a repressor of osteogenesis and therefore suppressing osteogenic progression. The METTL3-mediated m6A methylation is found to be dynamically reversed by the demethylase ALKBH5.
NACHT, LRR and PYD domains-containing protein 3 (NLRP3)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 8.32E-01
p-value: 1.76E-06
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 7.81E+00 GSE60213
Atherosclerosis [ICD-11: BD40]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [85]
Responsed Disease Atherosclerosis [ICD-11: BD40.Z]
Target Regulation Up regulation
In-vitro Model
 MAEC Normal Mus musculus CVCL_U411
HUVEC-C Normal Homo sapiens CVCL_2959
Response Summary In the in vivo atherosclerosis model,partial ligation of the carotid artery led to plaque formation and up-regulation of METTL3 and NLRP1, with down-regulation of KLF4; knockdown of METTL3 via repetitive shRNA administration prevented the atherogenic process, NACHT, LRR and PYD domains-containing protein 3 (NLRP3) up-regulation, and KLF4 down-regulation. Collectively, it has demonstrated that METTL3 serves a central role in the atherogenesis induced by oscillatory stress and disturbed blood flow.
Chronic kidney disease [ICD-11: GB61]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [86]
Responsed Disease Chronic kidney disease [ICD-11: GB61.Z]
Target Regulation Down regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
In-vitro Model
 MPC-5 Normal Mus musculus CVCL_AS87
Response Summary TFA could ameliorate HG-induced pyroptosis and injury in podocytes by targeting METTL3-dependent m6A modification via the regulation of NACHT, LRR and PYD domains-containing protein 3 (NLRP3)-inflammasome activation and PTEN/PI3K/Akt signaling. This study provides a better understanding of how TFA can protect podocytes in diabetic kidney disease (DKD).
Lung cancer [ICD-11: 2C25]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [316]
Responsed Disease Lung cancer [ICD-11: 2C25]
Responsed Drug Gefitinib Approved
 Drug Info 
In-vitro Model
 PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
SPC-A1 Endocervical adenocarcinoma Homo sapiens CVCL_6955
PC-9/GR2 Lung adenocarcinoma Homo sapiens CVCL_DI29
HCC827/GR
 N.A. Homo sapiens CVCL_E7R9
In-vivo Model To establish xenograft models, five-week-old male mice were orthotopically injected with the same number of the PC9/GR cells. Tumours had developed after 4 days, at which time the xenografted mice were randomly divided into the following two experimental groups (each group with 6 mice): (1) the control group and (2) the gefitinib group.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [316]
Responsed Disease Lung cancer [ICD-11: 2C25]
Target Regulation Up regulation
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [317]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Target Regulation Up regulation
In-vitro Model
 THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
Neuroblast differentiation-associated protein AHNAK (AHNAK)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MOLM-13 cell line Homo sapiens
Treatment: shMETTL3 MOLM13 cells
Control: MOLM13 cells
 GSE98623
Regulation
logFC: 1.10E+00
p-value: 5.50E-75
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.20E+00 GSE60213
Corneal injury [ICD-11: NA06]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [87]
Responsed Disease Corneal injury [ICD-11: NA06.4]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
In-vitro Model
 CGC (Conjunctival goblet cells)
In-vivo Model Mettl3fl/wt mice were generated as previously described. Mettl3fl/wt mice were crossed with K14CreER mice to obtain K14creER/Mettl3fl/fl (cKO) mice. Mettl3 cKO and control mice were injected with tamoxifen and then were subjected to corneal alkali burn treatment. The right eye was the experimental eye, and the left eye was the control eye. The mice were sacrificed at 24 hours, 7 days, 14 days, 35 days, and 56 days after injury. Six mice were taken from each period. Both eyes were removed, frozen in OCT (n = 4), fixed in 4% paraformaldehyde, and embedded in conventional paraffin (n = 2).
Response Summary METTL3 knockout in the limbal stem cells promotes the in vivo cell proliferation and migration, leading to the fast repair of corneal injury. In addition, m6A modification profiling identified stem cell regulatory factors Neuroblast differentiation-associated protein AHNAK (AHNAK) and DDIT4 as m6A targets.
Neurocalcin-delta (NCALD)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LNCaP cell line Homo sapiens
Treatment: shMETTL3 LNCaP cells
Control: shControl LNCaP cells
 GSE147884
Regulation
logFC: 1.15E+00
p-value: 3.16E-04
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 8.03E+00 GSE60213
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [88]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Fluorouracil Approved
 Drug Info 
Target Regulation Down regulation
In-vitro Model
 HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
In-vivo Model A tumor-bearing model was established by subcutaneously injecting 100 ul HT29 cells (5×106) followed by an intravenous injection of CAFs-derived exosomes (50 ug/mouse every three days) into the tail vein of the mice. An intraperitoneal injection of 5-FU (50 mg/kg, every week) was administered on day 12.
Response Summary METTL3 dependent m6A methylation was upregulated in CRC to promote the processing of miR 181d 5p by DGCR8. This led to increased miR 181d 5p expression, which inhibited the 5 FU sensitivity of CRC cells by targeting Neurocalcin-delta (NCALD).
Nuclear receptor-interacting protein 1 (NRIP1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line DKO-1 cell line Homo sapiens
Treatment: METTL3 knockdown DKO-1 cell
Control: DKO-1 cell
 GSE182382
Regulation
logFC: -1.29E+00
p-value: 1.52E-02
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.30E+00 GSE60213
Down syndrome [ICD-11: LD40]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [89]
Responsed Disease Complete trisomy 21 [ICD-11: LD40.0]
Target Regulation Down regulation
In-vitro Model
 HT22 Normal Mus musculus CVCL_0321
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
Response Summary The NRIP1 mRNA increased in fetal brain tissues of DS, whereas the m6A modification of the NRIP1 mRNA significantly decreased. METTL3 knockdown reduced the m6A modification of NRIP1 mRNA and increased its expression, and an increase in NRIP1 m6A modification and a decrease in its expression were observed in METTL3-overexpressed cells.
Parathyroid hormone 1 receptor (PTH1R)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -1.67E+00
p-value: 4.51E-08
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 6.67E+00 GSE60213
Low bone mass disorder [ICD-11: FB83]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [90]
Responsed Disease Osteoporosis [ICD-11: FB83.1]
Target Regulation Up regulation
Pathway Response Parathyroid hormone synthesis, secretion and action hsa04928
Cell Process Adipogenesis
In-vivo Model Mettl3fl/+ mice with C57BL6/J background were generated using CRISPR-Cas9 systems.
Response Summary Knockout of Mettl3 reduces the translation efficiency of MSCs lineage allocator Parathyroid hormone 1 receptor (PTH1R), and disrupts the PTH-induced osteogenic and adipogenic responses in vivo.
Paternally-expressed gene 3 protein (PEG3)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LNCaP cell line Homo sapiens
Treatment: shMETTL3 LNCaP cells
Control: shControl LNCaP cells
 GSE147884
Regulation
logFC: -6.51E-01
p-value: 1.16E-264
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 5.95E+00 GSE60213
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [91]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
Cell invasion
Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
In-vivo Model The 40 nude mice of each large group were classified into 8 small groups (n = 5) and subcutaneously injected with transfected cell suspension in the back (5 × 106 cells/mL/mouse). The length and width of tumors were recorded every 4 days, and the tumor volume = (length × width2)/2. The tumor growth curve was thereby graphed. On the 28th day of injection, mice were euthanized by neck dislocation, and the xenografts were harvested, photographed, and weighed.
Response Summary METTL3 regulates the m6A modification to promote the maturation of miR-1246, which targets Paternally-expressed gene 3 protein (PEG3) to participate in occurrence and development of non-small cell lung cancer.
Peroxisomal bifunctional enzyme (EHHADH)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -7.43E-01
p-value: 3.92E-35
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 7.66E+00 GSE60213
Type 2 diabetes mellitus [ICD-11: 5A11]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [48]
Responsed Disease Type 2 diabetes mellitus [ICD-11: 5A11]
Target Regulation Up regulation
Pathway Response Insulin resistance hsa04931
Cell Process Lipid metabolism
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model Hepatocyte-specific METTL3 knockout mice (TBG-Cre, METTL3 fl/fl) were generated by crossing mice with TBG-Cre Tg mice. METTL3 flox (METTL3 fl/fl) and hepatocyte-specific METTL3 knockout mice (TBG-Cre, METTL3 fl/fl) were used for experiments.
Response Summary Type 2 diabetes (T2D) is characterized by lack of insulin, insulin resistance and high blood sugar. METTL3 silence decreased the m6A methylated and total mRNA level of Fatty acid synthase (Fasn), subsequently inhibited fatty acid metabolism. The expression of Acc1, Acly, Dgat2, Peroxisomal bifunctional enzyme (EHHADH), Fasn, Foxo, Pgc1a and Sirt1, which are critical to the regulation of fatty acid synthesis and oxidation were dramatically decreased in livers of hepatocyte-specific METTL3 knockout mice.
Peroxisome proliferator-activated receptor alpha (PPARalpha/PPARA)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: -3.42E+00
p-value: 1.41E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 8.50E+00 GSE60213
Metabolic disorders [ICD-11: 5D2Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [92]
Responsed Disease Metabolic disorders [ICD-11: 5D2Z]
Target Regulation Down regulation
Pathway Response PPAR signaling pathway hsa03320
Adipocytokine signaling pathway hsa04920
Cell Process Llipid metabolism
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Hepa 1-6 Hepatocellular carcinoma of the mouse Mus musculus CVCL_0327
In-vivo Model Liver-specific Bmal1f/f-AlbCre-knockout mice were purchased from Jackson Laboratory. C57BI/6J or Bmal1f/f-AlbCre-knockout male mice were maintained under a 12 hr light/12 hr dark (LD) cycle (ZT0 = 6 AM) and fed ad libitum with normal rodent chow (2018 Global 18% Protein diet, Envigo) and water. At 10-14 weeks of age, 10 male mice per group were sacrificed via CO2 asphyxiation at Zeitgeber Time (ZT) 0,2,6,10,12,14,18,22. In order to induce high levels of ROS in the liver, WT male mice were fasted 12 h and followed by intraperitoneal injection with 300 mg/kg APAP dissolved in PBS and re-fed.
Response Summary PPaRalpha to mediate its mRNA stability to regulate lipid metabolism. Hepatic deletion of Bmal1 increases m6A mRNA methylation, particularly of Peroxisome proliferator-activated receptor alpha (PPARalpha/PPARA). Inhibition of m6A methylation via knockdown of m6A methyltransferase METTL3 decreases PPaR-Alpha m6A abundance and increases PPaRalpha mRNA lifetime and expression, reducing lipid accumulation in cells in vitro. YTHDF2 binds to PPaRalpha to mediate its mRNA stability to regulate lipid metabolism. Transcriptional regulation of circadian rhythms is essential for lipid metabolic homeostasis, disruptions of which can lead to metabolic diseases.
Pescadillo homolog (PES1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: 7.23E-01
p-value: 7.36E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.38E+00 GSE60213
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [93]
Responsed Disease Chronic myeloid leukaemia [ICD-11: 2B33.2]
Target Regulation Down regulation
Pathway Response Cell cycle hsa04110
Cell Process Decrease of S phase
In-vitro Model
 U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
LAMA-84 Chronic myelogenous leukemia Homo sapiens CVCL_0388
KCL-22 Chronic myelogenous leukemia Homo sapiens CVCL_2091
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
HL-60 Adult acute myeloid leukemia Homo sapiens CVCL_0002
HEL Erythroleukemia Homo sapiens CVCL_0001
Response Summary m6A methyltransferase complex METTL3/METTL14 is upregulated in CML patients and that is required for proliferation of primary CML cells and CML cell lines sensitive and resistant to the TKI imatinib. METTL3 directly regulates the level of Pescadillo homolog (PES1) protein identified as an oncogene in several tumors. These results point to METTL3 as a novel relevant oncogene in CML and as a promising therapeutic target for TKI resistant CML.
PHLPP-like (PHLPP2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MDA-MB-231 Homo sapiens
Treatment: METTL3 knockdown MDA-MB-231 cells
Control: MDA-MB-231 cells
 GSE70061
Regulation
logFC: 7.59E-01
p-value: 9.18E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.40E+00 GSE60213
Endometrial cancer [ICD-11: 2C76]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [94]
Responsed Disease Endometrial cancer [ICD-11: 2C76]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation and tumorigenicity
In-vitro Model
 HEC-1-A Endometrial adenocarcinoma Homo sapiens CVCL_0293
RL95-2 Endometrial adenosquamous carcinoma Homo sapiens CVCL_0505
T HESCs Normal Homo sapiens CVCL_C464
In-vivo Model 4×106 HEC-1-A endometrial cancer cells (shCtrl, shMETTL3, wild-type, METTL14+/-, or METTL14+/- rescued with wild-type or mutant METTL14) were injected intraperitoneally into 5 week old female athymic nude mice (Foxn1nu, Harlan; n=10 per group).
Response Summary About 70% of endometrial tumours exhibit reductions in m6A methylation that are probably due to either this METTL14 mutation or reduced expression of METTL3. Reductions in m6A methylation lead to decreased expression of the negative AKT regulator PHLPP-like (PHLPP2) and increased expression of the positive AKT regulator mTORC2. these results reveal reduced m6A mRNA methylation as an oncogenic mechanism in endometrial cancer and identify m6A methylation as a regulator of AKT signalling.
Phosphatidylinositol 3-kinase regulatory subunit beta (PI3K-p85/PIK3R2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 1.59E+00
p-value: 3.69E-27
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.42E+00 GSE60213
Retina cancer [ICD-11: 2D02]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [44]
Responsed Disease Retinoblastoma [ICD-11: 2D02.2]
Responsed Drug Rapamycin Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
mTOR signaling pathway hsa04150
Apoptosis hsa04210
Cell Process Cell proliferation
Cell migration
Cell invasion
Cell apoptosis
In-vitro Model
 WERI-Rb-1 Retinoblastoma Homo sapiens CVCL_1792
Y-79 Retinoblastoma Homo sapiens CVCL_1893
In-vivo Model To establish a subcutaneous tumour model in nude mice, 2 × 107 Y79 cells (METTL3 knockdown group: shNC, shRNA1 and shRNA2; METTL3 up-regulated group: NC and METLL3) were resuspended in 1 mL of pre-cooled PBS, and 200 uL of the cell suspension was injected subcutaneously into the left side of the armpit to investigate tumour growth (4 × 106 per mouse).
Response Summary METTL3 promotes the progression of retinoblastoma through Phosphatidylinositol 3-kinase regulatory subunit beta (PI3K-p85/PIK3R2)/AKT/mTOR pathways in vitro and in vivo. METTL3 has an impact on the PI3K-AKT-mTOR-P70S6K/4EBP1 pathway. The cell proliferation results show that the stimulatory function of METTL3 is lost after rapamycin treatment.
Phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -1.51E+00
p-value: 1.12E-09
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 8.41E+00 GSE60213
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [62]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Down regulation
Pathway Response Oxidative phosphorylation hsa00190
In-vitro Model
 VCaP Prostate carcinoma Homo sapiens CVCL_2235
RWPE-1 Normal Homo sapiens CVCL_3791
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
DU145 Prostate carcinoma Homo sapiens CVCL_0105
22Rv1 Prostate carcinoma Homo sapiens CVCL_1045
In-vivo Model Approximately 2 × 106 PCa cells (PC-3 shNC, shYTHDF2, shMETTL3 cell lines) per mouse suspended in 100 uL PBS were injected in the flank of male BALB/c nude mice (4 weeks old). During the 40-day observation, the tumor size (V = (width2×length ×0.52)) was measured with vernier caliper. Approximately 1.5 × 106 PCa cells suspended in 100 uL of PBS (PC-3 shNC, shYTHDF2, and shMETTL3 cell lines) per mouse were injected into the tail vein of male BALB/c nude mice (4 weeks old). The IVIS Spectrum animal imaging system (PerkinElmer) was used to evaluate the tumor growth (40 days) and whole metastasis conditions (4 weeks and 6 weeks) with 100 uL XenoLight D-luciferin Potassium Salt (15 mg/ml, Perkin Elmer) per mouse. Mice were anesthetized and then sacrificed for tumors and metastases which were sent for further organ-localized imaging as above, IHC staining and hematoxylin-eosin (H&E) staining.
Response Summary Knock-down of YTHDF2 or METTL3 significantly induced the expression of Phospholysine phosphohistidine inorganic pyrophosphate phosphatase (LHPP) and NKX3-1 at both mRNA and protein level with inhibited phosphorylated AKT. YTHDF2 mediates the mRNA degradation of the tumor suppressors LHPP and NKX3-1 in m6A-dependent way to regulate AKT phosphorylation-induced tumor progression in prostate cancer.
Pigment epithelium-derived factor (PEDF)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -9.30E-01
p-value: 1.13E-16
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 8.75E+00 GSE60213
Diffuse large B-cell lymphomas [ICD-11: 2A81]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [95]
Responsed Disease Diffuse large B-cell lymphomas [ICD-11: 2A81]
Target Regulation Up regulation
In-vitro Model
 U-2932 Diffuse large B-cell lymphoma Homo sapiens CVCL_1896
SU-DHL-4 Diffuse large B-cell lymphoma Homo sapiens CVCL_0539
OCI-Ly10 Diffuse large B-cell lymphoma Homo sapiens CVCL_8795
HBL-1 [Human diffuse large B-cell lymphoma] Diffuse large B-cell lymphoma Homo sapiens CVCL_4213
GM12878 Human B lymphocytes Homo sapiens CVCL_7526
Farage Diffuse large B-cell lymphoma Homo sapiens CVCL_3302
Response Summary Overexpressed Pigment epithelium-derived factor (PEDF) abrogates the inhibition of cell proliferation in DLBCL cells that is caused by METTL3 silence.
Platelet-derived growth factor receptor alpha (PDGFRA)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: 1.93E+00
p-value: 8.84E-11
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 4.83E+00 GSE60213
Diseases of arteries or arterioles [ICD-11: BD5Y]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [96]
Responsed Disease Diseases of arteries or arterioles [ICD-11: BD5Y]
Target Regulation Down regulation
In-vitro Model
 ACBRI-183 (Human retinal pericytes (ACBRI-183) was obtained from Cell Systems Corp. (CSC, USA))
In-vivo Model Mettl3 floxed mice were purchased from GemPharmatech Co. Ltd (Nanjing, China). Pdgfr-Beta-Cre mice were purchased from Beijing Biocytogen Co. Ltd (Beijing, China) generated on C57BL/6J background. Mettl3 flox/flox mice were crossed with Pdgfr-Beta-Cre mice to generate pericyte-specific Mettl3 knockout mice. All mice were bred under the specific-pathogen free condition with free access to diet and water or their nursing mothers with alternating 12/12 light-dark cycle (lights on at 08:00 and off at 20:00).
Response Summary Specific depletion of METTL3 in pericytes suppressed diabetes-induced pericyte dysfunction and Microvascular complication in vivo. METTL3 overexpression impaired pericyte function by repressing PKC-Eta, FAT4, and Platelet-derived growth factor receptor alpha (PDGFRA) expression, which was mediated by YTHDF2-dependent mRNA decay.
Poly [ADP-ribose] polymerase tankyrase-1 (Tankyrase)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Pancreatic islets Mus musculus
Treatment: Mettl3 knockout mice
Control: Mettl3 flox/flox mice
 GSE155612
Regulation
logFC: 8.10E-01
p-value: 1.68E-04
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.44E+00 GSE60213
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [24]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 Neural progenitor cells (NPCs) (The progenitor cells of the CNS)
NP69 (A human immortalized nasopharyngeal epithelial)
HNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_FA07
HNE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_0308
CNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_6889
CNE-1 Normal Homo sapiens CVCL_6888
In-vivo Model 1 × 105 HNE2 cells (with or without METTL3 knockdown) were labeled with luciferase gene and injected into the tail vein of the nude mice.
Response Summary METTL3 activated the luciferase activity of TOPflash (a reporter for beta-catenin/TCF signaling), and downregulation of METTL3 inhibited the expression of beta-catenin/TCF target genes vimentin and N-cadherin, which are two regulators of epithelial-mesenchymal transition. METTL3 silencing decreased the m6A methylation and total mRNA levels of Poly [ADP-ribose] polymerase tankyrase-1 (Tankyrase), a negative regulator of axin. METTL3 is a therapeutic target for NPC.
Potassium voltage-gated channel subfamily H member 6 (KCNH6)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Embryonic stem cells Mus musculus
Treatment: METTL3 knockout mESCs
Control: Wild type mESCs
 GSE156481
Regulation
logFC: 1.67E+00
p-value: 2.01E-04
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 4.49E+00 GSE60213
Idiopathic interstitial pneumonitis [ICD-11: CB03]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [97]
Responsed Disease Idiopathic pulmonary fibrosis [ICD-11: CB03.4]
Target Regulation Up regulation
In-vitro Model
 WI-38 Normal Homo sapiens CVCL_0579
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model Animals were bred and housed in the pathogen-free facility of the Laboratory Animal Center of Shanghai General Hospital (Shanghai, China). All lungs were collected 4 weeks after BLM treatment for histology and further study. Lung microsections (5 uM) were applied to Masson's trichrome and Sirius red staining to visualize fibrotic lesions.
Response Summary Lowering m6A levels through silencing METTL3 suppresses the FMT process in vitro and in vivo. m6A modification regulates EMT by modulating the translation of Potassium voltage-gated channel subfamily H member 6 (KCNH6) mRNA in a YTHDF1-dependent manner. Manipulation of m6A modification through targeting METTL3 becomes a promising strategy for the treatment of idiopathic pulmonary fibrosis.
Pro-epidermal growth factor (EGF)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: 2.08E+00
p-value: 3.08E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 7.98E+00 GSE60213
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [98]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Doxil Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Homologous recombination hsa03440
Cell Process Homologous recombination repair
In-vitro Model
 MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model Cells were trypsinized and resuspended in DMEM at a consistence of 1 × 107 cells/ml. A total of 1 × 106 cells were injected into flank of mice. 27 days after injection, tumors were removed for paraffin-embedded sections.
Response Summary Knockdown of METTL3 sensitized these breast cancer cells to Adriamycin (ADR; also named as doxorubicin) treatment and increased accumulation of DNA damage. Mechanically, we demonstrated that inhibition of METTL3 impaired HR efficiency and increased ADR-induced DNA damage by regulating m6A modification of Pro-epidermal growth factor (EGF)/RAD51 axis. METTL3 promoted EGF expression through m6A modification, which further upregulated RAD51 expression, resulting in enhanced HR activity.
Programmed cell death 1 ligand 1 (CD274/PD-L1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -1.82E+00
p-value: 4.68E-65
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 7.97E+00 GSE60213
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [99]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Target Regulation Up regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
In-vitro Model
 SCC-9 Tongue squamous cell carcinoma Homo sapiens CVCL_1685
SCC-4 Tongue squamous cell carcinoma Homo sapiens CVCL_1684
SCC-25 Tongue squamous cell carcinoma Homo sapiens CVCL_1682
CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
In-vivo Model Six-week-old nude mice were randomly divided into two groups (three mice per group) and cultured with continuous access to sterile food and water in pathogen-free sterile conditions. To establish the OSCC xenograft model, we subcutaneously injected 5 × 106 SCC-9 cells stably transfected with METTL3 shRNA or sh-NC vectors into nude mice.
Response Summary METTL3 intensified the metastasis and proliferation of OSCC by modulating the m6A amounts of PRMT5 and Programmed cell death 1 ligand 1 (CD274/PD-L1).
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [80]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Pathway Response p53 signaling pathway hsa04115
Central carbon metabolism in cancer hsa05230
PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Response Summary This study revealed that m6A methylation is closely related to the poor prognosis of non-small cell lung cancer patients via interference with the TIME, which suggests that m6A plays a role in optimizing individualized immunotherapy management and improving prognosis. The expression levels of METTL3, FTO and YTHDF1 in non-small cell lung cancer were changed. Patients in Cluster 1 had lower immunoscores, higher Programmed cell death 1 ligand 1 (CD274/PD-L1) expression, and shorter overall survival compared to patients in Cluster 2. The hallmarks of the Myelocytomatosis viral oncogene (MYC) targets, E2 transcription Factor (E2F) targets were significantly enriched.
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [100]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Cell Process Tumor immune escape
In-vitro Model
 SK-BR-3 Breast adenocarcinoma Homo sapiens CVCL_0033
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MCF-10A Normal Homo sapiens CVCL_0598
HCC38 Breast ductal carcinoma Homo sapiens CVCL_1267
4T1 Normal Mus musculus CVCL_0125
In-vivo Model For subcutaneous xenograft experiments in B-NDG mice, approximately 1 × 106 MDA-MB-231 and there was subcutaneous injection of the cells that resuspended in 100 uL PBS into the left flank of the mice and were divided into 11 groups randomly (each containing 5 mice). After the treatment Atezolizumab (Selleck, Shanghai, China) or corresponding iso control antibody (Selleck, Shanghai, China) was injected intratumorally on day 3, 6, 9, 12, 15 post-MDA-MB-231 inoculations, and 5 × 106 cytokine-induced killer (CIK) cells were injected in the tail vein on day 7, 14, 21.
Response Summary Programmed cell death 1 ligand 1 (CD274/PD-L1) was a downstream target of METTL3-mediated m6A modification in breast cancer cells. METTL3-mediated PD-L1 mRNA activation was m6A-IGF2BP3-dependent. PD-L1 expression was also positively correlated with METTL3 and IGF2BP3 expression in breast cancer tissues.
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [101]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
In-vitro Model
 UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
T24 Bladder carcinoma Homo sapiens CVCL_0554
SV-HUC-1 Normal Homo sapiens CVCL_3798
J82 Bladder carcinoma Homo sapiens CVCL_0359
5637 Bladder carcinoma Homo sapiens CVCL_0126
In-vivo Model Male C57BL/6J mice (6 weeks old) were given drinking water containing 0.05% (w/v) BBN (TCI, catalog no. B0938) for 20 weeks. After the BBN administration, mice were given normal drinking water and injected with 10% DMSO (as a control) or 20 mg/kg SP600125 (Selleck, catalog no. 129-56-6) i.p. every 3 days. After seven injections, mice were euthanized for tissue retrieval. For the bladder cancer cell-derived xenograft mouse model, male C57BL/6J mice (6 weeks old) were injected subcutaneously with 1 × 106 MB49 cells. One week after bladder cancer cell injection, 10% DMSO or 20 mg/kg SP600125 were injected i.p. every 3 days.
Response Summary METTL3 was essential for bladder cancer cells to resist the cytotoxicity of CD8+ T cells by regulating Programmed cell death 1 ligand 1 (CD274/PD-L1) expression. Additionally, JNK signaling contributed to tumor immune escape in a METTL3-dependent manner both in vitro and in vivo.
Inflammatory response [ICD-11: MG46]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [322]
Responsed Disease Inflammatory response [ICD-11: MG46]
Protein arginine N-methyltransferase 5 (PRMT5)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Pancreatic islets Mus musculus
Treatment: Mettl3 knockout mice
Control: Mettl3 flox/flox mice
 GSE155612
Regulation
logFC: 7.02E-01
p-value: 6.96E-04
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 5.94E+00 GSE60213
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [99]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Target Regulation Up regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
In-vitro Model
 SCC-9 Tongue squamous cell carcinoma Homo sapiens CVCL_1685
SCC-4 Tongue squamous cell carcinoma Homo sapiens CVCL_1684
SCC-25 Tongue squamous cell carcinoma Homo sapiens CVCL_1682
CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
In-vivo Model Six-week-old nude mice were randomly divided into two groups (three mice per group) and cultured with continuous access to sterile food and water in pathogen-free sterile conditions. To establish the OSCC xenograft model, we subcutaneously injected 5 × 106 SCC-9 cells stably transfected with METTL3 shRNA or sh-NC vectors into nude mice.
Response Summary METTL3 intensified the metastasis and proliferation of OSCC by modulating the m6A amounts of Protein arginine N-methyltransferase 5 (PRMT5) and PD-L1.
Protein SET (SET)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: 5.30E+00
p-value: 1.65E-04
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.53E+00 GSE60213
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [102]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Down regulation
Pathway Response TNF signaling pathway hsa04668
Cell Process Cell migration
Cell invasion
Epithelial-mesenchymal transition
In-vitro Model
 NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Response Summary MiR-1915-3p expression was regulated by METTL3/YTHDF2 m6A axis through transcription factor KLF4. miR-1915-3p function as a tumor suppressor by targeting Protein SET (SET) and has an anti-metastatic therapeutic potential for lung cancer treatment.
Proto-oncogene c-Rel (c-Rel)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Pancreatic islets Mus musculus
Treatment: Mettl3 knockout mice
Control: Mettl3 flox/flox mice
 GSE155612
Regulation
logFC: 1.39E+00
p-value: 2.50E-05
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.02E+00 GSE60213
Thyroid Cancer [ICD-11: 2D10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [103]
Responsed Disease Papillary thyroid cancer [ICD-11: 2D10.1]
Target Regulation Down regulation
Pathway Response NF-kappa B signaling pathway hsa04064
In-vitro Model
 TPC-1 Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
Nthy-ori 3-1 Normal Homo sapiens CVCL_2659
KTC-1 Thyroid carcinoma Homo sapiens CVCL_6300
B-CPAP Thyroid gland carcinoma Homo sapiens CVCL_0153
In-vivo Model For xenograft models, 5 × 106 BCPAP or KTC-1 cells from each group were injected subcutaneously into the flanks of female BALB/c nude mice (4-6 weeks old, Shanghai SLAC Laboratory Animal, China, n = 5 per group) in a volume of 150 uL PBS. Tumor growth was measured with a digital caliper every 4 days and calculated using the following formula: (length × width2)/2. To study the effect of IL-8 on tumor growth in vivo, scramble or shMETTL3 BCPAP cells were implanted hypodermically into BALB/c nude mice (2 × 106 cells in 150 uL PBS, n = 10 per group). When palpable tumors formed on day 14, mice were treated with DMSO or the IL-8 inhibitor SB225002 (10 mg/kg) by intraperitoneal injection 3 times per week for 3 weeks. Six weeks post-injection, the mice were sacrificed, and the tumors were collected to analyze the frequency of TANs by flow cytometry. For the lung metastasis model, BCPAP and KTC-1 cells (2 × 106 cells in 100 uL PBS) with the corresponding vectors were injected into the tail veins of BALB/c nude mice. Eight weeks after injection, the mice were euthanized, and metastatic lung nodules were analyzed (n = 5 for each group).
Response Summary METTL3 played a pivotal tumor-suppressor role in papillary thyroid cancer carcinogenesis through Proto-oncogene c-Rel (c-Rel) and RelA inactivation of the nuclear factor Kappa-B (NF-Kappa-B) pathway by cooperating with YTHDF2 and altered TAN infiltration to regulate tumor growth.
Pyruvate dehydrogenase kinase isoform 4 (PDK4)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -1.03E+01
p-value: 3.59E-12
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 5.02E+00 GSE60213
Solid tumour/cancer [ICD-11: 2A00-2F9Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [104]
Responsed Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Target Regulation Up regulation
Pathway Response Glycerolipid metabolism hsa00561
Cell Process Glycolysis
In-vitro Model
 SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
In-vivo Model As to the subcutaneous transplanted model, WT Vec, Mettl3 Mut/-+vec, WTPDK4, Mettl3 Mut/-+vecPDK4 cells (2 × 10 6 per mouse, n = 10 for each group) were diluted in 200 uL normal medium + 200 uL Matrigel (BD Biosciences) and subcutaneously injected into immunodeficient mice to investigate tumor growth.
Response Summary m6A regulates glycolysis of cancer cells through Pyruvate dehydrogenase kinase isoform 4 (PDK4). Knockdown of Mettl3 significantly attenuated m6A antibody enriched PDK4 mRNA in Huh7 cells. It reveals that m6A regulates glycolysis of cancer cells through PDK4.
Ribosomal protein S6 kinase beta-1 (RPS6KB1/p70S6K)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line CT26 cell line Mus musculus
Treatment: METTL3 knockout CT26 cells
Control: CT26 cells
 GSE142589
Regulation
logFC: -6.86E-01
p-value: 2.67E-02
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.70E+00 GSE60213
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
Response Summary Down-regulation of METTL3 inhibits the proliferation and mobility of human gastric cancer cells and leads to inactivation of the AKT signaling pathway, suggesting that METTL3 is a potential target for the treatment of human gastric cancer. METTL3 knockdown decreased Bcl2 and increased Bax and active Caspase-3 in gastric cancer cells, which suggested the apoptotic pathway was activated. METTL3 led to inactivation of the AKT signaling pathway in human gastric cancer cells, including decreased phosphorylation levels of AKT and expression of down-stream effectors Ribosomal protein S6 kinase beta-1 (RPS6KB1/p70S6K) and Cyclin D1.
Retina cancer [ICD-11: 2D02]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [44]
Responsed Disease Retinoblastoma [ICD-11: 2D02.2]
Responsed Drug Rapamycin Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
mTOR signaling pathway hsa04150
Cell Process Cell proliferation
Cell migration
Cell invasion
Cell apoptosis
In-vitro Model
 WERI-Rb-1 Retinoblastoma Homo sapiens CVCL_1792
Y-79 Retinoblastoma Homo sapiens CVCL_1893
In-vivo Model To establish a subcutaneous tumour model in nude mice, 2 × 107 Y79 cells (METTL3 knockdown group: shNC, shRNA1 and shRNA2; METTL3 up-regulated group: NC and METLL3) were resuspended in 1 mL of pre-cooled PBS, and 200 uL of the cell suspension was injected subcutaneously into the left side of the armpit to investigate tumour growth (4 × 106 per mouse).
Response Summary METTL3 promotes the progression of retinoblastoma through PI3K/AKT/mTOR pathways in vitro and in vivo. METTL3 has an impact on the PI3K-AKT-mTOR-Ribosomal protein S6 kinase beta-1 (RPS6KB1/p70S6K)/4EBP1 pathway. The cell proliferation results show that the stimulatory function of METTL3 is lost after rapamycin treatment.
RIG-I-like receptor 1 (RIG-I)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -1.14E+00
p-value: 3.48E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.75E+00 GSE60213
Acute viral hepatitis [ICD-11: 1E50]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [105]
Responsed Disease Acute hepatitis B [ICD-11: 1E50.1]
Target Regulation Down regulation
Pathway Response RIG-I-like receptor signaling pathway hsa04622
In-vitro Model
 Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary METTL3 and METTL14 leads to an increase in viral RNA recognition by RIG-I-like receptor 1 (RIG-I), thereby stimulating type I interferon production. The obvious advantage is that m6A deficiency in HBV and HCV induces a higher IFN synthesis and in turn enhance adaptive immunity.
COVID-19 [ICD-11: RA01]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [106]
Responsed Disease COVID-19 [ICD-11: RA01]
Target Regulation Down regulation
Pathway Response RIG-I-like receptor signaling pathway hsa04622
Cell Process Immune responses
In-vitro Model
 Calu-3 Lung adenocarcinoma Homo sapiens CVCL_0609
Caco-2 Colon adenocarcinoma Homo sapiens CVCL_0025
HEK293-FT Normal Homo sapiens CVCL_6911
Response Summary In SARS-CoV-2 infection, depletion of the host cell m6A methyltransferase METTL3 decreases m6A levels in SARS-CoV-2 and host genes, and m6A reduction in viral RNA increases RIG-I-like receptor 1 (RIG-I) binding and subsequently enhances the downstream innate immune signaling pathway and inflammatory gene expression.
Sequestosome-1 (SQSTM1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HUVEC cell line Homo sapiens
Treatment: shMETTL3 HUVEC cells
Control: shScramble HUVEC cells
 GSE157544
Regulation
logFC: -6.28E-01
p-value: 1.94E-05
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.03E+00 GSE60213
Lung cancer [ICD-11: 2C25]
In total 3 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Chloroquine Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model
 Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, ATG7, LC3B, and Sequestosome-1 (SQSTM1). beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Gefitinib Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model
 Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, ATG7, LC3B, and Sequestosome-1 (SQSTM1). beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Beta-Elemen Phase 3
 Drug Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model
 Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, ATG7, LC3B, and Sequestosome-1 (SQSTM1). beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Breast cancer [ICD-11: 2C60]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [331]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Paclitaxel Approved
 Drug Info 
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model The experimental mice were housed in an SPF-grade animal laboratory at a temperature of approximately 25 °C, a humidity range of 50%, and an average daylight duration of 12 h. BALB/C female mice at 5-6 weeks of age were taken and prepared for tumor-bearing. After the mice were sacrificed, their tissues were collected, weighed and immediately snap-frozen in liquid nitrogen.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [331]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug STM2457 Investigative
 Drug Info 
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model The experimental mice were housed in an SPF-grade animal laboratory at a temperature of approximately 25 °C, a humidity range of 50%, and an average daylight duration of 12 h. BALB/C female mice at 5-6 weeks of age were taken and prepared for tumor-bearing. After the mice were sacrificed, their tissues were collected, weighed and immediately snap-frozen in liquid nitrogen.
Serine/threonine-protein kinase 4 (STK4)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 7.22E-01
p-value: 1.68E-60
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.45E+00 GSE60213
Thyroid Cancer [ICD-11: 2D10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [107]
Responsed Disease Thyroid Cancer [ICD-11: 2D10]
Target Regulation Down regulation
Response Summary Silencing METTL3 suppresses miR-222-3p expression and thus stimulates Serine/threonine-protein kinase 4 (STK4) expression, thereby repressing the malignancy and metastasis of Thyroid Carcinoma.
Serine/threonine-protein kinase mTOR (MTOR)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3 knockout liver
Control: Wild type liver cells
 GSE198512
Regulation
logFC: 8.34E-01
p-value: 1.58E-02
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.47E+00 GSE60213
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [108]
Responsed Disease Lung cancer [ICD-11: 2C25]
Target Regulation Up regulation
Pathway Response mTOR signaling pathway hsa04150
PI3K-Akt signaling pathway hsa04151
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
In-vivo Model 5 × 106 A549 cells overexpressing METTL3 (Lv-METTL3) or control (Lv-Ctrl) were suspended in 100 uL phosphate-buffered saline (PBS), and were subcutaneously injected into mouse lower right flank. Drug treatment started in the Lv-METTL3 group when the tumour volume reached around 100 mm3. Mice were randomly divided into three groups to receive vehicle, GSK2536771 (30 mg/kg) or rapamycin (1 mg/kg). Drugs were administrated daily through intraperitoneal injection for 18 days. Treatment conditions were chosen as previously reported.
Response Summary METTL3-mediated m6 A methylation promotes lung cancer progression via activating PI3K/AKT/Serine/threonine-protein kinase mTOR (MTOR) pathway.
Renal cell carcinoma [ICD-11: 2C90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [109]
Responsed Disease Renal cell carcinoma [ICD-11: 2C90]
Target Regulation Down regulation
Cell Process Epithelial-to-mesenchymal transition
Arrest cell cycle at G0/G1 phase
In-vitro Model
 ACHN Papillary renal cell carcinoma Homo sapiens CVCL_1067
Caki-1 Clear cell renal cell carcinoma Homo sapiens CVCL_0234
Caki-2 Papillary renal cell carcinoma Homo sapiens CVCL_0235
HK2 Normal Acipenser baerii CVCL_YE28
In-vivo Model Cells (5×106 cells in 200 uL) were suspended with 100 uL PBS and 100 uL Matrigel Matrix, and injected subcutaneously into the left armpit of each mouse.
Response Summary Knockdown of METTL3 could obviously promote cell proliferation, migration and invasion function, and induce G0/G1 arrest,METTL3 acts as a novel marker for tumorigenesis, development and survival of RCC. Knockdown of METTL3 promoted changes in pI3K/AKT/Serine/threonine-protein kinase mTOR (MTOR) markers' expression with a gain in p-PI3k, p-AKT, p-mTOR and p-p70, and a loss of p-4EBP1.
Retina cancer [ICD-11: 2D02]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [44]
Responsed Disease Retinoblastoma [ICD-11: 2D02.2]
Responsed Drug Rapamycin Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
mTOR signaling pathway hsa04150
Cell Process Cell proliferation
Cell migration
Cell invasion
Cell apoptosis
In-vitro Model
 WERI-Rb-1 Retinoblastoma Homo sapiens CVCL_1792
Y-79 Retinoblastoma Homo sapiens CVCL_1893
In-vivo Model To establish a subcutaneous tumour model in nude mice, 2 × 107 Y79 cells (METTL3 knockdown group: shNC, shRNA1 and shRNA2; METTL3 up-regulated group: NC and METLL3) were resuspended in 1 mL of pre-cooled PBS, and 200 uL of the cell suspension was injected subcutaneously into the left side of the armpit to investigate tumour growth (4 × 106 per mouse).
Response Summary METTL3 promotes the progression of retinoblastoma through PI3K/AKT/Serine/threonine-protein kinase mTOR (MTOR) pathways in vitro and in vivo. METTL3 has an impact on the PI3K-AKT-mTOR-P70S6K/4EBP1 pathway. The cell proliferation results show that the stimulatory function of METTL3 is lost after rapamycin treatment.
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [110]
Responsed Disease Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation Up regulation
Pathway Response mTOR signaling pathway hsa04150
HIF-1 signaling pathway hsa04066
In-vivo Model The 8-10 weeks old mice were fed either a high fat diet or HF-CDAA , ad lib for 6-12 weeks. Chow diet was used as control for HFD.The mouse liver was perfused with PBS through portal vein, and liver tissue was cut into small pieces by a scissor. The single cell was made using syringe plunger to mull the tissue, and passed through a 40 uM cell strainer.
Response Summary The contribution of METTL3-mediated m6A modification of Ddit4 mRNA to macrophage metabolic reprogramming in non-alcoholic fatty liver disease and obesity. In METTL3-deficient macrophages, there is a significant downregulation of Serine/threonine-protein kinase mTOR (MTOR) and nuclear factor Kappa-B (NF-Kappa-B) pathway activity in response to cellular stress and cytokine stimulation, which can be restored by knockdown of DDIT4.
Signal transducer and activator of transcription 2 (STAT2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: -1.27E+00
p-value: 1.09E-100
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.27E+00 GSE60213
Congenital pneumonia [ICD-11: KB24]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [111]
Responsed Disease Congenital pneumonia [ICD-11: KB24]
Target Regulation Down regulation
Cell Process Cell apoptosis
In-vitro Model
 WI-38 Normal Homo sapiens CVCL_0579
In-vivo Model All mice were housed under a 12 h light/dark cycle with constant temperature about 25 ℃ and relative humidity approximating 55 %. The mice had free access to food and water for 10 days prior to the experiment. Forty mice were randomly selected and divided into four groups of 10 mice each. After 10 days, mice received an intraperitoneal injection of 22 mg / mL sodium pentobarbital (diluted in saline) followed by 167 uM LPS (60 uL) Saline solution was instilled into the oral cavity through the posterior pharyngeal wall. Pinch the nares quickly and hold for 30 s, model is successful when all fluid is absorbed into the nasal cavity, and slight tracheal rales appear. Lentiviral vectors containing pcDNA-SNHG4 (150 uM) or pcDNA-3.1 were intratracheally injected into mice. Twenty-one days after establishing the model, mice were intraperitoneally injected with 3% sodium pentobarbital and euthanized by overdose anesthesia at a dose of 90 mL/Kg, and organs and tissues were removed for follow-up studies.
Response Summary SNHG4 was downregulated in the neonatal pneumonia patient serum and its overexpression could inhibit LPS induced inflammatory injury in human lung fibroblasts and mouse lung tissue. The molecular mechanism underlying this protective effect was achieved by suppression of METTL3-mediated m6A modification levels of YTHDF1-dependent Signal transducer and activator of transcription 2 (STAT2) mRNA.
Stearoyl-CoA desaturase (SCD)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MDA-MB-231 Homo sapiens
Treatment: METTL3 knockdown MDA-MB-231 cells
Control: MDA-MB-231 cells
 GSE70061
Regulation
logFC: -1.10E+00
p-value: 2.11E-02
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.17E+00 GSE60213
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [112]
Responsed Disease Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation Up regulation
Pathway Response Glycerolipid metabolism hsa00561
Cell Process Lipid metabolism
In-vitro Model
 LM3 Malignant neoplasms Mus musculus CVCL_D269
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
In-vivo Model Mice with a Tmem30a deletion specifically in pancreatic beta cells were generated as previously described. Mice developed with NAFLD were named for Tmem30a-associated NAFLD (TAN) mice. The littermate mice with genotypes of Tmem30aloxP/loxP were used as controls.
Response Summary Targeting METTL3/14 in vitro increases protein level of ACLY and Stearoyl-CoA desaturase (SCD) as well as triglyceride and cholesterol production and accumulation of lipid droplets. These findings demonstrate a new NAFLD mouse model that provides a study platform for DM2-related NAFLD and reveals a unique epitranscriptional regulating mechanism for lipid metabolism via m6A-modified protein expression of ACLY and SCD1.
TNF receptor-associated factor 5 (TRAF5)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -7.59E-01
p-value: 1.50E-05
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.24E+00 GSE60213
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [113]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Oxaliplatin Approved
 Drug Info 
Target Regulation Down regulation
In-vitro Model
 LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
In-vivo Model HCT-116 cells (3 × 105 cells in 200 uL of saline) were subcutaneously injected into the nude mice to establish xenograft tumors. After 10 days, 10 mg/kg OX or saline was intraperitoneally injected (n = 5 for each group). Si-METTL3 or si-TRAF5 (10 nmol/20 g body weight) was injected twice intratumorally before the start of OX treatment. The mice were examined every 2 days and sacrificed 4 weeks after the OX treatment.
Response Summary 2-polarized tumor-associated macrophages enabled the oxaliplatin resistance via the elevation of METTL3-mediated m6A modification in Colorectal Cancer cells. Furthermore, they found that TNF receptor-associated factor 5 (TRAF5) contributes to the METTL3-triggered OX resistance in CRC cells.
TNF receptor-associated factor 6 (TRAF6)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: 1.02E+00
p-value: 2.31E-81
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.04E+00 GSE60213
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [114]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Target Regulation Up regulation
In-vitro Model
 U2OS Osteosarcoma Homo sapiens CVCL_0042
SaOS-2 Osteosarcoma Homo sapiens CVCL_0548
NHOst (Normal human osteoblast cells)
MG-63 Osteosarcoma Homo sapiens CVCL_0426
HOS Osteosarcoma Homo sapiens CVCL_0312
In-vivo Model For mouse xenograft tumor model, 1×106 Saos2 or HOS cells were mixed in 200 ul PBS and injected subcutaneously into 6- to 8-week-old C57BL/6 mice.umor size of mice was measured by vernier calipers every week after injection. The mice were euthanized after 28 days by intraperitoneal injection of 1% pentobarbital sodium (120 mg/kg), and the tumor tissues were removed from the mice.
Response Summary METTL3 is highly expressed in OS and enhances TNF receptor-associated factor 6 (TRAF6) expression through m6A modification, thereby promoting the metastases of OS cells.
Acute myocardial infarction [ICD-11: BA41]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [347]
Responsed Disease Acute myocardial infarction [ICD-11: BA41]
Target Regulation Up regulation
Transcription factor AP-2 gamma (TFAP2C)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Embryonic stem cells Mus musculus
Treatment: METTL3-/- mESCs
Control: Wild type ESCs
 GSE147849
Regulation
logFC: 1.20E+00
p-value: 4.47E-08
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.28E+00 GSE60213
Testicular cancer [ICD-11: 2C80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [115]
Responsed Disease Testicular cancer [ICD-11: 2C80]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Nucleotide excision repair hsa03420
Cell Process DNA repair
In-vitro Model
 TCam-2 Testicular seminoma Homo sapiens CVCL_T012
In-vivo Model Male mice were subcutaneously injected with tumour cells near the limbs to establish xenografts (1 × 106/mouse, 0.2 mL for each injection site; METTL3-overexpressing TCam-2/CDDP cells were inoculated once at the initial time and IGF2BP1-inhibited TCam-2/CDDP cells were inoculated every 3 days).
Response Summary METTL3 potentiates resistance to cisplatin through m6A modification of Transcription factor AP-2 gamma (TFAP2C) in seminoma. Enhanced stability of TFAP2C mRNA promoted seminoma cell survival under cisplatin treatment burden probably through up-regulation of DNA repair-related genes. IGF2BP1 binds to TFAP2C and enhances TFAP2C mRNA stability.
Transcription factor E2F1 (E2F1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 8.59E-01
p-value: 2.73E-57
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.01E+00 GSE60213
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [80]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Pathway Response p53 signaling pathway hsa04115
Central carbon metabolism in cancer hsa05230
PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Response Summary This study revealed that m6A methylation is closely related to the poor prognosis of non-small cell lung cancer patients via interference with the TIME, which suggests that m6A plays a role in optimizing individualized immunotherapy management and improving prognosis. The expression levels of METTL3, FTO and YTHDF1 in non-small cell lung cancer were changed. Patients in Cluster 1 had lower immunoscores, higher programmed death-ligand 1 (PD-L1) expression, and shorter overall survival compared to patients in Cluster 2. The hallmarks of the Myelocytomatosis viral oncogene (MYC) targets, Transcription factor E2F1 (E2F1) targets were significantly enriched.
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [116]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Doxil Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 MCF7-DoxR (Adriamycin-resistant cell line MCF7-DoxR)
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
In-vivo Model Once the tumor volume increased to about 1 cm3, six groups of MCF7 bearing mice (n = 10 in each group) were injected with PBS (0.1 ml, caudal vein) and adriamycin (0.1 ml, 10 mg/kg), respectively. When the tumor reached 1.5 cm in any direction (defined as event-free survival analysis), 10 mice in each group were selected to measure the tumor size and weight on the 12th day after adriamycin injection.
Response Summary METTL3 can regulate the expression of MALAT1 through m6A, mediate the Transcription factor E2F1 (E2F1)/AGR2 axis, and promote the adriamycin resistance of breast cancer.
Transcription factor EB (TFEB)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LNCaP cell line Homo sapiens
Treatment: shMETTL3 LNCaP cells
Control: shControl LNCaP cells
 GSE147884
Regulation
logFC: -6.54E-01
p-value: 8.08E-07
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 8.22E+00 GSE60213
Ischemic heart disease [ICD-11: BA40-BA6Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [117]
Responsed Disease Ischemic heart disease [ICD-11: BA40-BA6Z]
Target Regulation Down regulation
Pathway Response Apoptosis hsa04210)
Cell Process Cell proliferation
In-vitro Model
 H9c2(2-1) Normal Rattus norvegicus CVCL_0286
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model To cause I/R injury, mice were subjected to 30 min of LAD ischemia followed by 60 min of reperfusion.
Response Summary METTL3 methylates Transcription factor EB (TFEB), a master regulator of lysosomal biogenesis and autophagy genes, at two m6A residues in the 3'-UTR, which promotes the association of the RNA-binding protein HNRNPD with TFEB pre-mRNA and subsequently decreases the expression levels of TFEB. METTL3-ALKBH5 and autophagy, providing insight into the functional importance of the reversible mRNA m6A methylation and its modulators in ischemic heart disease.
Transcription factor ISGF-3 components p91/p84 (Stat1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Raw 264.7 cell line Mus musculus
Treatment: METTL3 knockout Raw 264.7 cells
Control: Wild type Raw 264.7 cells
 GSE162248
Regulation
logFC: -7.90E-01
p-value: 1.53E-25
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.34E+00 GSE60213
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [118]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Cell Process Immunity
In-vitro Model
 CT26 Mouse colon adenocarcinoma Mus musculus CVCL_7254
B16-GM-CSF (B16-GM-CSF cell line was a kind gift from Drs. Glenn Dranoff and Michael Dougan (Dana-Farber/Harvard Cancer Center))
B16-F10 Mouse melanoma Mus musculus CVCL_0159
In-vivo Model 2 × 106 CT26 cells with knockout of Mettl3, Mettl14, Mettl3/Stat1, Mettl3/Irf1, Mettl14/Stat1, or Mettl14/Irf1 and control were suspended in 200 uL of PBS/Matrigel (Corning) (1:1) and then subcutaneously inoculated into flank of each mouse.
Response Summary In colorectal cancer, Mettl3- or Mettl14-deficient tumors increased cytotoxic tumor-infiltrating CD8+ T cells and elevated secretion of IFN-gamma, Cxcl9, and Cxcl10 in tumor microenvironment in vivo. Mechanistically, Mettl3 or Mettl14 loss promoted IFN-gamma-Stat1-Irf1 signaling through stabilizing the Transcription factor ISGF-3 components p91/p84 (Stat1) and Irf1 mRNA via Ythdf2.
Psoriasis [ICD-11: EA90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [348]
Responsed Disease Psoriasis [ICD-11: EA90]
Target Regulation Up regulation
Transcription factor JunB (JUNB)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: -8.92E-01
p-value: 4.99E-05
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.95E+00 GSE60213
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [119]
Responsed Disease Lung cancer [ICD-11: 2C25]
Target Regulation Up regulation
Pathway Response Cytokine-cytokine receptor interaction hsa04060
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
LC-2/ad Lung adenocarcinoma Homo sapiens CVCL_1373
Response Summary m6A methyltransferase METTL3 is indispensable for TGF-beta-induced EMT of lung cancer cells through the regulation of Transcription factor JunB (JUNB).
Transcription factor SOX-2 (SOX2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: 5.94E-01
p-value: 9.57E-57
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 6.08E+00 GSE60213
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [120]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Target Regulation Up regulation
Pathway Response Signaling pathways regulating pluripotency of stem cells hsa04550
Cell Process DNA repair
Nucleotide excision repair (hsa03420)
In-vitro Model
 Mouse immortalized astrocytes (A type of glial cell)
Response Summary GBM tumors have elevated levels of METTL3 transcripts and silencing METTL3 in U87/TIC inhibited tumor growth in an intracranial orthotopic mouse model with prolonged mice survival. The exogenous overexpression of 3'UTR-less Transcription factor SOX-2 (SOX2) significantly alleviated the inhibition of neurosphere formation observed in METTL3 silenced GSCs.
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [121]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Signaling pathways regulating pluripotency of stem cells hsa04550
Cell Process Cell self-renewal
Stem cell frequency
Cell migration
In-vitro Model
 CCD-112CoN Normal Homo sapiens CVCL_6382
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HCT 15 Colon adenocarcinoma Homo sapiens CVCL_0292
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
LS174T Colon adenocarcinoma Homo sapiens CVCL_1384
RKO Colon carcinoma Homo sapiens CVCL_0504
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
Response Summary METTL3, acting as an oncogene, maintained Transcription factor SOX-2 (SOX2) expression through an m6A-IGF2BP2-dependent mechanism in CRC cells, and indicated a potential biomarker panel for prognostic prediction in Colorectal carcinoma.
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [122]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
In-vitro Model
 MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
BT-474 Invasive breast carcinoma Homo sapiens CVCL_0179
Response Summary Knockdown of METTL3 downregulated protein levels of Transcription factor SOX-2 (SOX2), CD133 and CD44 in MCF-7 cells. METTL3 is upregulated in breast cancer, and it promotes the stemness and malignant progression of BCa through mediating m6A modification on SOX2 mRNA.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [349]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation Up regulation
Cognitive disorders [ICD-11: 6E0Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [350]
Responsed Disease Cognitive disorders [ICD-11: 6E0Z]
Responsed Drug LPS Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
Transcriptional coactivator YAP1 (YAP1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LNCaP cell line Homo sapiens
Treatment: shMETTL3 LNCaP cells
Control: shControl LNCaP cells
 GSE147884
Regulation
logFC: 6.80E-01
p-value: 6.99E-58
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.22E+00 GSE60213
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [123]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell metastasis
In-vitro Model
 MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
GES-1 Normal Homo sapiens CVCL_EQ22
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
Response Summary The expression of m6A and METTL3 was upregulated in human gastric cancer tissues and gastric cancer cell lines. m6A methyltransferase METTL3 promoted the proliferation and migration of gastric cancer cells through the m6A modification of Transcriptional coactivator YAP1 (YAP1).
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [124]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Hippo signaling pathway hsa04390
Cell Process Cell invasion
Cell migration
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
In-vivo Model BALB/c nude mice (4 weeks old) were acquired from Vital River Laboratory (Beijing, China). HCT116 cells with stable circ1662 expression (2 × 106 in 100 L of PBS) were injected via the tail vein. After 45 days, the mice were sacrificed. The lung metastatic carcinoma specimens were processed into paraffin-embedded sections for subsequent H&E staining and IHC.
Response Summary METTL3-induced circ1662 promoted colorectal cancer cell invasion and migration by accelerating Transcriptional coactivator YAP1 (YAP1) nuclear transport. Circ1662 enhanced CRC invasion and migration depending on YAP1 and SMAD3. This result implies that circ1662 is a new prognostic and therapeutic marker for CRC metastasis.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [125]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
Pathway Response Hippo signaling pathway hsa04390
Cell Process Cell migration and invasion
In-vitro Model
 Homo sapiens (SK-HEP-1-Luc (luciferase labeled) cells were obtained from OBIO (Shanghai, China).)
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model 1 × 107 SK-HEP-1-Luc-shControl or SK-HEP-1-Luc-shMETTL3 stable cells were suspended in 300 uL of PBS and injected orthotopically into the left liver lobe of nude mice.
Response Summary m6A methylation plays a key role in VM formation in HCC. METTL3 and Transcriptional coactivator YAP1 (YAP1) could be potential therapeutic targets via impairing VM formation in anti-metastatic strategies.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [126]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Hippo signaling pathway hsa04390
Cell Process Metabolic
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Calu-6 Lung adenocarcinoma Homo sapiens CVCL_0236
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
In-vivo Model Mice were injected with 5 × 106 lung cancer cells with stably expression of relevant plasmids and randomly divided into two groups (five mice per group) after the diameter of the xenografted tumors had reached approximately 5 mm in diameter. Xenografted mice were then administrated with PBS or DDP (3 mg/kg per day) for three times a week, and tumor volume were measured every second day.
Response Summary METTL3, YTHDF3, YTHDF1, and eIF3b directly promoted YAP translation through an interaction with the translation initiation machinery. METTL3 knockdown inhibits tumor growth and enhances sensitivity to DDP in vivo.m6A mRNA methylation initiated by METTL3 directly promotes YAP translation and increases YAP activity by regulating the MALAT1-miR-1914-3p-Transcriptional coactivator YAP1 (YAP1) axis to induce Non-small cell lung cancer drug resistance and metastasis.
Triple-negative breast cancer [ICD-11: 2C6Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [351]
Responsed Disease Triple-negative breast cancer [ICD-11: 2C6Z]
Target Regulation Up regulation
In-vitro Model
 U2OS Osteosarcoma Homo sapiens CVCL_0042
WI-38 VA13 subline 2RA
 N.A. Homo sapiens CVCL_2759
CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
HEK293T Normal Homo sapiens CVCL_0063
Injuries of spine or trunk [ICD-11: ND51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [352]
Responsed Disease Spinal cord injury [ICD-11: ND51.2]
Target Regulation Up regulation
Translocation protein SEC62 (SEC62)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line CT26 cell line Mus musculus
Treatment: METTL3 knockout CT26 cells
Control: CT26 cells
 GSE142589
Regulation
logFC: -8.61E-01
p-value: 1.21E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.99E+00 GSE60213
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [127]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Pathway Response Protein processing in endoplasmic reticulum hsa04141
Cell Process RNA stability
Cell apoptosis
In-vitro Model
 GES-1 Normal Homo sapiens CVCL_EQ22
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
Response Summary MiR-4429 prevented gastric cancer progression through targeting METTL3 to inhibit m6A-caused stabilization of Translocation protein SEC62 (SEC62), indicating miR-4429 as a promising target for treatment improvement for Gastric cancer. METTL3 interacted with SEC62 to induce the m6A on SEC62 mRNA, therefore facilitated the stabilizing effect of IGF2BP1 on SEC62 mRNA.
Colorectal cancer [ICD-11: 2B91]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [128]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Fluorouracil Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Protein degradation
In-vitro Model
 DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model DLD-1 cells were subcutaneously implanted into 4-6 weeks old female nude mice. When tumors reached a size of about 50 mm3, the nude mice were randomly divided into 6 groups.
Response Summary Translocation protein SEC62 (SEC62) upregulated by the METTL3-mediated m6A modification promotes the stemness and chemoresistance of colorectal cancer by binding to beta-catenin and enhancing Wnt signalling. Depletion of Sec62 sensitized the CRC cells to 5-Fu or oxaliplatin treatment.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [128]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Oxaliplatin Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Protein degradation
In-vitro Model
 DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model DLD-1 cells were subcutaneously implanted into 4-6 weeks old female nude mice. When tumors reached a size of about 50 mm3, the nude mice were randomly divided into 6 groups.
Response Summary Translocation protein SEC62 (SEC62) upregulated by the METTL3-mediated m6A modification promotes the stemness and chemoresistance of colorectal cancer by binding to beta-catenin and enhancing Wnt signalling. Depletion of Sec62 sensitized the CRC cells to 5-Fu or oxaliplatin treatment.
Tumor necrosis factor (TNF/TNF-alpha)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Raw 264.7 cell line Mus musculus
Treatment: METTL3 knockout Raw 264.7 cells
Control: Wild type Raw 264.7 cells
 GSE162248
Regulation
logFC: -8.06E-01
p-value: 1.88E-29
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 4.17E+00 GSE60213
B-cell lymphomas [ICD-11: 2A86]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease B-cell lymphomas [ICD-11: 2A86]
Target Regulation Up regulation
Pathway Response Apoptosis hsa04210
Cell Process Cell proliferation and metastasis
Cell apoptosis
In-vitro Model
 ATDC-5 Mouse teratocarcinoma Mus musculus CVCL_3894
In-vivo Model For MIA + SAH control, S-adenosylhomocysteine (SAH), Mettl3 inhibitor (10 mg/kg) (MCE, NJ, USA) was injected intraperitoneally before MIA injection and maintained twice a week until mice were sacrificed.
Response Summary Mettl3 inhibitor, S-adenosylhomocysteine promoted the apoptosis and autophagy of chondrocytes with inflammation in vitro and aggravated the degeneration of chondrocytes and subchondral bone in monosodium iodoacetate (MIA) induced temporomandibular joint osteoarthritis mice in vivo. Bcl2 protein interacted with Beclin1 protein in chondrocytes induced by Tumor necrosis factor (TNF/TNF-alpha) stimulation. Mettl3 inhibits the apoptosis and autophagy of chondrocytes in inflammation through m6A/Ythdf1/Bcl2 signal axis which provides promising therapeutic strategy for temporomandibular joint osteoarthritis.
Dentofacial anomalies [ICD-11: DA0E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease Temporomandibular joint disorders [ICD-11: DA0E.8]
Target Regulation Up regulation
Pathway Response Apoptosis hsa04210
Cell Process Cell proliferation and metastasis
Cell apoptosis
In-vitro Model
 ATDC-5 Mouse teratocarcinoma Mus musculus CVCL_3894
In-vivo Model For MIA + SAH control, S-adenosylhomocysteine (SAH), Mettl3 inhibitor (10 mg/kg) (MCE, NJ, USA) was injected intraperitoneally before MIA injection and maintained twice a week until mice were sacrificed.
Response Summary Mettl3 inhibitor, S-adenosylhomocysteine promoted the apoptosis and autophagy of chondrocytes with inflammation in vitro and aggravated the degeneration of chondrocytes and subchondral bone in monosodium iodoacetate (MIA) induced temporomandibular joint osteoarthritis mice in vivo. Bcl2 protein interacted with Beclin1 protein in chondrocytes induced by Tumor necrosis factor (TNF/TNF-alpha) stimulation. Mettl3 inhibits the apoptosis and autophagy of chondrocytes in inflammation through m6A/Ythdf1/Bcl2 signal axis which provides promising therapeutic strategy for temporomandibular joint osteoarthritis.
Tumor protein 63 (TP63)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: 4.35E+00
p-value: 1.15E-34
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 6.67E+00 GSE60213
Cutaneous squamous cell carcinoma [ICD-11: 2C31]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [129]
Responsed Disease Cutaneous squamous cell carcinoma [ICD-11: 2C31.Z]
Target Regulation Up regulation
Pathway Response Signaling pathways regulating pluripotency of stem cells hsa04550
Cell Process Cell proliferation
In-vitro Model
 A-431 Skin squamous cell carcinoma Homo sapiens CVCL_0037
HSC-1 Skin squamous cell carcinoma Homo sapiens CVCL_2807
In-vivo Model 2 × 106 cells were suspended in 150 uL DMEM. The A431 cells (scrambled group and shRNA1 group) were injected subcutaneously into the flanks of nude mice.
Response Summary METTL3 knock down and methylation inhibitor cycloleucine could decrease the m6A levels and the expression of DeltaNp63 in Cutaneous squamous cell carcinoma.
Tyrosine-protein kinase JAK2 (JAK2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Raw 264.7 cell line Mus musculus
Treatment: METTL3 knockout Raw 264.7 cells
Control: Wild type Raw 264.7 cells
 GSE162248
Regulation
logFC: -7.87E-01
p-value: 4.26E-20
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 7.70E+00 GSE60213
Atherosclerosis [ICD-11: BD40]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [130]
Responsed Disease Atherosclerosis [ICD-11: BD40.Z]
Target Regulation Up regulation
Pathway Response JAK-STAT signaling pathway hsa04630
Cell Process Cell proliferation and migration
In-vitro Model
 HUVEC-C Normal Homo sapiens CVCL_2959
In-vivo Model The adeno-associated viruses (AAV) that could silence METTL3 (sh-METTL3) and the negative control adeno-associated viruses (sh-NC) were obtained from WZ Biosciences Inc. (Jinan, China). APOE-/- mice were randomly divided into AS + sh-NC and AS + sh-METTL3 groups. Each group contains five mice. Mice were fed with the standard diet for 1 week to acclimatize. After 1 week of acclimation, mice were challenged with a high-fat and high-cholesterol feed H10540 (Beijing HFK BIOSCIENCE Co., Ltd., Beijing, China). The formula of the H10540 feed was shown in Supplementary File S1. After 8 weeks of HFD feeding, sh-NC or sh-METTL3 adeno-associated virus serotype 9 (AAV9, 1012 viral genome copies per mouse) were respectively delivered into mice in AS + sh-NC or AS + sh-METTL3 group through tail vein injection. At 14 weeks after HDF feeding, mice fasted overnight.
Response Summary METTL3 knockdown prevented Atherosclerosis progression by inhibiting Tyrosine-protein kinase JAK2 (JAK2)/STAT3 pathway via IGF2BP1.
Ubiquitin-like modifier-activating enzyme ATG7 (ATG7)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 6.17E-01
p-value: 3.67E-05
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 4.77E+00 GSE60213
Enterovirus [ICD-11: 1A2Y]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Enterovirus [ICD-11: 1A2Y]
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cell proliferation and metastasis
Cell apoptosis
Cell autophagy
In-vitro Model
 Schwann cells (A type of glial cell that surrounds neurons)
Response Summary Knocking down METTL3 prevented Enterovirus 71-induced cell death and suppressed Enterovirus 71-induced expression of Bax while rescuing Bcl-2 expression after Enterovirus 71 infection. Knocking down METTL3 inhibited Enterovirus 71-induced expression of Atg5, Ubiquitin-like modifier-activating enzyme ATG7 (ATG7) and LC3 II. Knocking down METTL3 inhibited Enterovirus 71-induced apoptosis and autophagy.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [17]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Sorafenib Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response FoxO signaling pathway hsa04068
Autophagy hsa04140
Cell Process Cell autophagy
Response Summary METTL3 can sensitise hepatocellular carcinoma cells to sorafenib through stabilising forkhead box class O3 (FOXO3) in an m6A-dependent manner and translated by YTHDF1, thereby inhibiting the transcription of autophagy-related genes, including ATG3, ATG5, Ubiquitin-like modifier-activating enzyme ATG7 (ATG7), ATG12, and ATG16L1.
Lung cancer [ICD-11: 2C25]
In total 3 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Chloroquine Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model
 Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, Ubiquitin-like modifier-activating enzyme ATG7 (ATG7), LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Gefitinib Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model
 Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, Ubiquitin-like modifier-activating enzyme ATG7 (ATG7), LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Beta-Elemen Phase 3
 Drug Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model
 Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, Ubiquitin-like modifier-activating enzyme ATG7 (ATG7), LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [131]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Target Regulation Down regulation
Pathway Response Autophagy hsa04140
Cell Process Cellular senescence
Cell autophagy
In-vitro Model
 C-28/I2 Normal Homo sapiens CVCL_0187
FLS (Rat fibroblast synovial cell line)
In-vivo Model Mice were anaesthetized with isoflurane supplied in a mouse anaesthesia apparatus, followed with joint surgery on the right joint by sectioning the medial meniscotibial ligament.
Response Summary In osteoarthritis METTL3-mediated m6A modification decreased the expression of autophagy-related 7, an E-1 enzyme crucial for the formation of autophagosomes, by attenuating its RNA stability. Silencing METTL3 enhanced autophagic flux and inhibited Ubiquitin-like modifier-activating enzyme ATG7 (ATG7) expression in OA-FLS.
Ubiquitin-like protein ATG12 (ATG12)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Mouse testis Mus musculus
Treatment: Mettl3 knockout mouse testis
Control: Mouse testis
 GSE99771
Regulation
logFC: -2.94E+00
p-value: 6.14E-05
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.85E+00 GSE60213
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [17]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Sorafenib Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response FoxO signaling pathway hsa04068
Autophagy hsa04140
Cell Process Cell autophagy
Response Summary METTL3 can sensitise hepatocellular carcinoma cells to sorafenib through stabilising forkhead box class O3 (FOXO3) in an m6A-dependent manner and translated by YTHDF1, thereby inhibiting the transcription of autophagy-related genes, including ATG3, ATG5, ATG7, Ubiquitin-like protein ATG12 (ATG12), and ATG16L1.
Zinc finger and BTB domain-containing protein 4 (ZBTB4)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 8.19E-01
p-value: 3.59E-20
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.32E+00 GSE60213
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [132]
Responsed Disease Lung cancer [ICD-11: 2C25]
Target Regulation Down regulation
Pathway Response RNA degradation hsa03018
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 HBE (Human bronchial epithelial cell line)
In-vivo Model Male BALB/c mice were grouped into control, CS, CS+AAV-ShMETTL3, and CS+AAV-NC shRNA groups, n = 6 animals per group. Mice in the AAV-ShMETTL3 and AAV-NC shRNA (GeneChem, China) groups were dosed by intranasal instillation after CS exposure for 4 weeks.
Response Summary METTL3-mediated m6A modification of Zinc finger and BTB domain-containing protein 4 (ZBTB4) via EZH2 is involved in the CS-induced EMT and in lung cancer.
Zinc finger MYM-type protein 1 (ZMYM1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3 knockout liver
Control: Wild type liver cells
 GSE198513
Regulation
logFC: 7.91E-01
p-value: 6.45E-05
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.20E+00 GSE60213
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [133]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Pathway Response Cytokine-cytokine receptor interaction hsa04060
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
GES-1 Normal Homo sapiens CVCL_EQ22
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
MKN28 Gastric tubular adenocarcinoma Homo sapiens CVCL_1416
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
In-vivo Model The luciferase signal intensity from days 7 to 42 is on equivalent scales in the models. Bioluminescent flux (photons/s/cm2/steradian) was determined for the lung metastases.
Response Summary The m6A modification of Zinc finger MYM-type protein 1 (ZMYM1) mRNA by METTL3 enhanced its stability relying on the "reader" protein HuR (also known as ELAVL1) dependent pathway.The study uncover METTL3/ZMYM1/E-cadherin signaling as a potential therapeutic target in anti-metastatic strategy against Gastric cancer.
Zinc finger protein 750 (ZNF750)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3-deficient liver
Control: Wild type liver cells
 GSE197800
Regulation
logFC: 1.24E+00
p-value: 8.99E-10
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 5.92E+00 GSE60213
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [134]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Down regulation
Cell Process Cell apoptosis
In-vitro Model
 5-8F Nasopharyngeal carcinoma Homo sapiens CVCL_C528
6-10B Nasopharyngeal carcinoma Homo sapiens CVCL_C529
C666-1 Nasopharyngeal carcinoma Homo sapiens CVCL_7949
HNE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_0308
HONE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_8706
NP69 (A human immortalized nasopharyngeal epithelial)
S18 Nasopharyngeal carcinoma Homo sapiens CVCL_B0U9
S26 Nasopharyngeal carcinoma Homo sapiens CVCL_B0UB
SUNE1 Nasopharyngeal carcinoma Homo sapiens CVCL_6946
In-vivo Model BALB/c-nu mice (4-6 weeks old, female) were purchased from Charles River Laboratories (Beijing, China), and SUNE1-vector-luciferase or SUNE1-ZNF750-luciferase cells (1 × 106) were subcutaneously injected into the dorsal or ventral flank.
Response Summary m6A modifications maintained the low expression level of ZNF750 in NPC. Knocking down METTL3 stimulated endogenous Zinc finger protein 750 (ZNF750) expression, and vice versa.
Zinc finger protein GLI1 (GLI1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HUVEC cell line Homo sapiens
Treatment: shMETTL3 HUVEC cells
Control: shScramble HUVEC cells
 GSE157544
Regulation
logFC: 7.30E-01
p-value: 2.91E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 7.23E+00 GSE60213
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [135]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
Pathway Response Hedgehog signaling pathway hsa04340
Cell Process Cell proliferation
Cell survival
Cell colony formation
Cell invasion
In-vitro Model
 LNCaP C4-2 Prostate carcinoma Homo sapiens CVCL_4782
LNCaP C4-2B Prostate carcinoma Homo sapiens CVCL_4784
DU145 Prostate carcinoma Homo sapiens CVCL_0105
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
In-vivo Model Equal number of PC-3 cells was injected subcutaneously into right flank.
Response Summary METTL3 silence decreased the m6A modification and expression of Zinc finger protein GLI1 (GLI1), an important component of hedgehog pathway, which led to cell apoptosis.the m6A methyltransferase METTL3 promotes the growth and motility of prostate cancer cells by regulating hedgehog pathway.
FOXD2 adjacent opposite strand RNA 1 (FOXD2-AS1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: 1.16E+00
p-value: 1.63E-05
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 5.78E+00 GSE60213
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [136]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Up regulation
Cell Process Cell migration and proliferation
In-vitro Model
 C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
Ca Ski Cervical squamous cell carcinoma Homo sapiens CVCL_1100
HaCaT Normal Homo sapiens CVCL_0038
HT-3 Cervical carcinoma Homo sapiens CVCL_1293
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
In-vivo Model A total 5 × 106 stably transfected SiHa cells were subcutaneously injected into the flank of nude mice.
Response Summary METTL3/FOXD2 adjacent opposite strand RNA 1 (FOXD2-AS1) accelerates cervical cancer progression via a m6A-dependent modality, which serves as a potential therapeutic target for cervical cancer.
KRT7-AS
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HUVEC cell line Homo sapiens
Treatment: shMETTL3 HUVEC cells
Control: shScramble HUVEC cells
 GSE157544
Regulation
logFC: -5.89E-01
p-value: 3.54E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 8.95E+00 GSE60213
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [137]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Cell Process Lung Metastasis
In-vitro Model
 MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
BT-549 Invasive breast carcinoma Homo sapiens CVCL_1092
In-vivo Model First, subcutaneous transplanted model was used to evaluate the growth of BT-549LMF3 and BT-549 cells. Cells (5 × 106 per mouse, n = 5 for each group) were diluted in 200 ul PBS + 200 ul Matrigel (BD Biosciences) and subcutaneously injected into immunodeficient female mice. Second, subcutaneous transplanted model was used to evaluate the metastasis potential of BT-549LMF3 and BT-549 cells. Cells (5 × 106 per mouse, n = 5 for each group) were diluted in 200 ul PBS + 200 ul Matrigel (BD Biosciences) and subcutaneously injected into immunodeficient female mice. Third, the in vivo lung metastasis model was established by injecting with BT-549, BT-549LMF3, FTO stable BT-549LMF3, sh-METTL3 BT-549LMF3, and sh-KRT7 BT-549LMF3 stable cells (1 × 106 per mouse, n = 5 for each group).
Response Summary Specifically, increased METTL3 methylated KRT7-AS at A877 to increase the stability of a KRT7-AS/KRT7 mRNA duplex via IGF2BP1/HuR complexes. m6A promotes breast cancer lung metastasis by increasing the stability of a KRT7-AS/KRT7 mRNA duplex and translation of KRT7.
LBX2 antisense RNA 1 (LBX2-AS1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -8.54E-01
p-value: 2.13E-07
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 6.38E+00 GSE60213
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [138]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Fluorouracil Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary The increased LBX2 antisense RNA 1 (LBX2-AS1) in CRC was mediated by METTL3-dependent m6A methylation. LBX2-AS1 serves as a therapeutic target and predictor of 5-FU benefit in colorectal cancer patients.
LncRNA activating regulator of DKK1 (LNCAROD)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 9.04E-01
p-value: 2.47E-45
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 5.11E+00 GSE60213
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [139]
Responsed Disease Head and neck squamous carcinoma [ICD-11: 2B6E]
Target Regulation Up regulation
Pathway Response Proteasome hsa03050
Cell Process Proteasomal degradation
In-vitro Model
 C666-1 Nasopharyngeal carcinoma Homo sapiens CVCL_7949
CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
FaDu Hypopharyngeal squamous cell carcinoma Homo sapiens CVCL_1218
HK1 Nasopharyngeal carcinoma Acipenser baerii CVCL_YE27
NP69 (A human immortalized nasopharyngeal epithelial)
Tca8113 Endocervical adenocarcinoma Homo sapiens CVCL_6851
Response Summary The N6-methyladenosine (m6A) modification mediated by METTL3 and METTL14 enhanced the stability of LncRNA activating regulator of DKK1 (LNCAROD) in head and neck squamous cell carcinoma cells. LNCAROD is stabilized by m6A methylation and promotes cancer progression via forming a ternary complex with HSPA1A and YBX1 in head and neck squamous cell carcinoma.
Long intergenic non-protein coding RNA 1833 (LINC01833)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: 1.55E+00
p-value: 2.63E-05
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 7.09E+00 GSE60213
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [140]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model
 NCI-H1650 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1483
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
BEAS-2B Normal Homo sapiens CVCL_0168
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
In-vivo Model For the tumorigenicity studies, 3 × 106 HCC827 cells stably expressing sh-LINC01833 or sh-NC were injected subcutaneously into the ventral side of male BALB/c nude mice in the according groups with five mice in each group. Five mice were sampled each time. Tumor size and weight were examined at 28 days after injection.
Response Summary m6A transferase METTL3-induced Long intergenic non-protein coding RNA 1833 (LINC01833) m6A methylation promotes NSCLC progression through modulating HNRNPA2B1 expression.
Long intergenic non-protein coding RNA 958 (LINC00958)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HUVEC cell line Homo sapiens
Treatment: shMETTL3 HUVEC cells
Control: shScramble HUVEC cells
 GSE157544
Regulation
logFC: -6.47E-01
p-value: 2.79E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 5.60E+00 GSE60213
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [141]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
Pathway Response mRNA surveillance pathway hsa03015
Cell Process RNA stability
Lipogenesis
In-vitro Model
 FOCUS Adult hepatocellular carcinoma Homo sapiens CVCL_7955
HCCLM3 Adult hepatocellular carcinoma Homo sapiens CVCL_6832
HEp-2 Endocervical adenocarcinoma Homo sapiens CVCL_1906
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
QSG-7701 Endocervical adenocarcinoma Homo sapiens CVCL_6944
Response Summary Long intergenic non-protein coding RNA 958 (LINC00958) sponged miR-3619-5p to upregulate hepatoma-derived growth factor (HDGF) expression, thereby facilitating Hepatocellular carcinoma lipogenesis and progression. METTL3-mediated N6-methyladenosine modification led to LINC00958 upregulation through stabilizing its RNA transcript.
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [142]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Pathway Response mRNA surveillance pathway hsa03015
Cell Process RNA transcript stability
In-vitro Model
 BT-549 Invasive breast carcinoma Homo sapiens CVCL_1092
MCF-10A Normal Homo sapiens CVCL_0598
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MDA-MB-468 Breast adenocarcinoma Homo sapiens CVCL_0419
In-vivo Model MCF-7 cells transfected with sh-LINC00958 or empty vector were resuspended at 2 × 107 cells/mL.
Response Summary m6A methyltransferase-like 3 (METTL3) gave rise to the upregulation of Long intergenic non-protein coding RNA 958 (LINC00958) by promoting its RNA transcript stability in breast cancer.
Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line DKO-1 cell line Homo sapiens
Treatment: METTL3 knockdown DKO-1 cell
Control: DKO-1 cell
 GSE182382
Regulation
logFC: 8.20E-01
p-value: 5.93E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.28E+00 GSE60213
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [143]
Responsed Disease Glioma [ICD-11: 2A00.0]
Target Regulation Up regulation
Pathway Response TNF signaling pathway hsa04668
Cell Process Cell proliferation and metastasis
In-vitro Model
 H4 Astrocytoma Homo sapiens CVCL_1239
LN-229 Glioblastoma Homo sapiens CVCL_0393
U87 (A primary glioblastoma cell line)
In-vivo Model U87 cells (5 × 105) transfected with an empty vector, METTL3 shRNA, or METTL3 overexpression vector were inoculated into the right frontal node of nude mice.
Response Summary METTL3 promoted the malignant progression of IDH-wildtype gliomas and revealed important insight into the upstream regulatory mechanism of Metastasis associated lung adenocarcinoma transcript 1 (MALAT1) and NF-Kappa-B with a primary focus on m6A modification.
Lung cancer [ICD-11: 2C25]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [126]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Hippo signaling pathway hsa04390
Cell Process Metabolic
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Calu-6 Lung adenocarcinoma Homo sapiens CVCL_0236
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
In-vivo Model Mice were injected with 5 × 106 lung cancer cells with stably expression of relevant plasmids and randomly divided into two groups (five mice per group) after the diameter of the xenografted tumors had reached approximately 5 mm in diameter. Xenografted mice were then administrated with PBS or DDP (3 mg/kg per day) for three times a week, and tumor volume were measured every second day.
Response Summary METTL3, YTHDF3, YTHDF1, and eIF3b directly promoted YAP translation through an interaction with the translation initiation machinery. METTL3 knockdown inhibits tumor growth and enhances sensitivity to DDP in vivo.m6A mRNA methylation initiated by METTL3 directly promotes YAP translation and increases YAP activity by regulating the Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)-miR-1914-3p-YAP axis to induce Non-small cell lung cancer drug resistance and metastasis.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [370]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
Thymoma [ICD-11: 2C27]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [144]
Responsed Disease Thymic epithelial tumors [ICD-11: 2C27.Y]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Cellular senescence hsa04218
Cell Process Cell viability and proliferation
In-vitro Model
 T1889 Thymic undifferentiated carcinoma Homo sapiens CVCL_D024
Response Summary This study highlighted METTL3 as a tumor promoter in Thymic tumors and c-MYC as a promising target to be exploited for the treatment of TET. High expression of c-MYC protein is enabled by lncRNA Metastasis associated lung adenocarcinoma transcript 1 (MALAT1), which is methylated and delocalized by METTL3. Silencing of METTL3 combined with cisplatin or c-MYC inhibitor induces cell death in TET cells. Blocking of c-MYC by using JQ1 inhibitor cooperates with METTL3 depletion in the inhibition of proliferation and induction of cell death.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [144]
Responsed Disease Thymic epithelial tumors [ICD-11: 2C27.Y]
Responsed Drug JQ-1 Phase 1
 Drug Info 
Target Regulation Up regulation
Pathway Response Cellular senescence hsa04218
Cell Process Cell viability and proliferation
In-vitro Model
 T1889 Thymic undifferentiated carcinoma Homo sapiens CVCL_D024
Response Summary This study highlighted METTL3 as a tumor promoter in Thymic tumors and c-MYC as a promising target to be exploited for the treatment of TET. High expression of c-MYC protein is enabled by lncRNA Metastasis associated lung adenocarcinoma transcript 1 (MALAT1), which is methylated and delocalized by METTL3. Silencing of METTL3 combined with cisplatin or c-MYC inhibitor induces cell death in TET cells. Blocking of c-MYC by using JQ1 inhibitor cooperates with METTL3 depletion in the inhibition of proliferation and induction of cell death.
Breast cancer [ICD-11: 2C60]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [116]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Doxil Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 MCF7-DoxR (Adriamycin-resistant cell line MCF7-DoxR)
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
In-vivo Model Once the tumor volume increased to about 1 cm3, six groups of MCF7 bearing mice (n = 10 in each group) were injected with PBS (0.1 ml, caudal vein) and adriamycin (0.1 ml, 10 mg/kg), respectively. When the tumor reached 1.5 cm in any direction (defined as event-free survival analysis), 10 mice in each group were selected to measure the tumor size and weight on the 12th day after adriamycin injection.
Response Summary METTL3 can regulate the expression of Metastasis associated lung adenocarcinoma transcript 1 (MALAT1) through m6A, mediate the E2F1/AGR2 axis, and promote the adriamycin resistance of breast cancer.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [57]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MDA-MB-468 Breast adenocarcinoma Homo sapiens CVCL_0419
MCF-10A Normal Homo sapiens CVCL_0598
Response Summary Silencing METTL3 down-regulate Metastasis associated lung adenocarcinoma transcript 1 (MALAT1) and HMGA2 by sponging miR-26b, and finally inhibit EMT, migration and invasion in breast cancer, providing a theoretical basis for clinical treatment of breast cancer.
Chronic kidney disease [ICD-11: GB61]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [145]
Responsed Disease Chronic kidney disease [ICD-11: GB61]
Responsed Drug Artenimol Approved
 Drug Info 
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 HK-2 [Human kidney] Normal Homo sapiens CVCL_0302
HK2 Normal Acipenser baerii CVCL_YE28
In-vivo Model For the unilateral ureteral obstruction (UUO) model, male C57BL/6J mice at 8 weeks of age (20-22 g body weight) were first anaesthetized with pentobarbital sodium (50 mg/kg) via intraperitoneal injection. Then, the left ureter was ligated using 3-0 silk and a left lateral incision.
Response Summary Renal fibrosis is a key factor in chronic kidney disease (CKD). Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)/miR-145/FAK pathway was involved in the effect of dihydroartemisinin (DHA) on TGF-beta1-induced renal fibrosis in vitro and in vivo.
Kidney failure [ICD-11: GB6Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [146]
Responsed Disease Kidney failure [ICD-11: GB6Z]
Target Regulation Up regulation
In-vitro Model
 NIT-1 Insulin tumor Mus musculus CVCL_3561
Response Summary m6A modification is co-regulated by METTL3 and FTO in cadmium-treated cells. Metastasis associated lung adenocarcinoma transcript 1 (MALAT1), LncRNA-PVT1 and m6A modification could be key nodes for cadmium-induced oxidative damage, and highlight their importance as promising preventive and therapeutic targets in cadmium toxicity.
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [368]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Target Regulation Up regulation
In-vitro Model
 hFOB 1.19 Normal Homo sapiens CVCL_3708
MG-63 Osteosarcoma Homo sapiens CVCL_0426
U2OS Osteosarcoma Homo sapiens CVCL_0042
Ewing's sarcoma [ICD-11: 2B52]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [369]
Responsed Disease Ewing's sarcoma [ICD-11: 2B52]
Target Regulation Up regulation
Prostate cancer associated transcript 6 (PCAT6)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: 1.32E+00
p-value: 7.57E-06
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 7.42E+00 GSE60213
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [147]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
Cell Process RNA stability
In-vitro Model
 PC-3 Prostate carcinoma Homo sapiens CVCL_0035
LNCaP C4-2B Prostate carcinoma Homo sapiens CVCL_4784
In-vivo Model At 1 week post-injection with PC-3 cells, mice were randomly assigned to three groups (n = 8 per group): the ASO-NC group (injection with ASO negative control targeting unknown sequence, 5 nmol in 100 uL PBS for each mouse), the ASO-L group (injection with low-dose ASO targeting PCAT6, 5 nmol in 100 uL PBS for each mouse), and the ASO-H group (injection with high-dose ASO targeting PCAT6, 10 nmol in 100 uL PBS for each mouse).
Response Summary METTL3-mediated m6A modification contributed to Prostate cancer associated transcript 6 (PCAT6) upregulation in an IGF2BP2-dependent manner. Furthermore, PCAT6 upregulated IGF1R expression by enhancing IGF1R mRNA stability through the PCAT6/IGF2BP2/IGF1R RNA-protein three-dimensional complex. The m6 A-induced PCAT6/IGF2BP2/IGF1R axis promotes PCa bone metastasis and tumor growth, suggesting that PCAT6 serves as a promising prognostic marker and therapeutic target against bone-metastatic PCa.
Small nucleolar RNA host gene 1 (SNHG1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: -1.12E+00
p-value: 7.04E-06
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.90E+00 GSE60213
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [148]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
Response Summary METTL3/Small nucleolar RNA host gene 1 (SNHG1)/miR-140-3p/UBE2C axis plays a crucial role in cancer progression and the immune response in non-small cell lung cancer.
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [374]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 NCM460 Normal Homo sapiens CVCL_0460
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
RKO Colon carcinoma Homo sapiens CVCL_0504
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
HT29 Colon cancer Mus musculus CVCL_A8EZ
THAP7 antisense RNA 1 (THAP7-AS1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line DKO-1 cell line Homo sapiens
Treatment: METTL3 knockdown DKO-1 cell
Control: DKO-1 cell
 GSE182382
Regulation
logFC: -1.23E+00
p-value: 1.77E-02
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 5.66E+00 GSE60213
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [149]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process Cell growth
Cell invasion
Cell metastasis
Response Summary LV-sh-THAP7 antisense RNA 1 (THAP7-AS1) treatment could suppress gastric cancer growth. THAP7-AS1, transcriptionally activated by SP1 and then modified by METTL3-mediated m6A, exerts oncogenic functions, by promoting interaction between NLS and importin alpha-1 and then improving the CUL4B protein entry into the nucleus to repress the transcription of miR-22-3p and miR-320a.
A disintegrin and metalloproteinase with thrombospondin motifs 9 (ADAMTS9)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HUVEC cell line Homo sapiens
Treatment: shMETTL3 HUVEC cells
Control: shScramble HUVEC cells
 GSE157544
Regulation
logFC: 8.11E-01
p-value: 4.51E-05
More Results Click to View More RNA-seq Results
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [150]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Down regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process RNA stability
In-vitro Model
 HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
In-vivo Model For the formation of xenograft tumors, 5 × 106 AGS cells mixed in Matrigel (BD Biosciences, Franklin Lakes, NJ, USA) were subcutaneously injected into BALB/c nude mice (5-week-old male).
Response Summary METTL3 facilitates GC progression through the A disintegrin and metalloproteinase with thrombospondin motifs 9 (ADAMTS9)-mediated PI3K/AKT pathway.
Acetyl-CoA carboxylase 1 (ACC1/ACACA)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MDA-MB-231 Homo sapiens
Treatment: METTL3 knockdown MDA-MB-231 cells
Control: MDA-MB-231 cells
 GSE70061
Regulation
logFC: -6.50E-01
p-value: 2.31E-03
More Results Click to View More RNA-seq Results
Type 2 diabetes mellitus [ICD-11: 5A11]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [48]
Responsed Disease Type 2 diabetes mellitus [ICD-11: 5A11]
Target Regulation Up regulation
Pathway Response Insulin resistance hsa04931
Cell Process Lipid metabolism
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model Hepatocyte-specific METTL3 knockout mice (TBG-Cre, METTL3 fl/fl) were generated by crossing mice with TBG-Cre Tg mice. METTL3 flox (METTL3 fl/fl) and hepatocyte-specific METTL3 knockout mice (TBG-Cre, METTL3 fl/fl) were used for experiments.
Response Summary Type 2 diabetes (T2D) is characterized by lack of insulin, insulin resistance and high blood sugar. METTL3 silence decreased the m6A methylated and total mRNA level of Fatty acid synthase (Fasn), subsequently inhibited fatty acid metabolism. The expression of Acetyl-CoA carboxylase 1 (ACC1/ACACA), Acly, Dgat2, Ehhadh, Fasn, Foxo, Pgc1a and Sirt1, which are critical to the regulation of fatty acid synthesis and oxidation were dramatically decreased in livers of hepatocyte-specific METTL3 knockout mice.
Actin, aortic smooth muscle (ACTA2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -3.22E+00
p-value: 6.14E-220
More Results Click to View More RNA-seq Results
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [151]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Cell Process Cell proliferation
In-vitro Model
 BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
GES-1 Normal Homo sapiens CVCL_EQ22
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
Response Summary METTL3 knockdown decreased Actin, aortic smooth muscle (ACTA2) muscle actin. Taken together, our finding revealed that m6A methylation writer METTL3 serve as an oncogene in tumorigenesis of Gastric cancer.
Adenylate kinase 4, mitochondrial (AK4)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -5.87E-01
p-value: 2.40E-51
More Results Click to View More RNA-seq Results
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [152]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Tamoxifen Approved
 Drug Info 
Target Regulation Up regulation
Cell Process Mitochondrial apoptosis
In-vitro Model
 MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF7-TamR Invasive breast carcinoma Homo sapiens CVCL_EG55
Response Summary Adenylate kinase 4 modulates the resistance of breast cancer cells to tamoxifen through an m6A-based epitranscriptomic mechanism. Genetic depletion of METTL3 in TamR MCF-7 cells led to a diminished Adenylate kinase 4, mitochondrial (AK4) protein level and attenuated resistance to tamoxifen.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [265]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
In-vitro Model
 L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
SMMC-7721 Endocervical adenocarcinoma Homo sapiens CVCL_0534
BEL-7404 Endocervical adenocarcinoma Homo sapiens CVCL_6568
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Alpha-enolase (ENO1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: -8.80E-01
p-value: 3.03E-81
More Results Click to View More RNA-seq Results
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [153]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Up regulation
Pathway Response Carbon metabolism hsa01200
Glycolysis / Gluconeogenesis hsa00010
Cell Process Glycolysis
In-vitro Model
 PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
NCI-H441 Lung papillary adenocarcinoma Homo sapiens CVCL_1561
NCI-H292 Lung mucoepidermoid carcinoma Homo sapiens CVCL_0455
NCI-H2030 Lung adenocarcinoma Homo sapiens CVCL_1517
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H1650 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1483
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
3LL Malignant tumors of the mouse pulmonary system Mus musculus CVCL_5653
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
Calu-1 Lung squamous cell carcinoma Homo sapiens CVCL_0608
BEAS-2B Normal Homo sapiens CVCL_0168
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
A-427 Lung adenocarcinoma Homo sapiens CVCL_1055
16HBE14o- Normal Homo sapiens CVCL_0112
In-vivo Model KP and Mettl3-/- mice were bred to generate KPM-/- mice. Afterwards, the KP and KPM-/- mice were intranasally infected under anesthesia with adeno-associated virus type 5 (AAV5) expressing Cre to initiate lung tumorigenesis along with ALKBH5-expressing AAV5 or Empty AAV5 to generate KPE, KPA, KPEM-/- and KPAM-/- spontaneous LUAD mouse models. For generation of LLC-based intra-pulmonary tumor mouse models, 1 × 107 LLC cells were injected into C57BL/6 mice via the tail vein.For cell-derived xenograft (CDX) mouse models, 1.0 × 107 H1299 or 1.5 × 107 H1975 cells were subcutaneously injected into 4-6-week-old athymic nude mice. The tumors were monitored at indicated time points and isolated for further analysis after sacrifice.
Response Summary Alpha-enolase (ENO1) positively correlated with METTL3 and global m6A levels, and negatively correlated with ALKBH5 in human Lung adenocarcinoma(LUAD). In addition, m6A-dependent elevation of ENO1 was associated with LUAD progression.
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [266]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
In-vitro Model
 T24 Bladder carcinoma Homo sapiens CVCL_0554
5637 Bladder carcinoma Homo sapiens CVCL_0126
UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
RT-4 Bladder carcinoma Homo sapiens CVCL_0036
J82 Bladder carcinoma Homo sapiens CVCL_0359
SV-HUC-1 Normal Homo sapiens CVCL_3798
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model For the subcutaneous implantation model, 5 × 106 cells (n = 6 per group) were subcutaneously injected into the flank regions of 4-5 weeks female BALB/c nude mice. Tumor volume was calculated as 0.5 × W2 × L (where W and L represent a tumor's width and length, respectively). After xenografts were generated, DMSOand SB431542 (10 mg/kg, #301836-41-9, SANTA CRUZ BIOTECHNOLOGY), or ENOblock (#1177827-73-4, 8 mg/kg, MCE) were administered daily. All animal experiments were approved by The Affiliated Hospital of Qingdao University Committee on Animal Care.
AMPK subunit alpha-1 (AMPK/PRKAA1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 7.94E-01
p-value: 1.12E-47
More Results Click to View More RNA-seq Results
Atherosclerosis [ICD-11: BD40]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [154]
Responsed Disease Atherosclerosis [ICD-11: BD40.Z]
Target Regulation Down regulation
Pathway Response AMPK signaling pathway hsa04152
Cell Process Cell apoptosis
In-vitro Model
 hTERT-RPE1 Normal Homo sapiens CVCL_4388
iHAEC Normal Homo sapiens CVCL_C0EQ
Response Summary m6A driven machinery in virus-induced vascular endothelium damage and highlight the significance of vitamin D3 in the intervention of HCMV-induced atherosclerosis. METTL3 methylates mitochondrial calcium uniporter (MCU), the main contributor to HCMV-induced apoptosis of vascular endothelial cells, at three m6A residues in the 3'-UTR. Vitamin D3 downregulated the METTL3 by inhibiting the activation of AMPK subunit alpha-1 (AMPK/PRKAA1), thereby inhibiting the m6A modification of MCU and cell apoptosis.
Anterior gradient protein 2 homolog (AGR2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -7.71E-01
p-value: 1.08E-130
More Results Click to View More RNA-seq Results
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [116]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Doxil Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 MCF7-DoxR (Adriamycin-resistant cell line MCF7-DoxR)
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
In-vivo Model Once the tumor volume increased to about 1 cm3, six groups of MCF7 bearing mice (n = 10 in each group) were injected with PBS (0.1 ml, caudal vein) and adriamycin (0.1 ml, 10 mg/kg), respectively. When the tumor reached 1.5 cm in any direction (defined as event-free survival analysis), 10 mice in each group were selected to measure the tumor size and weight on the 12th day after adriamycin injection.
Response Summary METTL3 can regulate the expression of MALAT1 through m6A, mediate the E2F1/Anterior gradient protein 2 homolog (AGR2) axis, and promote the adriamycin resistance of breast cancer.
ATP-citrate synthase (ACLY)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3 knockout liver
Control: Wild type liver cells
 GSE198513
Regulation
logFC: -6.16E-01
p-value: 1.78E-18
More Results Click to View More RNA-seq Results
Type 2 diabetes mellitus [ICD-11: 5A11]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [48]
Responsed Disease Type 2 diabetes mellitus [ICD-11: 5A11]
Target Regulation Up regulation
Pathway Response Insulin resistance hsa04931
Cell Process Lipid metabolism
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model Hepatocyte-specific METTL3 knockout mice (TBG-Cre, METTL3 fl/fl) were generated by crossing mice with TBG-Cre Tg mice. METTL3 flox (METTL3 fl/fl) and hepatocyte-specific METTL3 knockout mice (TBG-Cre, METTL3 fl/fl) were used for experiments.
Response Summary Type 2 diabetes (T2D) is characterized by lack of insulin, insulin resistance and high blood sugar. METTL3 silence decreased the m6A methylated and total mRNA level of Fatty acid synthase (Fasn), subsequently inhibited fatty acid metabolism. The expression of Acc1, ATP-citrate synthase (ACLY), Dgat2, Ehhadh, Fasn, Foxo, Pgc1a and Sirt1, which are critical to the regulation of fatty acid synthesis and oxidation were dramatically decreased in livers of hepatocyte-specific METTL3 knockout mice.
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [112]
Responsed Disease Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation Up regulation
Pathway Response Glycerolipid metabolism hsa00561
Cell Process Lipid metabolism
In-vitro Model
 LM3 Malignant neoplasms Mus musculus CVCL_D269
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
In-vivo Model Mice with a Tmem30a deletion specifically in pancreatic beta cells were generated as previously described. Mice developed with NAFLD were named for Tmem30a-associated NAFLD (TAN) mice. The littermate mice with genotypes of Tmem30aloxP/loxP were used as controls.
Response Summary Targeting METTL3/14 in vitro increases protein level of ATP-citrate synthase (ACLY) and SCD1 as well as triglyceride and cholesterol production and accumulation of lipid droplets. These findings demonstrate a new NAFLD mouse model that provides a study platform for DM2-related NAFLD and reveals a unique epitranscriptional regulating mechanism for lipid metabolism via m6A-modified protein expression of ACLY and SCD1.
ATP-dependent translocase ABCB1 (ABCB1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -1.24E+00
p-value: 2.14E-202
More Results Click to View More RNA-seq Results
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [22]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Doxil Approved
 Drug Info 
Target Regulation Up regulation
Cell Process Cell growth and death
Cell apoptosis
In-vitro Model
 ADR-resistant MCF-7 (MCF-7/ADR) cells (Human breast cancer doxorubicin-resistant cell line)
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
In-vivo Model Cell suspensions (2 × 106 cells/mL) made with MCF-7/ADR cells stably expressing METTL3 and/or miR-221-3p inhibitor were subcutaneously implanted into each mouse. One week later, xenografted mice were injected with 0.1 mL ADR (25 mg/kg, intraperitoneal injection) twice a week.
Response Summary METTL3 promotes adriamycin resistance in MCF-7 breast cancer cells by accelerating pri-microRNA-221-3p maturation in a m6A-dependent manner. METTL3 knockdown was shown to reduce the expression of miR-221-3p by reducing pri-miR-221-3p m6A mRNA methylation, reducing the expression of ATP-dependent translocase ABCB1 (ABCB1) and BCRP, and inducing apoptosis. Identified the METTL3/miR-221-3p/HIPK2/Che-1 axis as a novel signaling event that will be responsible for resistance of BC cells to ADR.
Beclin-1 associated RUN domain containing protein (RUBCN/Rubicon)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 6.54E-01
p-value: 1.80E-06
More Results Click to View More RNA-seq Results
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [155]
Responsed Disease Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cell autophagy
In-vitro Model
 AML12 Normal Mus musculus CVCL_0140
Hepa 1-6 Hepatocellular carcinoma of the mouse Mus musculus CVCL_0327
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model All mice were housed in specific pathogen-free conditions in the animal facility with constant temperature and humidity under a 12-h light/12-h dark cycle, with free access to water and food. After a week of adaptation, they were then divided into two groups randomly and fed with a HFD (60 kcal% fat, D12492, Research Diets) or standard normal chow diet (CD) for 16 weeks, respectively.
Response Summary The upregulation of METTL3 and YTHDF1 induced by lipotoxicity contributes to the elevated expression level of Beclin-1 associated RUN domain containing protein (RUBCN/Rubicon) in an m6A-dependent manner, which inhibits the fusion of autophagosomes and lysosomes and further suppresses the clearance of LDs via lysosomes in nonalcoholic fatty liver disease.
Brain and muscle ARNT-like 1 (Bmal1/ARNTL)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: -1.11E+00
p-value: 1.53E-46
More Results Click to View More RNA-seq Results
Metabolic disorders [ICD-11: 5D2Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [92]
Responsed Disease Metabolic disorders [ICD-11: 5D2Z]
Target Regulation Up regulation
Pathway Response Adipocytokine signaling pathway hsa04920
Cell Process Llipid metabolism
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Hepa 1-6 Hepatocellular carcinoma of the mouse Mus musculus CVCL_0327
In-vivo Model Liver-specific Bmal1f/f-AlbCre-knockout mice were purchased from Jackson Laboratory. C57BI/6J or Bmal1f/f-AlbCre-knockout male mice were maintained under a 12 hr light/12 hr dark (LD) cycle (ZT0 = 6 AM) and fed ad libitum with normal rodent chow (2018 Global 18% Protein diet, Envigo) and water. At 10-14 weeks of age, 10 male mice per group were sacrificed via CO2 asphyxiation at Zeitgeber Time (ZT) 0,2,6,10,12,14,18,22. In order to induce high levels of ROS in the liver, WT male mice were fasted 12 h and followed by intraperitoneal injection with 300 mg/kg APAP dissolved in PBS and re-fed.
Response Summary PPaRalpha to mediate its mRNA stability to regulate lipid metabolism. Hepatic deletion of Brain and muscle ARNT-like 1 (Bmal1/ARNTL) increases m6A mRNA methylation, particularly of PPaRalpha. Inhibition of m6A methylation via knockdown of m6A methyltransferase METTL3 decreases PPaR-Alpha m6A abundance and increases PPaRalpha mRNA lifetime and expression, reducing lipid accumulation in cells in vitro. YTHDF2 binds to PPaRalpha to mediate its mRNA stability to regulate lipid metabolism. Transcriptional regulation of circadian rhythms is essential for lipid metabolic homeostasis, disruptions of which can lead to metabolic diseases.
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [156]
Responsed Disease Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation Up regulation
In-vivo Model M3LKO (Mettl3fl/fl; Alb-Cre) mice were generated by crossing Mettl3fl/fl mice (provided by Dr. Jacob Hanna) with albumin-Cre mice (Jackson Laboratories, Bar Harbor, ME), and genotypes were confirmed by tail-DNA PCR using primers as previously described.
Response Summary Liver-specific Mettl3 knockout mice exhibited global decrease in m6A on polyadenylated RNAs and pathologic features associated with nonalcoholic fatty liver disease. Studies in the M3LKO model indicated that METTL3 exhibits pleotropic function to maintain liver homeostasis by deregulating m6A profile and expression of the liver transcriptome. A significant decrease in total Brain and muscle ARNT-like 1 (Bmal1/ARNTL) and Clock mRNAs but an increase in their nuclear levels were observed in M3LKO livers, suggesting impaired nuclear export.
C-X-C motif chemokine 10 (Cxcl10)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line CT26 cell line Mus musculus
Treatment: METTL3 knockout CT26 cells
Control: CT26 cells
 GSE142589
Regulation
logFC: 1.38E+00
p-value: 1.00E-07
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [118]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Cell Process Immunity
In-vitro Model
 CT26 Mouse colon adenocarcinoma Mus musculus CVCL_7254
B16-GM-CSF (B16-GM-CSF cell line was a kind gift from Drs. Glenn Dranoff and Michael Dougan (Dana-Farber/Harvard Cancer Center))
B16-F10 Mouse melanoma Mus musculus CVCL_0159
In-vivo Model 2 × 106 CT26 cells with knockout of Mettl3, Mettl14, Mettl3/Stat1, Mettl3/Irf1, Mettl14/Stat1, or Mettl14/Irf1 and control were suspended in 200 uL of PBS/Matrigel (Corning) (1:1) and then subcutaneously inoculated into flank of each mouse.
Response Summary In colorectal cancer, Mettl3- or Mettl14-deficient tumors increased cytotoxic tumor-infiltrating CD8+ T cells and elevated secretion of IFN-gamma, Cxcl9, and C-X-C motif chemokine 10 (Cxcl10) in tumor microenvironment in vivo. Mechanistically, Mettl3 or Mettl14 loss promoted IFN-gamma-Stat1-Irf1 signaling through stabilizing the Stat1 and Irf1 mRNA via Ythdf2.
C-X-C motif chemokine 9 (Cxcl9)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -2.40E+00
p-value: 4.57E-02
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [118]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Cell Process Immunity
In-vitro Model
 CT26 Mouse colon adenocarcinoma Mus musculus CVCL_7254
B16-GM-CSF (B16-GM-CSF cell line was a kind gift from Drs. Glenn Dranoff and Michael Dougan (Dana-Farber/Harvard Cancer Center))
B16-F10 Mouse melanoma Mus musculus CVCL_0159
In-vivo Model 2 × 106 CT26 cells with knockout of Mettl3, Mettl14, Mettl3/Stat1, Mettl3/Irf1, Mettl14/Stat1, or Mettl14/Irf1 and control were suspended in 200 uL of PBS/Matrigel (Corning) (1:1) and then subcutaneously inoculated into flank of each mouse.
Response Summary In colorectal cancer, Mettl3- or Mettl14-deficient tumors increased cytotoxic tumor-infiltrating CD8+ T cells and elevated secretion of IFN-gamma, C-X-C motif chemokine 9 (Cxcl9), and Cxcl10 in tumor microenvironment in vivo. Mechanistically, Mettl3 or Mettl14 loss promoted IFN-gamma-Stat1-Irf1 signaling through stabilizing the Stat1 and Irf1 mRNA via Ythdf2.
Caspase-3 (CASP3)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: -7.30E-01
p-value: 2.00E-53
More Results Click to View More RNA-seq Results
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Down regulation
Pathway Response Apoptosis hsa04210
PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
Response Summary Down-regulation of METTL3 inhibits the proliferation and mobility of human gastric cancer cells and leads to inactivation of the AKT signaling pathway, suggesting that METTL3 is a potential target for the treatment of human gastric cancer. METTL3 knockdown decreased Bcl2 and increased Bax and active Caspase-3 (CASP3) in gastric cancer cells, which suggested the apoptotic pathway was activated. METTL3 led to inactivation of the AKT signaling pathway in human gastric cancer cells, including decreased phosphorylation levels of AKT and expression of down-stream effectors p70S6K and Cyclin D1.
CD44 antigen (CD44)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 1.08E+00
p-value: 6.88E-51
More Results Click to View More RNA-seq Results
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [122]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
In-vitro Model
 MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
BT-474 Invasive breast carcinoma Homo sapiens CVCL_0179
Response Summary Knockdown of METTL3 downregulated protein levels of SOX2, CD133 and CD44 antigen (CD44) in MCF-7 cells. METTL3 is upregulated in breast cancer, and it promotes the stemness and malignant progression of BCa through mediating m6A modification on SOX2 mRNA.
Circadian locomoter output cycles protein kaput (CLOCK)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 6.28E-01
p-value: 1.95E-19
More Results Click to View More RNA-seq Results
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [156]
Responsed Disease Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation Up regulation
In-vivo Model M3LKO (Mettl3fl/fl; Alb-Cre) mice were generated by crossing Mettl3fl/fl mice (provided by Dr. Jacob Hanna) with albumin-Cre mice (Jackson Laboratories, Bar Harbor, ME), and genotypes were confirmed by tail-DNA PCR using primers as previously described.
Response Summary Liver-specific Mettl3 knockout mice exhibited global decrease in m6A on polyadenylated RNAs and pathologic features associated with nonalcoholic fatty liver disease. Studies in the M3LKO model indicated that METTL3 exhibits pleotropic function to maintain liver homeostasis by deregulating m6A profile and expression of the liver transcriptome. A significant decrease in total Bmal1 and Circadian locomoter output cycles protein kaput (CLOCK) mRNAs but an increase in their nuclear levels were observed in M3LKO livers, suggesting impaired nuclear export.
Cyclin-dependent kinase 1 (CDK1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3-deficient liver
Control: Wild type liver cells
 GSE197800
Regulation
logFC: 2.36E+00
p-value: 3.11E-05
More Results Click to View More RNA-seq Results
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [157]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process Cell cycle
In-vitro Model
 BT-474 Invasive breast carcinoma Homo sapiens CVCL_0179
HCC1806 Breast squamous cell carcinoma Homo sapiens CVCL_1258
MCF-10A Normal Homo sapiens CVCL_0598
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MDA-MB-453 Breast adenocarcinoma Homo sapiens CVCL_0418
ZR-75-1 Invasive breast carcinoma Homo sapiens CVCL_0588
In-vivo Model Twelve female BALB/c nude mice (aged 4 weeks, 18-22g) were randomly divided into 2 groups. Stable circMETTL3-expression SUM1315 cells or control cells (1×106 cells in 0.1 mL PBS) was subcutaneously injected into mammary fat pads of the mice and the growth of tumors was followed up every week. Tumor volume was measured every week using a caliper, calculated as (length × width2)/2. After 4 weeks, mice were sacrificed and checked for final tumor weight.
Response Summary CircMETTL3 promotes breast cancer progression through circMETTL3/miR-31-5p/Cyclin-dependent kinase 1 (CDK1) axis.
Cystine/glutamate transporter (SLC7A11)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MOLM-13 cell line Homo sapiens
Treatment: shMETTL3 MOLM13 cells
Control: MOLM13 cells
 GSE98623
Regulation
logFC: -4.02E+00
p-value: 2.26E-108
More Results Click to View More RNA-seq Results
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [158]
Responsed Disease Hepatoblastoma [ICD-11: 2C12.01]
Target Regulation Up regulation
Pathway Response Ferroptosis hsa04216
Cell Process Ferroptosis
In-vitro Model
 HuH-6 Hepatoblastoma Homo sapiens CVCL_4381
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
Response Summary METTL3-mediated Cystine/glutamate transporter (SLC7A11) m6A modification enhances hepatoblastoma ferroptosis resistance. The METTL3/IGF2BP1/m6A modification promotes SLC7A11 mRNA stability and upregulates its expression by inhibiting the deadenylation process.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [159]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Up regulation
Pathway Response Ferroptosis hsa04216
Cell Process Ferroptosis
In-vitro Model
 SPC-A1 Endocervical adenocarcinoma Homo sapiens CVCL_6955
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
NCI-H322 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1556
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
BEAS-2B Normal Homo sapiens CVCL_0168
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
In-vivo Model For the subcutaneous xenograft model, PC9 cells stably transfected with METTL3 knockdown (shMETTL3) or negative control (shNC) shRNA (5 × 106 cells per mouse, n = 6) were suspended in 200 uL PBS with 50% Matrigel matrix (Corning, USA, 354234) and then injected into one side of the axilla of nude mice.
Response Summary METTL3-mediated m-6A modification could stabilize Cystine/glutamate transporter (SLC7A11) mRNA and promote its translation, thus promoting LUAD cell proliferation and inhibiting cell ferroptosis, a novel form of programmed cell death.
Injury of heart [ICD-11: NB31]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [284]
Responsed Disease Myocardial injury [ICD-11: NB31.Z]
Target Regulation Down regulation
In-vitro Model
 H9c2(2-1) Normal Rattus norvegicus CVCL_0286
Diacylglycerol O-acyltransferase 2 (DGAT2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MOLM-13 cell line Homo sapiens
Treatment: shMETTL3 MOLM13 cells
Control: MOLM13 cells
 GSE98623
Regulation
logFC: -1.53E+00
p-value: 7.36E-18
More Results Click to View More RNA-seq Results
Type 2 diabetes mellitus [ICD-11: 5A11]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [48]
Responsed Disease Type 2 diabetes mellitus [ICD-11: 5A11]
Target Regulation Up regulation
Pathway Response Insulin resistance hsa04931
Cell Process Lipid metabolism
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model Hepatocyte-specific METTL3 knockout mice (TBG-Cre, METTL3 fl/fl) were generated by crossing mice with TBG-Cre Tg mice. METTL3 flox (METTL3 fl/fl) and hepatocyte-specific METTL3 knockout mice (TBG-Cre, METTL3 fl/fl) were used for experiments.
Response Summary Type 2 diabetes (T2D) is characterized by lack of insulin, insulin resistance and high blood sugar. METTL3 silence decreased the m6A methylated and total mRNA level of Fatty acid synthase (Fasn), subsequently inhibited fatty acid metabolism. The expression of Acc1, Acly, Diacylglycerol O-acyltransferase 2 (DGAT2), Ehhadh, Fasn, Foxo, Pgc1a and Sirt1, which are critical to the regulation of fatty acid synthesis and oxidation were dramatically decreased in livers of hepatocyte-specific METTL3 knockout mice.
DNA damage-inducible transcript 4 protein (DDIT4)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 1.24E+00
p-value: 1.11E-27
More Results Click to View More RNA-seq Results
Obesity [ICD-11: 5B81]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [110]
Responsed Disease Obesity [ICD-11: 5B81]
Target Regulation Down regulation
Pathway Response mTOR signaling pathway hsa04150
HIF-1 signaling pathway hsa04066
In-vivo Model The 8-10 weeks old mice were fed either a high fat diet or HF-CDAA , ad lib for 6-12 weeks. Chow diet was used as control for HFD.The mouse liver was perfused with PBS through portal vein, and liver tissue was cut into small pieces by a scissor. The single cell was made using syringe plunger to mull the tissue, and passed through a 40 uM cell strainer.
Response Summary The contribution of METTL3-mediated m6A modification of DNA damage-inducible transcript 4 protein (DDIT4) mRNA to macrophage metabolic reprogramming in non-alcoholic fatty liver disease and obesity. In METTL3-deficient macrophages, there is a significant downregulation of mammalian target of rapamycin (mTOR) and nuclear factor Kappa-B (NF-Kappa-B) pathway activity in response to cellular stress and cytokine stimulation, which can be restored by knockdown of DDIT4.
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [110]
Responsed Disease Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation Down regulation
Pathway Response mTOR signaling pathway hsa04150
HIF-1 signaling pathway hsa04066
In-vivo Model The 8-10 weeks old mice were fed either a high fat diet or HF-CDAA , ad lib for 6-12 weeks. Chow diet was used as control for HFD.The mouse liver was perfused with PBS through portal vein, and liver tissue was cut into small pieces by a scissor. The single cell was made using syringe plunger to mull the tissue, and passed through a 40 uM cell strainer.
Response Summary The contribution of METTL3-mediated m6A modification of DNA damage-inducible transcript 4 protein (DDIT4) mRNA to macrophage metabolic reprogramming in non-alcoholic fatty liver disease and obesity. In METTL3-deficient macrophages, there is a significant downregulation of mammalian target of rapamycin (mTOR) and nuclear factor Kappa-B (NF-Kappa-B) pathway activity in response to cellular stress and cytokine stimulation, which can be restored by knockdown of DDIT4.
Corneal injury [ICD-11: NA06]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [87]
Responsed Disease Corneal injury [ICD-11: NA06.4]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
In-vitro Model
 CGC (Conjunctival goblet cells)
In-vivo Model Mettl3fl/wt mice were generated as previously described. Mettl3fl/wt mice were crossed with K14CreER mice to obtain K14creER/Mettl3fl/fl (cKO) mice. Mettl3 cKO and control mice were injected with tamoxifen and then were subjected to corneal alkali burn treatment. The right eye was the experimental eye, and the left eye was the control eye. The mice were sacrificed at 24 hours, 7 days, 14 days, 35 days, and 56 days after injury. Six mice were taken from each period. Both eyes were removed, frozen in OCT (n = 4), fixed in 4% paraformaldehyde, and embedded in conventional paraffin (n = 2).
Response Summary METTL3 knockout in the limbal stem cells promotes the in vivo cell proliferation and migration, leading to the fast repair of corneal injury. In addition, m6A modification profiling identified stem cell regulatory factors AHNAK and DNA damage-inducible transcript 4 protein (DDIT4) as m6A targets.
DNA repair protein RAD51 homolog 1 (RAD51)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: 2.32E+00
p-value: 1.62E-02
More Results Click to View More RNA-seq Results
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [98]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Doxil Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Homologous recombination hsa03440
Cell Process Homologous recombination repair
In-vitro Model
 MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model Cells were trypsinized and resuspended in DMEM at a consistence of 1 × 107 cells/ml. A total of 1 × 106 cells were injected into flank of mice. 27 days after injection, tumors were removed for paraffin-embedded sections.
Response Summary Knockdown of METTL3 sensitized these breast cancer cells to Adriamycin (ADR; also named as doxorubicin) treatment and increased accumulation of DNA damage. Mechanically, we demonstrated that inhibition of METTL3 impaired HR efficiency and increased ADR-induced DNA damage by regulating m6A modification of EGF/RAD51 axis. METTL3 promoted EGF expression through m6A modification, which further upregulated DNA repair protein RAD51 homolog 1 (RAD51) expression, resulting in enhanced HR activity.
Genotoxicity [ICD-11: XE2PA]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [286]
Responsed Disease Genotoxicity [ICD-11: XE2PA]
Target Regulation Up regulation
In-vitro Model
GC-2spd(ts)
 N.A. Mus musculus CVCL_6633
In-vivo Model Corn oil (control group), 1 mg/kg/day DEHP (low-dose: D1 group), 250 mg/kg/day DEHP (middle-dose: D250 group), and 500 mg/kg/day DEHP (high-dose: D500 group).
DNA replication licensing factor MCM5 (MCM5)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: -6.56E-01
p-value: 6.81E-68
More Results Click to View More RNA-seq Results
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [42]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 GES-1 Normal Homo sapiens CVCL_EQ22
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
MKN74 Gastric tubular adenocarcinoma Homo sapiens CVCL_2791
pGCC (Primary GC cells)
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
In-vivo Model A total of 2 × 106 GC cells were injected into the flank of nude mice in a 1:1 suspension of BD Matrigel (BD Biosciences) in phosphate-buffered saline (PBS) solution.
Response Summary In gastric cancer, several component molecules (e.g., DNA replication licensing factor MCM5 (MCM5), MCM6, etc.) of MYC target genes were mediated by METTL3 via altered m6A modification.
DNA-3-methyladenine glycosylase (ANPG/MPG)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -6.00E-01
p-value: 3.04E-08
More Results Click to View More RNA-seq Results
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [69]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Responsed Drug Temozolomide Approved
 Drug Info 
Target Regulation Down regulation
Pathway Response Nucleotide excision repair hsa03420
Cell Process DNA repair
In-vitro Model
 U251 (Fibroblasts or fibroblast like cells)
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
In-vivo Model Subcutaneously injected shMETTL3 or shNC-expressing U87-MG-TMZ cells into BALB/c NOD mice. After confirmation of GBM implantation, mice were treated with TMZ (66 mg/kg/d, 5 d per week, for 3 cycles).
Response Summary Two critical DNA repair genes (MGMT and DNA-3-methyladenine glycosylase (ANPG/MPG)) were m6A-modified by METTL3, whereas inhibited by METTL3 silencing or DAA-mediated total methylation inhibition, which is crucial for METTL3-improved temozolomide resistance in glioblastoma cells.
Glioblastoma multiforme [ICD-11: XH0MB1]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [287]
Responsed Disease Glioblastoma multiforme [ICD-11: XH0MB1]
Target Regulation Up regulation
In-vitro Model
 GSC11 Glioblastoma Homo sapiens CVCL_DR55
GSC23 Glioblastoma Homo sapiens CVCL_DR59
In-vivo Model To establish the xenograft model of GSCs in mice, GSCs or METTL3 knocking-down GSCs (v/v = 1:1) were subcutaneously inoculated into the right posterior limb of BALB/c nude mice (5 × 106 cells/mice, 4-week-old, female, body weight of 20 g). Tumor volume was measured with calipers every 3 days. The tumor size was calculated using the formula: (a2 × b)/2 (a: width in mm, b: length in mm). After about 27 days, all mice were sacrificed under general anesthesia and the xenografts were harvested for further pathological study.
Dual specificity protein phosphatase 2 (DUSP2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 7.70E-01
p-value: 1.05E-14
More Results Click to View More RNA-seq Results
Emphysema [ICD-11: CA21]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [160]
Responsed Disease Emphysema [ICD-11: CA21]
Target Regulation Down regulation
Pathway Response MAPK signaling pathway hsa04010
Response Summary METTL3-mediated formation of EV miR-93, facilitated by m6A, is implicated in the aberrant cross-talk of epithelium-macrophages, indicating that this process is involved in the smoking-related emphysema. EV miR-93 was used as a novel risk biomarker for CS-induced emphysema. MiR-93 activated the JNK pathway by targeting Dual specificity protein phosphatase 2 (DUSP2), which elevated the levels of matrix metalloproteinase 9 (MMP9) and matrix metalloproteinase 12 (MMP12) and induced elastin degradation, leading to emphysema.
Dual specificity protein phosphatase 5 (DUSP5)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LNCaP cell line Homo sapiens
Treatment: shMETTL3 LNCaP cells
Control: shControl LNCaP cells
 GSE147884
Regulation
logFC: -7.11E-01
p-value: 1.15E-05
More Results Click to View More RNA-seq Results
Gallbladder cancer [ICD-11: 2C13]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [161]
Responsed Disease Gallbladder cancer [ICD-11: 2C13]
Target Regulation Down regulation
Cell Process Cell proliferation
Cell invasion
Cell migration
In-vitro Model
 NOZ Gallbladder carcinoma Homo sapiens CVCL_3079
GBC-SD Human gallbladder Homo sapiens CVCL_6903
Response Summary METTL3-mediated m6A-modification profile in gallbladder-cancer cells and identified Dual specificity protein phosphatase 5 (DUSP5) as the downstream gene of METTL3. METTL3 promoted the degradation of DUSP5 mRNA in a YTHDF2-dependent manner.
E3 ubiquitin-protein ligase Mdm2 (Mdm2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 2.07E+00
p-value: 7.73E-92
More Results Click to View More RNA-seq Results
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [28]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation Up regulation
Pathway Response p53 signaling pathway hsa04115
Cell cycle hsa04110
Cell Process Cell apoptosis
Cells in G2/M phase decreased
In-vitro Model
 THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
MOLT-4 Adult T acute lymphoblastic leukemia Homo sapiens CVCL_0013
Kasumi-1 Myeloid leukemia with maturation Homo sapiens CVCL_0589
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
HL-60 Adult acute myeloid leukemia Homo sapiens CVCL_0002
HEL Erythroleukemia Homo sapiens CVCL_0001
CCRF-CEM C7 T acute lymphoblastic leukemia Homo sapiens CVCL_6825
HEK293T Normal Homo sapiens CVCL_0063
Response Summary METTL3 and METTL14 play an oncogenic role in acute myeloid leukemia(AML) by targeting E3 ubiquitin-protein ligase Mdm2 (Mdm2)/p53 signal pathway. The knockdown of METTL3 and METTL14 in K562 cell line leads to several changes in the expression of p53 signal pathway, including the upregulation of p53, cyclin dependent kinase inhibitor 1A (CDKN1A/p21), and downregulation of mdm2.
Acute kidney failure [ICD-11: GB60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [289]
Responsed Disease Acute kidney failure [ICD-11: GB60]
Target Regulation Down regulation
In-vitro Model
 HK-2 [Human kidney] Normal Homo sapiens CVCL_0302
E3 ubiquitin-protein ligase SMURF1 (SMURF1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: -1.08E+00
p-value: 3.04E-03
More Results Click to View More RNA-seq Results
Inflammatory response [ICD-11: MG46]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [162]
Responsed Disease Inflammatory response [ICD-11: MG46]
Target Regulation Down regulation
Pathway Response MAPK signaling pathway hsa04010
Cell Process RNA stability
In-vitro Model
 MC3T3-E1 Normal Mus musculus CVCL_0409
Response Summary METTL3 knockdown inhibits osteoblast differentiation and Smad-dependent signaling by stabilizing Smad7 and E3 ubiquitin-protein ligase SMURF1 (SMURF1) mRNA transcripts via YTHDF2 involvement and activates the inflammatory response by regulating MAPK signaling in LPS-induced inflammation.
ELAV-like protein 1 (HuR/ELAVL1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Embryonic stem cells Mus musculus
Treatment: METTL3 knockout ESCs
Control: Wild type ESCs
 GSE146466
Regulation
logFC: 6.09E-01
p-value: 1.50E-08
More Results Click to View More RNA-seq Results
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [163]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Down regulation
In-vitro Model
 PC-3 Prostate carcinoma Homo sapiens CVCL_0035
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
DU145 Prostate carcinoma Homo sapiens CVCL_0105
In-vivo Model A total of 1 × 106 PC3 cells or DU145 cells suspended in a mixture of 100 uL PBS and Matrigel were subcutaneously injected into BALB/c nude mice. Tumor weight were measured 2 months after the engraftment. To evaluate the role of METTL3 in tumor metastasis, PC3 cells with or without knockdown of METTL3 were injected into SCID mice through the tail vein (1 × 106 cells per mouse). After eight weeks, mice were sacrificed and their lung tissues were collected for subsequent analyses.
Response Summary m6A modification levels were markedly upregulated in human PCa tissues due to increased expression of METTL3. METTL3 mediates m6A modification of USP4 mRNA at A2696, and m6A reader protein YTHDF2 binds to and induces degradation of USP4 mRNA by recruiting RNA-binding protein HNRNPD to the mRNA. Decrease of USP4 fails to remove the ubiquitin group from ELAVL1 protein, resulting in a reduction of ELAVL1 protein. Lastly, downregulation of ELAV-like protein 1 (HuR/ELAVL1) in turn increases ARHGDIA expression, promoting migration and invasion of PCa cells.
Ephrin type-B receptor 2 (ERK/EPHB2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -6.74E-01
p-value: 5.11E-30
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [72]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
Pathway Response MAPK signaling pathway hsa04010
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
KM12 Colon carcinoma Homo sapiens CVCL_1331
Response Summary METTL3 played a tumor-suppressive role in Colorectal cancer cell proliferation, migration and invasion through p38/Ephrin type-B receptor 2 (ERK/EPHB2) pathways, which indicated that METTL3 was a novel marker for CRC carcinogenesis, progression and survival.
Muscular dystrophies [ICD-11: 8C70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [67]
Responsed Disease Muscular dystrophies [ICD-11: 8C70]
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
C2C12 Normal Mus musculus CVCL_0188
In-vivo Model For mouse muscle injury and regeneration experiment, tibialis anterior (TA) muscles of 6-week-old male mice were injected with 25 uL of 10 uM cardiotoxin (CTX, Merck Millipore, 217503), 0.9% normal saline (Saline) were used as control. The regenerated muscles were collected at day 1, 3, 5, and 10 post-injection. TA muscles were isolated for Hematoxylin and eosin staining or frozen in liquid nitrogen for RNA and protein extraction.
Response Summary m6A writers METTL3/METTL14 and the m6A reader YTHDF1 orchestrate MNK2 expression posttranscriptionally and thus control Ephrin type-B receptor 2 (ERK/EPHB2) signaling, which is required for the maintenance of muscle myogenesis and contributes to regeneration.
Epidermal growth factor receptor (EGFR)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: -6.74E-01
p-value: 1.53E-03
More Results Click to View More RNA-seq Results
Melanoma [ICD-11: 2C30]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [164]
Responsed Disease Melanoma [ICD-11: 2C30]
Responsed Drug PLX4032 Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response EGFR tyrosine kinase inhibitor resistance hsa01521
Cell Process Cell apoptosis
In-vitro Model
 A375-R Amelanotic melanoma Homo sapiens CVCL_6234
Response Summary METTL3 increased the m6A modification of Epidermal growth factor receptor (EGFR) mRNA in A375R cells, which promoted its translation efficiency. Inhibiting METTL3 function to restore PLX4032 sensitivity in patients with melanoma.
Liver cancer [ICD-11: 2C12]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [290]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Lenvatinib Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model Tumor cells derived xenograft (MHCC97H cells) from subcutaneous mouse model were cut into 1 mm3 pieces and implanted into the left lobe of the livers of six-week-old male NCG mice. Once the tumors were established and reached approximately 100 mm3, mice were randomly assigned to daily treatment with vehicle, lenvatinib (4 mg/kg, oral gavage), STM2457 (50 mg/kg, intraperitoneal injection) or a drug combination in which each compound was administered at the same dose and duration as the single agent.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [290]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug STM2457 Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [291]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
F-box/WD repeat-containing protein 7 (FBXW7)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MDA-MB-231 Homo sapiens
Treatment: METTL3 knockdown MDA-MB-231 cells
Control: MDA-MB-231 cells
 GSE70061
Regulation
logFC: 7.60E-01
p-value: 3.50E-02
More Results Click to View More RNA-seq Results
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [165]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Down regulation
Cell Process RNA stability
Cell apoptosis
In-vitro Model
 HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model The mice were randomly divided into groups before subcutaneous injection with cells (107) suspended in 200 uL of phosphate-buffered saline. Tumors were measured on day 7 and then once every 7 days until 28 days after injection.
Response Summary METTL3 positively regulates F-box/WD repeat-containing protein 7 (FBXW7) expression and confirm the tumor-suppressive role of m6A-modified FBXW7, thus providing insight into its epigenetic regulatory mechanisms in lung adenocarcinoma initiation and development.
Forkhead box protein C2 (FOXC2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Mesenchymal stem cell line Mus musculus
Treatment: Mettl3 knockout mesenchymal stem cells
Control: Wild type mesenchymal stem cells
 GSE114933
Regulation
logFC: -2.30E+00
p-value: 6.85E-05
More Results Click to View More RNA-seq Results
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [166]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model
 hFOB 1.19 Normal Homo sapiens CVCL_3708
MG-63 Osteosarcoma Homo sapiens CVCL_0426
U2OS Osteosarcoma Homo sapiens CVCL_0042
Response Summary METTL3-mediated circNRIP1 exhibits oncogenic roles in osteosarcoma by regulating Forkhead box protein C2 (FOXC2) via sponging miR-199a, which provides new ideas for the treatment of osteosarcoma.
Forkhead box protein O1 (FOXO1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: 9.70E-01
p-value: 7.07E-55
More Results Click to View More RNA-seq Results
Type 2 diabetes mellitus [ICD-11: 5A11]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [48]
Responsed Disease Type 2 diabetes mellitus [ICD-11: 5A11]
Target Regulation Up regulation
Pathway Response Insulin resistance hsa04931
Cell Process Lipid metabolism
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model Hepatocyte-specific METTL3 knockout mice (TBG-Cre, METTL3 fl/fl) were generated by crossing mice with TBG-Cre Tg mice. METTL3 flox (METTL3 fl/fl) and hepatocyte-specific METTL3 knockout mice (TBG-Cre, METTL3 fl/fl) were used for experiments.
Response Summary Type 2 diabetes (T2D) is characterized by lack of insulin, insulin resistance and high blood sugar. METTL3 silence decreased the m6A methylated and total mRNA level of Fatty acid synthase (Fasn), subsequently inhibited fatty acid metabolism. The expression of Acc1, Acly, Dgat2, Ehhadh, Fasn, Forkhead box protein O1 (FOXO1), Pgc1a and Sirt1, which are critical to the regulation of fatty acid synthesis and oxidation were dramatically decreased in livers of hepatocyte-specific METTL3 knockout mice.
Female infertility [ICD-11: GA31]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [293]
Responsed Disease Female infertility [ICD-11: GA31]
Target Regulation Down regulation
In-vitro Model
 T HESCs Normal Homo sapiens CVCL_C464
HTR-8/SVneo Normal Homo sapiens CVCL_7162
HTR-8 Normal Homo sapiens CVCL_D728
In-vivo Model Five female mice were subjected to a normal pregnancy assay. Uterine tissues of 14 female donor mice were cut up and injected into the abdominal cavity of 28 female recipient mice. After 21 d, 10 male C57 mice were mated with the recipient mice, and the next day, when vaginal plugs were observed, was regarded as day 1. Eight recipient mice were euthanized by cervical dislocation after deep pentobarbital anesthesia on day 8, and the number of blastocysts in the uterus was counted. At the night of day 3, 10 μL of STM2457, a METTL3 inhibitor (Sellcek, S9870, 10 μM) and 10 μL dimethyl sulfoxide (DMSO) were individually injected into the uterine horns of 20 recipient mice. The mice were euthanized on day 8, and the number of blastocysts in the uterus was counted. The uterine tissues were collected and fixed in 4% (w/v) paraformaldehyde for histological and IHC analyses.
Forkhead box protein O3 (FOXO3)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: 8.00E-01
p-value: 1.28E-68
More Results Click to View More RNA-seq Results
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [167]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Sorafenib Approved
 Drug Info 
Target Regulation Down regulation
Pathway Response FoxO signaling pathway hsa04068
Cell Process Cell Transport
Cell catabolism
Cell autophagy
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
Hepa 1-6 Hepatocellular carcinoma of the mouse Mus musculus CVCL_0327
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HUVEC-C Normal Homo sapiens CVCL_2959
WRL 68 Endocervical adenocarcinoma Homo sapiens CVCL_0581
In-vivo Model For the drug-resistant subcutaneous tumor models, drug administration was adopted when the tumors reached about 50 mm3 in size, at which point mice were randomized for treatment with DMSO(intraperitoneally) or sorafenib (50 mg/kg/every 2 days, intraperitoneally). For the patient-derived tumor xenograft model, drug administration began 4 weeks after tumors reached about 100 mm3 in size with sorafenib (50 mg/kg/every 3 days, intraperitoneally) or siCtrl/siMETTL3 intratumor injection.
Response Summary METTL3 and Forkhead box protein O3 (FOXO3) levels are tightly correlated in hepatocellular carcinoma patients. In mouse xenograft models, METTL3 depletion significantly enhances sorafenib resistance of HCC by abolishing the identified METTL3-mediated FOXO3 mRNA stabilization, and overexpression of FOXO3 restores m6 A-dependent sorafenib sensitivity.
G1/S-specific cyclin-D1 (CCND1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LNCaP cell line Homo sapiens
Treatment: shMETTL3 LNCaP cells
Control: shControl LNCaP cells
 GSE147884
Regulation
logFC: -6.51E-01
p-value: 1.46E-104
More Results Click to View More RNA-seq Results
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
Response Summary Down-regulation of METTL3 inhibits the proliferation and mobility of human gastric cancer cells and leads to inactivation of the AKT signaling pathway, suggesting that METTL3 is a potential target for the treatment of human gastric cancer. METTL3 knockdown decreased Bcl2 and increased Bax and active Caspase-3 in gastric cancer cells, which suggested the apoptotic pathway was activated. METTL3 led to inactivation of the AKT signaling pathway in human gastric cancer cells, including decreased phosphorylation levels of AKT and expression of down-stream effectors p70S6K and G1/S-specific cyclin-D1 (CCND1).
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [168]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process Cell cycle
Cell apoptosis
In-vitro Model
 OVCAR-3 Ovarian serous adenocarcinoma Homo sapiens CVCL_0465
SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
Response Summary METTL3 knockdown downregulated the phosphorylation levels of AKT and the expression of the downstream effector G1/S-specific cyclin-D1 (CCND1) in ovarian cancer.
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [169]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Down regulation
In-vitro Model
 SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
In-vivo Model Mice were divided into two groups (n = 4/group) randomly. 3×106 cells suspended in 200 uL PBS were administered via subcutaneous injection over the right flank region of nude mice. After the development of palpable tumors (average volume, 50 mm3), intratumoral injection of synthetic miR-193b, or negative control complexed with siPORT Amine transfection reagent (Ambion, USA) was given 6 times at a 4-day interval.
Response Summary METTL3 modulates miR-193b mature process in an m6A-dependent manner. Reintroduction of miR-193b profoundly inhibits tumorigenesis of cervical cancer cells both in vivo and in vitro through G1/S-specific cyclin-D1 (CCND1) targeting.
Obesity [ICD-11: 5B81]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [170]
Responsed Disease Obesity [ICD-11: 5B81]
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process Mitotic clonal
Prolonged G1/S transition
In-vitro Model
 3T3-L1 Normal Mus musculus CVCL_0123
Response Summary Obesity is becoming a global problem. ZFP217 knockdown-induced adipogenesis inhibition was caused by G1/S-specific cyclin-D1 (CCND1), which was mediated by METTL3 and YTHDF2 in an m6A-dependent manner.
Glucose transporter type 1 (GLUT1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 8.54E-01
p-value: 1.08E-85
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [54]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Glycolysis / Gluconeogenesis hsa00010
Cell Process Glucose metabolism
Response Summary METTL3 stabilizes HK2 and Glucose transporter type 1 (SLC2A1) (GLUT1) expression in colorectal cancer through an m6A-IGF2BP2/3- dependent mechanism.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [294]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
PLC/PRF/5 Adult hepatocellular carcinoma Homo sapiens CVCL_0485
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Heat shock 70 kDa protein 1A (HSPA1A)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: -1.11E+00
p-value: 1.96E-02
More Results Click to View More RNA-seq Results
Pre-eclampsia [ICD-11: JA24]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [172]
Responsed Disease Pre-eclampsia [ICD-11: JA24]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
mTOR signaling pathway hsa04150
Response Summary Findings show that METTL3 and METTL14 were up-regulated in preeclampsia(PE). Heat shock 70 kDa protein 1A (HSPA1A) is involved in the pathophysiology of PE as its mRNA and protein expression is regulated by m6A modification.
Hepatocyte growth factor receptor (c-Met/MET)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 6.42E-01
p-value: 3.45E-17
More Results Click to View More RNA-seq Results
Lung cancer [ICD-11: 2C25]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [173]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Crizotinib Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response EGFR tyrosine kinase inhibitor resistance hsa01521
In-vitro Model
 HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
NCI-H661 Lung large cell carcinoma Homo sapiens CVCL_1577
NCI-H596 Lung adenosquamous carcinoma Homo sapiens CVCL_1571
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
NCI-H358 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1559
NCI-H292 Lung mucoepidermoid carcinoma Homo sapiens CVCL_0455
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H1650 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1483
NCI-H1395 Lung adenocarcinoma Homo sapiens CVCL_1467
EBC-1 Lung squamous cell carcinoma Homo sapiens CVCL_2891
Calu-3 Lung adenocarcinoma Homo sapiens CVCL_0609
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
In-vivo Model HCC827 (3×106) cells suspended in 100 uL of PBS were injected into the left inguen of female Balb/c nude mice (body weight 18-20 g; age 6 weeks; Beijing Huafukang Bioscience Co., Inc.). When the tumor volumes reached 50-100 mm3 on the 10th posttransplantation day, the mice were randomized into four groups (10 mice per group) and were intragastrically administered vehicle (normal saline), crizotinib (25 mg/kg body weight), chidamide (5 mg/kg), or the combination of the two drugs daily for 21 days. The tumor volumes and body weights of the mice were measured every 3 days.
Response Summary Chidamide could decrease Hepatocyte growth factor receptor (c-Met/MET) expression by inhibiting mRNA N6-methyladenosine (m6A) modification through the downregulation of METTL3 and WTAP expression, subsequently increasing the crizotinib sensitivity of NSCLC cells in a c-MET-/HGF-dependent manner.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [174]
Responsed Disease Lung cancer [ICD-11: 2C25]
Responsed Drug Gefitinib Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
In-vitro Model
 PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
NCI-H3255 Lung adenocarcinoma Homo sapiens CVCL_6831
Response Summary METTL3 combines with Hepatocyte growth factor receptor (c-Met/MET) and causes the PI3K/AKT signalling pathway to be manipulated, which affects the sensitivity of lung cancer cells to gefitinib. METTL3 knockdown promotes apoptosis and inhibits proliferation of lung cancer cells.
Melanoma of uvea [ICD-11: 2D0Y]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [175]
Responsed Disease Melanoma of uvea [ICD-11: 2D0Y]
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process Cell proliferation
Cell migration
Cell invasion
Arrest cell cycle at G1 phase
In-vitro Model
 M17 (Neuroblastoma cells)
M21 Melanoma Homo sapiens CVCL_D031
M23 Cutaneous melanoma Homo sapiens CVCL_RT32
SP-6.5 Uveal melanoma Homo sapiens CVCL_7997
Response Summary METTL3-mediated m6A RNA methylation modulates uveal melanoma cell proliferation, migration, and invasion by targeting Hepatocyte growth factor receptor (c-Met/MET). Cycloleucine (Cyc) was used to block m6 A methylation in UM cells.
High mobility group protein HMG-I/HMG-Y (HMGA1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -8.70E-01
p-value: 2.47E-77
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [176]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response mRNA surveillance pathway hsa03015
Cell Process mRNA stability
Epithelial-mesenchymal transition
In-vitro Model
 DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
FHC Normal Homo sapiens CVCL_3688
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HEK293T Normal Homo sapiens CVCL_0063
HT29 Colon cancer Mus musculus CVCL_A8EZ
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model Groups of HCT116-Luc-shCtrl, HCT116-Luc-shLINC00460, and HCT116-Luc-shLINC00460 + HMGA1 cells (5 × 106) were injected subcutaneously into the flanks of mice correspondingly.
Response Summary LINC00460 is a novel oncogene of colorectal cancer through interacting with IGF2BP2 and DHX9 and bind to the m6A modified High mobility group protein HMG-I/HMG-Y (HMGA1) mRNA to enhance the HMGA1 mRNA stability. The N6-methyladenosine (m6A) modification of HMGA1 mRNA by METTL3 enhanced HMGA1 expression in CRC.
Histone deacetylase 5 (HDAC5)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -9.48E-01
p-value: 2.87E-28
More Results Click to View More RNA-seq Results
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [177]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Target Regulation Up regulation
In-vitro Model
 U2OS Osteosarcoma Homo sapiens CVCL_0042
SaOS-2 Osteosarcoma Homo sapiens CVCL_0548
HOS Osteosarcoma Homo sapiens CVCL_0312
hFOB 1.19 Normal Homo sapiens CVCL_3708
In-vivo Model U2OS cells with stable METTL3 expression were screened using puromycin for subsequent experiments. U2OS cells (1 × 106) were injected subcutaneously to the right side of each mouse (the mice were numbered according to their weight, and the experimenters randomly divided the nude mice into 12 groups by the random number method, with 12 mice in each group). The status of mice was detected every 2 days. Tumor growth and volume were measured once a week.Tumor volume was measured: Volume = Width2 × Length/2. On the 35th day after the operation, nude mice were euthanized by intraperitoneal injection of ≥100 mg/kg pentobarbital sodium. Tumor resection was performed and tumor weight was recorded. Weight loss >10% of the body weight or the maximum diameter of the tumor >1.5 cm was the humane end point.
Response Summary Higher METTL3 expression indicated poorer prognosis. METTL3 upregulated Histone deacetylase 5 (HDAC5) expression in osteosarcoma cells by increasing the m6A level.
Histone-lysine N-methyltransferase SETD7 (SETD7)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 7.00E-01
p-value: 6.39E-40
More Results Click to View More RNA-seq Results
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [178]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Down regulation
Cell Process Cancer proliferation
Cancer metastasis
In-vitro Model
 SV-HUC-1 Normal Homo sapiens CVCL_3798
T24 Bladder carcinoma Homo sapiens CVCL_0554
UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
In-vivo Model For the subcutaneous implantation model, UM-UC-3 cells (2 × 106 cells per mouse) stably METTL3 knocked down (shMETTL3-1, shMETTL3-2) were injected into the flanks of mice.
Response Summary METTL3/YTHDF2/Histone-lysine N-methyltransferase SETD7 (SETD7)/KLF4 m6 A axis provide the insight into the underlying mechanism of carcinogenesis and highlight potential therapeutic targets for bladder cancer.
Homeobox protein NANOG (NANOG)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Soma Mus musculus
Treatment: Mettl3-/- soma
Control: Wild type soma
 GSE171199
Regulation
logFC: 2.74E+00
p-value: 4.57E-02
More Results Click to View More RNA-seq Results
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [179]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Cell Process Cell migration
Cell invasion
Epithelial-mesenchymal transition initiation
Response Summary In breast cancer, ZNF217 could upregulate Homeobox protein NANOG (NANOG) by reducing N6-methyladenosine levels via methyltransferase-like 13 (METTL3).
Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 1.13E+00
p-value: 4.17E-08
More Results Click to View More RNA-seq Results
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [180]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
Pathway Response HIF-1 signaling pathway hsa04066
Central carbon metabolism in cancer hsa05230
Cell Process Glycolysis
Glutaminolysis
In-vitro Model
 BEL-7402 Endocervical adenocarcinoma Homo sapiens CVCL_5492
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
MHCC97 Adult hepatocellular carcinoma Homo sapiens CVCL_4971
SMMC-7721 Endocervical adenocarcinoma Homo sapiens CVCL_0534
Response Summary HBXIP drives metabolic reprogramming in hepatocellular carcinoma cells via METTL3-mediated m6A modification of Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A). Highly expressed HBXIP and METTL3 are associated with dismal oncologic outcomes of patients with hepatocellular carcinoma. The positive relation between HBXIP and METTL3 can activate reprogramming of HCC cell metabolism by inducing m6A modification of HIF-1-alpha, which is unraveled to enhance aggressive biological behaviors of HCC cells.
Injury of other or unspecified intrathoracic organs [ICD-11: NB32]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [300]
Responsed Disease Injury of other or unspecified intrathoracic organs [ICD-11: NB32.3]
Target Regulation Up regulation
Inhibitor of nuclear factor kappa-B kinase subunit beta (IKBKB)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: 3.01E+00
p-value: 5.15E-06
More Results Click to View More RNA-seq Results
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Cell Process Glucose metabolism
Response Summary AF4/FMR2 family member 4 (AFF4), two key regulators of NF-Kappa-B pathway (Inhibitor of nuclear factor kappa-B kinase subunit beta (IKBKB) and RELA) and MYC were further identified as direct targets of METTL3-mediated m6A modification.overexpression of METTL3 significantly promoted Bladder cancer cell growth and invasion.
Insulin-like growth factor 1 receptor (IGF1R)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 6.69E-01
p-value: 4.12E-12
More Results Click to View More RNA-seq Results
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [147]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
Cell Process RNA stability
In-vitro Model
 PC-3 Prostate carcinoma Homo sapiens CVCL_0035
LNCaP C4-2B Prostate carcinoma Homo sapiens CVCL_4784
In-vivo Model At 1 week post-injection with PC-3 cells, mice were randomly assigned to three groups (n = 8 per group): the ASO-NC group (injection with ASO negative control targeting unknown sequence, 5 nmol in 100 uL PBS for each mouse), the ASO-L group (injection with low-dose ASO targeting PCAT6, 5 nmol in 100 uL PBS for each mouse), and the ASO-H group (injection with high-dose ASO targeting PCAT6, 10 nmol in 100 uL PBS for each mouse).
Response Summary METTL3-mediated m6A modification contributed to PCAT6 upregulation in an IGF2BP2-dependent manner. Furthermore, PCAT6 upregulated Insulin-like growth factor 1 receptor (IGF1R) expression by enhancing IGF1R mRNA stability through the PCAT6/IGF2BP2/IGF1R RNA-protein three-dimensional complex. The m6 A-induced PCAT6/IGF2BP2/IGF1R axis promotes PCa bone metastasis and tumor growth, suggesting that PCAT6 serves as a promising prognostic marker and therapeutic target against bone-metastatic PCa.
Integrin alpha-6 (ITGA6)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MOLM-13 cell line Homo sapiens
Treatment: shMETTL3 MOLM13 cells
Control: MOLM13 cells
 GSE98623
Regulation
logFC: -2.38E+00
p-value: 1.75E-72
More Results Click to View More RNA-seq Results
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [181]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Pathway Response Cell adhesion molecules hsa04514
Cell Process Cell adhesion
Cell migration
Cell invasion
In-vitro Model
 5637 Bladder carcinoma Homo sapiens CVCL_0126
HEK293T Normal Homo sapiens CVCL_0063
J82 Bladder carcinoma Homo sapiens CVCL_0359
SV-HUC-1 Normal Homo sapiens CVCL_3798
T24 Bladder carcinoma Homo sapiens CVCL_0554
UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
In-vivo Model For the subcutaneous implantation model, 1 × 107 cells were subcutaneously implanted into 5-week-old BALB/cJNju-Foxn1nu/Nju nude mice.
Response Summary m6A writer METTL3 and eraser ALKBH5 altered cell adhesion by regulating Integrin alpha-6 (ITGA6) expression in bladder cancer cells. m6A is highly enriched within the ITGA6 transcripts, and increased m6A methylations of the ITGA6 mRNA 3'UTR promotes the translation of ITGA6 mRNA via binding of the m6A readers YTHDF1 and YTHDF3. Inhibition of ITGA6 results in decreased growth and progression of bladder cancer cells in vitro and in vivo.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [301]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
In-vivo Model Or tumor growth assessment, 104 Huh7/CSC infected with different lentiviral vectors were mixed with Matrigel at a 1:1 ratio, and the mixture was injected subcutaneously into nude mice (n = 6). For mouse survival assessment, a mixture of 105 infected Huh7/CSC cells with Matrigel was administered to the liver of nude mice.
Integrin beta-1 (ITGB1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -2.05E+00
p-value: 1.83E-215
More Results Click to View More RNA-seq Results
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [182]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
Pathway Response Cell adhesion molecules hsa04514
Cell Process Cell adhesion
In-vitro Model
 LNCaP Prostate carcinoma Homo sapiens CVCL_0395
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
In-vivo Model All the mice were randomly divided into five groups of four mice each, including PC3-shNC, PC3-shMETTL3-1/2, LNCaP-vector and LNCaP-METTL3 group.
Response Summary METTL3 regulates the expression of Integrin beta-1 (ITGB1) through m6A-HuR-dependent mechanism, which affects the binding of ITGB1 to Collagen I and tumor cell motility, so as to promote the bone metastasis of prostate cancer.
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [303]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
In-vitro Model
 HPDE Normal Homo sapiens CVCL_4376
Capan-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0237
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
HPC-Y5 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_6918
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
In-vivo Model Total of 27 BALB/c nude mice were chosen and divided into three groups (n = 6): Control group (injected with PANC-1 cells), si-NC group, and si-NNT-AS1 group. For the si-NC and si-NNT-AS1 groups, PANC-1 cells transfected with si-NC and si-NNT-AS1, respectively, were injected into mice. The back of each mouse was injected with above cell suspension (2 × 104 cells in 0.2 mL). The average volume of the tumor was measured three times in each 7 days. The mice were euthanized on the 28th day, and tumor tissues were collected for related analysis. Immunohistochemistry (IHC) and terminal deoxynucleotidyl transferase-mediated dUTP nick-end labeling (TUNEL) staining were performed. The remaining nude mice were divided into three groups (n = 3): Control, si-NC, and si-NNT-AS1 groups. Cell suspension containing 2 × 104 cells was then injected into the back of each mouse. After 7 days, mice were administered a 50-μL suspension containing 5 × 106 CD8 T cells via peritumoral injection every 3 days for a total of five injections. After the last injection, mice were euthanized on the 28th day, and sera were collected. All animal studies were approved by the Ethics Committee of Xiangya Hospital, Central South University.
Intercellular adhesion molecule 1 (ICAM1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 9.55E-01
p-value: 2.64E-22
More Results Click to View More RNA-seq Results
Cataract [ICD-11: 9B10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [183]
Responsed Disease Diabetic cataract [ICD-11: 9B10.21]
Target Regulation Up regulation
Cell Process RNA stability
Cell apoptosis
In-vitro Model
 B-3 Normal Homo sapiens CVCL_6367
Response Summary METTL3 modulates the proliferation and apoptosis of lens epithelial cells in diabetic cataract. METTL3 targets the 3' UTR of Intercellular adhesion molecule 1 (ICAM1) to stabilize mRNA stability.
Interferon gamma (IFN-gamma)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Th1 cell line Mus musculus
Treatment: METTL3 knockout splenic Th1 cells
Control: Wild type splenic Th1 cells
 GSE129648
Regulation
logFC: -1.72E+00
p-value: 6.66E-03
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [118]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Cell Process Immunity
In-vitro Model
 CT26 Mouse colon adenocarcinoma Mus musculus CVCL_7254
B16-GM-CSF (B16-GM-CSF cell line was a kind gift from Drs. Glenn Dranoff and Michael Dougan (Dana-Farber/Harvard Cancer Center))
B16-F10 Mouse melanoma Mus musculus CVCL_0159
In-vivo Model 2 × 106 CT26 cells with knockout of Mettl3, Mettl14, Mettl3/Stat1, Mettl3/Irf1, Mettl14/Stat1, or Mettl14/Irf1 and control were suspended in 200 uL of PBS/Matrigel (Corning) (1:1) and then subcutaneously inoculated into flank of each mouse.
Response Summary In colorectal cancer, Mettl3- or Mettl14-deficient tumors increased cytotoxic tumor-infiltrating CD8+ T cells and elevated secretion of Interferon gamma (IFN-gamma), Cxcl9, and Cxcl10 in tumor microenvironment in vivo. Mechanistically, Mettl3 or Mettl14 loss promoted IFN-gamma-Stat1-Irf1 signaling through stabilizing the Stat1 and Irf1 mRNA via Ythdf2.
Interferon regulatory factor 1 (Irf1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: -9.51E-01
p-value: 1.06E-05
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [118]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Cell Process Immunity
In-vitro Model
 CT26 Mouse colon adenocarcinoma Mus musculus CVCL_7254
B16-GM-CSF (B16-GM-CSF cell line was a kind gift from Drs. Glenn Dranoff and Michael Dougan (Dana-Farber/Harvard Cancer Center))
B16-F10 Mouse melanoma Mus musculus CVCL_0159
In-vivo Model 2 × 106 CT26 cells with knockout of Mettl3, Mettl14, Mettl3/Stat1, Mettl3/Irf1, Mettl14/Stat1, or Mettl14/Irf1 and control were suspended in 200 uL of PBS/Matrigel (Corning) (1:1) and then subcutaneously inoculated into flank of each mouse.
Response Summary In colorectal cancer, Mettl3- or Mettl14-deficient tumors increased cytotoxic tumor-infiltrating CD8+ T cells and elevated secretion of IFN-gamma, Cxcl9, and Cxcl10 in tumor microenvironment in vivo. Mechanistically, Mettl3 or Mettl14 loss promoted IFN-gamma-Stat1-Irf1 signaling through stabilizing the Stat1 and Interferon regulatory factor 1 (Irf1) mRNA via Ythdf2.
Interferon-induced 54 kDa protein (IFIT2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LNCaP cell line Homo sapiens
Treatment: shMETTL3 LNCaP cells
Control: shControl LNCaP cells
 GSE147884
Regulation
logFC: 9.21E-01
p-value: 1.94E-18
More Results Click to View More RNA-seq Results
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [184]
Responsed Disease Intrahepatic cholangiocarcinoma [ICD-11: 2C12.10]
Target Regulation Down regulation
In-vitro Model
 HuCC-T1 Intrahepatic cholangiocarcinoma Homo sapiens CVCL_0324
HCCC-9810 Intrahepatic cholangiocarcinoma Homo sapiens CVCL_6908
In-vivo Model 4-week-old female BALB/c nude mice were used for HuCC-T1 tumor xenograft models and 4-week-old female B-NDG mice (Biocytogen, Beijing, China) were used for HCCC-9810 tumor xenograft models. 1 × 107 HuCC-T1 or HCCC-9810 cells were resuspended in 100 ul PBS with Matrigel (1:1), and injected into the right flank of mice (n = 6/group).
Response Summary METTL3 was upregulated and predicted poor prognosis of patients with intrahepatic cholangiocarcinoma(ICC). H3K4me3 activation-driven METTL3 transcription promotes ICC progression by YTHDF2-mediated Interferon-induced 54 kDa protein (IFIT2) mRNA degradation.
Interferon-inducible protein 4 (ADAR1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line E14.5 LSK cell line Mus musculus
Treatment: METTL3 knockout E14.5 LSK cells
Control: Wild type E14.5 LSK cells
 GSE148882
Regulation
logFC: 6.03E-01
p-value: 6.54E-18
More Results Click to View More RNA-seq Results
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [185]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Target Regulation Up regulation
Pathway Response mRNA surveillance pathway hsa03015
RNA degradation hsa03018
Cell Process RNA stability
In-vitro Model
 U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
U-118MG Astrocytoma Homo sapiens CVCL_0633
T98G Glioblastoma Homo sapiens CVCL_0556
A-172 Glioblastoma Homo sapiens CVCL_0131
In-vivo Model 2 × 106 U87MG cells already expressing shscr or shADAR1 were subcutaneously injected in the flank of 6-week-old nude mice (nu/nu, Charles River, Wilmington, MA, USA).
Response Summary METTL3, upregulated in glioblastoma, methylates Interferon-inducible protein 4 (ADAR1) mRNA and increases its protein level leading to a pro-tumorigenic mechanism connecting METTL3, YTHDF1, and ADAR1.
Interleukin enhancer-binding factor 3 (ILF3)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: 7.68E-01
p-value: 3.12E-02
More Results Click to View More RNA-seq Results
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [186]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
In-vitro Model
 Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model Approximately 5 × 106 control and ILF3-AS1 silencing Huh7 cells were subcutaneously implanted into the right flank of nude mice.Xenograft size was measured every 7 days and calculated using the equation V(mm3)=(length×width2)/2. 35 days later, the mice were sacrificed, and the tumor tissues were isolated and weighed.
Response Summary ILF3-AS1 expression was significantly elevated in HCC tissues,mechanistically, ILF3-AS1 associated with Interleukin enhancer-binding factor 3 (ILF3) mRNA and inhibited its degradation. ILF3-AS1 increased ILF3 m6A level via recruiting N6-methyladenosine (m6A) RNA methyltransferase METTL3. Moreover, IFL3-AS1 enhanced the interaction between ILF3 mRNA and m6A reader IGF2BP1.
Interleukin-6 (IL-6)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: -1.10E+00
p-value: 7.68E-04
More Results Click to View More RNA-seq Results
Rheumatoid arthritis [ICD-11: FA20]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [187]
Responsed Disease Rheumatoid arthritis [ICD-11: FA20]
Target Regulation Up regulation
Cell Process Inflammatory response
In-vitro Model
 FLS (Rat fibroblast synovial cell line)
In-vivo Model To establish the adjuvant-induced arthritis (AIA) model, the rats were given complete Freund's adjuvant (CFA; Chondrex, Inc.) on the left paw of 0.1 ml per 100 g of body weight. Additionally, the rats were injected with normal saline to create the negative control (NC) group.
Response Summary METTL3 knockdown suppressed Interleukin-6 (IL-6), matrix metalloproteinase (MMP)-3, and MMP-9 levels in human RA-FLSs and rat AIA-FLSs.
Intersectin-2 (ITSN2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Pancreatic islets Mus musculus
Treatment: Mettl3 knockout mice
Control: Mettl3 flox/flox mice
 GSE155612
Regulation
logFC: 8.48E-01
p-value: 1.42E-04
More Results Click to View More RNA-seq Results
Ovarian dysfunction [ICD-11: 5A80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [188]
Responsed Disease Ovarian dysfunction [ICD-11: 5A80]
Target Regulation Up regulation
In-vivo Model All mice described above were maintained on the C57BL/6 J background. Mice lacking Mettl3 in oocytes (referred to as Mettl3Gdf9 cKO) were generated by crossing Mettl3flox/flox mice with Gdf9-Cre mice. The Mettl3flox/flox female mice were used as the control group (referred to as WT). For the fertility test, six pairs of 6 weeks Mettl3flox/flox and Mettl3Gdf9 cKO female mice were randomly selected and continually mated to Mettl3flox/flox male mice which have been confirmed fertility for 5 months. The number of pups and litter size from each female was recorded.
Response Summary METTL3 targets Intersectin-2 (ITSN2) for m6A modification and then enhances its stability to influence the oocytes meiosis. mRNA m6A modification in follicle development and coordination of RNA stabilization during oocyte growth.
Female infertility [ICD-11: GA31]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [188]
Responsed Disease Female infertility [ICD-11: GA31]
Target Regulation Up regulation
In-vivo Model All mice described above were maintained on the C57BL/6 J background. Mice lacking Mettl3 in oocytes (referred to as Mettl3Gdf9 cKO) were generated by crossing Mettl3flox/flox mice with Gdf9-Cre mice. The Mettl3flox/flox female mice were used as the control group (referred to as WT). For the fertility test, six pairs of 6 weeks Mettl3flox/flox and Mettl3Gdf9 cKO female mice were randomly selected and continually mated to Mettl3flox/flox male mice which have been confirmed fertility for 5 months. The number of pups and litter size from each female was recorded.
Response Summary METTL3 targets Intersectin-2 (ITSN2) for m6A modification and then enhances its stability to influence the oocytes meiosis. mRNA m6A modification in follicle development and coordination of RNA stabilization during oocyte growth.
Kinesin-like protein KIF3C (KIF3C)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 5.93E-01
p-value: 1.16E-06
More Results Click to View More RNA-seq Results
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [189]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
Cell Process Cell migration
Cell invasion
In-vitro Model
 VCaP Prostate carcinoma Homo sapiens CVCL_2235
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
DU145 Prostate carcinoma Homo sapiens CVCL_0105
LNCaP C4-2B Prostate carcinoma Homo sapiens CVCL_4784
22Rv1 Prostate carcinoma Homo sapiens CVCL_1045
In-vivo Model For the proliferation assays, C4-2B cells of KIF3C knockdown, negative control (1×106/200uL) were subcutaneously injected into BALB/c nude mice. The tumors were dissected and weighed (4-6 weeks old, male).
Response Summary METTL3 induced m6A modification on Kinesin-like protein KIF3C (KIF3C), promoting the stabilization of KIF3C-mRNA by IGF2BP1. KIF3C was overexpressed in prostate cancer, promoting its growth migration and invasion was induced by miR-320d/METTL3 in an m6A dependent process.
Krueppel-like factor 2 (KLF2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -1.15E+00
p-value: 3.23E-14
More Results Click to View More RNA-seq Results
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [190]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Down regulation
Cell Process Cell proliferation
Cell migration
Cell invasion
Response Summary METTL3 promotes translation of SPHK2 mRNA via an m6A-YTHDF1-dependent manner. Functionally, SPHK2 facilitates GC cell proliferation, migration and invasion by inhibiting Krueppel-like factor 2 (KLF2) expression.
Krueppel-like factor 4 (KLF4)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HUVEC cell line Homo sapiens
Treatment: shMETTL3 HUVEC cells
Control: shScramble HUVEC cells
 GSE157544
Regulation
logFC: -8.63E-01
p-value: 1.22E-04
More Results Click to View More RNA-seq Results
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [102]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Down regulation
Pathway Response TNF signaling pathway hsa04668
Cell Process Cell migration
Cell invasion
Epithelial-mesenchymal transition
In-vitro Model
 NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Response Summary MiR-1915-3p expression was regulated by METTL3/YTHDF2 m6A axis through transcription factor Krueppel-like factor 4 (KLF4). miR-1915-3p function as a tumor suppressor by targeting SET and has an anti-metastatic therapeutic potential for lung cancer treatment.
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [178]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Down regulation
Cell Process Cancer proliferation
Cancer metastasis
In-vitro Model
 SV-HUC-1 Normal Homo sapiens CVCL_3798
T24 Bladder carcinoma Homo sapiens CVCL_0554
UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
In-vivo Model For the subcutaneous implantation model, UM-UC-3 cells (2 × 106 cells per mouse) stably METTL3 knocked down (shMETTL3-1, shMETTL3-2) were injected into the flanks of mice.
Response Summary METTL3/YTHDF2/SETD7/Krueppel-like factor 4 (KLF4) m6 A axis provide the insight into the underlying mechanism of carcinogenesis and highlight potential therapeutic targets for bladder cancer.
Atherosclerosis [ICD-11: BD40]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [85]
Responsed Disease Atherosclerosis [ICD-11: BD40.Z]
Target Regulation Down regulation
In-vitro Model
 MAEC Normal Mus musculus CVCL_U411
HUVEC-C Normal Homo sapiens CVCL_2959
Response Summary In the in vivo atherosclerosis model,partial ligation of the carotid artery led to plaque formation and up-regulation of METTL3 and NLRP1, with down-regulation of KLF4; knockdown of METTL3 via repetitive shRNA administration prevented the atherogenic process, NLRP1 up-regulation, and Krueppel-like factor 4 (KLF4) down-regulation. Collectively, it has demonstrated that METTL3 serves a central role in the atherogenesis induced by oscillatory stress and disturbed blood flow.
Lymphoid enhancer-binding factor 1 (LEF1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 6.28E-01
p-value: 2.52E-06
More Results Click to View More RNA-seq Results
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [191]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 HOS Osteosarcoma Homo sapiens CVCL_0312
MG-63 Osteosarcoma Homo sapiens CVCL_0426
NHOst (Normal human osteoblast cells)
SaOS-2 Osteosarcoma Homo sapiens CVCL_0548
U2OS Osteosarcoma Homo sapiens CVCL_0042
In-vivo Model The Metastatic Bone Tumor Model was established via injecting HOS cells into the right tibia of each animal.
Response Summary METTL3 silence decreased the m6A methylation and total mRNA level of Lymphoid enhancer-binding factor 1 (LEF1),the m6A methyltransferase METTL3 promotes osteosarcoma cell progression by regulating the m6A level of LEF1 and activating Wnt/beta-catenin signaling pathway.
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [192]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Cell activity and migratory
In-vitro Model
 PC-3 Prostate carcinoma Homo sapiens CVCL_0035
Response Summary METTL3 influences the activity of the Wnt pathway through m6A methylation on Lymphoid enhancer-binding factor 1 (LEF1) mRNA, thereafter, promoting the progression of prostate cancer.
M-phase inducer phosphatase 2 (CDC25B)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: 2.72E+00
p-value: 5.89E-03
More Results Click to View More RNA-seq Results
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [193]
Responsed Disease Head and neck squamous carcinoma [ICD-11: 2B6E]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 Tu 686 Laryngeal squamous cell carcinoma Homo sapiens CVCL_4916
Tu 212 Head and neck squamous cell carcinoma Homo sapiens CVCL_4915
SAS Tongue squamous cell carcinoma Homo sapiens CVCL_1675
HUVEC-C Normal Homo sapiens CVCL_2959
HEp-2 Endocervical adenocarcinoma Homo sapiens CVCL_1906
FaDu Hypopharyngeal squamous cell carcinoma Homo sapiens CVCL_1218
In-vivo Model Tumour xenograft models were established in nude mice bearing: SAS cells cells stably transfected with METTL3-shRNA and the corresponding control vector. The different HNSCC cells (5 × 106) were subcutaneously injected into the right axilla of nude mice (n = 6 per group).
Response Summary METTL3 enhanced the m6A modification of M-phase inducer phosphatase 2 (CDC25B) mRNA, which maintained its stability and upregulated its expression, thereby activating G2/M phase of cell cycle and leading to HNSCC malignant progression.
Macrophage metalloelastase (MMP12)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Raw 264.7 cell line Mus musculus
Treatment: METTL3 knockout Raw 264.7 cells
Control: Wild type Raw 264.7 cells
 GSE162248
Regulation
logFC: -3.62E+00
p-value: 1.51E-23
More Results Click to View More RNA-seq Results
Emphysema [ICD-11: CA21]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [160]
Responsed Disease Emphysema [ICD-11: CA21]
Target Regulation Down regulation
Pathway Response MAPK signaling pathway hsa04010
Response Summary METTL3-mediated formation of EV miR-93, facilitated by m6A, is implicated in the aberrant cross-talk of epithelium-macrophages, indicating that this process is involved in the smoking-related emphysema. EV miR-93 was used as a novel risk biomarker for CS-induced emphysema. MiR-93 activated the JNK pathway by targeting dual-specificity phosphatase 2 (DUSP2), which elevated the levels of matrix metalloproteinase 9 (MMP9) and Macrophage metalloelastase (MMP12) and induced elastin degradation, leading to emphysema.
Matrix metalloproteinase-9 (MMP9)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 2.14E+00
p-value: 4.12E-24
More Results Click to View More RNA-seq Results
Emphysema [ICD-11: CA21]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [160]
Responsed Disease Emphysema [ICD-11: CA21]
Target Regulation Down regulation
Pathway Response MAPK signaling pathway hsa04010
Response Summary METTL3-mediated formation of EV miR-93, facilitated by m6A, is implicated in the aberrant cross-talk of epithelium-macrophages, indicating that this process is involved in the smoking-related emphysema. EV miR-93 was used as a novel risk biomarker for CS-induced emphysema. MiR-93 activated the JNK pathway by targeting dual-specificity phosphatase 2 (DUSP2), which elevated the levels of Matrix metalloproteinase-9 (MMP9) and matrix metalloproteinase 12 (MMP12) and induced elastin degradation, leading to emphysema.
Rheumatoid arthritis [ICD-11: FA20]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [187]
Responsed Disease Rheumatoid arthritis [ICD-11: FA20]
Target Regulation Up regulation
Cell Process Inflammatory response
In-vitro Model
 FLS (Rat fibroblast synovial cell line)
In-vivo Model To establish the adjuvant-induced arthritis (AIA) model, the rats were given complete Freund's adjuvant (CFA; Chondrex, Inc.) on the left paw of 0.1 ml per 100 g of body weight. Additionally, the rats were injected with normal saline to create the negative control (NC) group.
Response Summary METTL3 knockdown suppressed interleukin (IL)-6, matrix metalloproteinase (MMP)-3, and Matrix metalloproteinase-9 (MMP9) levels in human RA-FLSs and rat AIA-FLSs.
Meltrin-beta (ADAM19)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HUVEC cell line Homo sapiens
Treatment: shMETTL3 HUVEC cells
Control: shScramble HUVEC cells
 GSE157544
Regulation
logFC: -7.06E-01
p-value: 4.35E-03
More Results Click to View More RNA-seq Results
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [194]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Responsed Drug Ethyl ester form of meclofenamic acid Approved
 Drug Info 
Target Regulation Down regulation
Cell Process Cells growth
Cells self-renewal
Tumorigenesis
MicroRNAs in cancer (hsa05206)
In-vitro Model
 GSC Glioma Epinephelus akaara CVCL_M752
In-vivo Model 2 × 105 dissociated cells in 2 uL PBS were injected into the following site (anteroposterior [AP] +0.6 mm, mediolateral [ML] +1.6 mm, and dorsoventricular [DV] 2.6 mm) with a rate of 1 uL/min.
Response Summary Knockdown of METTL3 or METTL14 induced changes in mRNA m6A enrichment and altered mRNA expression of genes (e.g., Meltrin-beta (ADAM19)) with critical biological functions in GSCs. Treatment with MA2, a chemical inhibitor of FTO, dramatically suppressed GSC-induced tumorigenesis and prolonged lifespan in GSC-grafted animals.
Metalloreductase STEAP2 (STEAP2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: 6.65E-01
p-value: 3.16E-05
More Results Click to View More RNA-seq Results
Thyroid Cancer [ICD-11: 2D10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [195]
Responsed Disease Papillary thyroid cancer [ICD-11: 2D10.1]
Target Regulation Up regulation
Pathway Response Hedgehog signaling pathway hsa04340
Cell Process Epithelial-to-mesenchymal transition
Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 TPC-1 Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
KTC-1 Thyroid carcinoma Homo sapiens CVCL_6300
B-CPAP Thyroid gland carcinoma Homo sapiens CVCL_0153
In-vivo Model BCPAP cells (5×106) were introduced into the mice by means of subcutaneous injection through the flank area. STEAP2-saRNA or NC-saRNA (n = 6 for each group) was given by intratumoral multipoint injection at an interval of 3 days (5 injections in total) using an in vivo transfection reagent (Entranster -in vivo, Engreen, China) as per the vendor-provided protocol. Tumor volume (V) was monitored and calculated as follows: V = (L×W2)/2. For the in vivo tumor metastasis assay, BCPAP cells (5×106 cells) were administrated into mice through the tail vein. STEAP2-saRNA or NC-saRNA (n = 6 for each group) was given via tail vein injection at an interval of 3 days (8 injections in total).
Response Summary Metalloreductase STEAP2 (STEAP2) overexpression inhibited papillary thyroid cancer cell proliferation, migration, and invasion in vitro and inhibited lung metastasis and tumorigenicity in vivo. METTL3 stabilized STEAP2 mRNA and regulated STEAP2 expression positively in an m6A-dependent manner.
Microprocessor complex subunit DGCR8 (DGCR8)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3 knockout liver
Control: Wild type liver cells
 GSE198513
Regulation
logFC: -9.09E-01
p-value: 2.99E-21
More Results Click to View More RNA-seq Results
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [196]
Responsed Disease Esophageal squamous cell carcinoma [ICD-11: 2B70.1]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation
Cell migration
Cell invasion
Epithelial-mesenchymal transition
In-vitro Model
 TE-1 Esophageal squamous cell carcinoma Homo sapiens CVCL_1759
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
HET-1A Normal Homo sapiens CVCL_3702
CVCL_E307 Esophageal squamous cell carcinoma Homo sapiens CVCL_E307
Eca-109 Esophageal squamous cell carcinoma Homo sapiens CVCL_6898
In-vivo Model Luciferase-labeled KYSE150 cells (5 × 106) were inoculated into the footpads of BALB/c nude mice (4-5 weeks old, 18-20 g) to establish the popliteal lymphatic metastasis model.
Response Summary METTL3 could interact with Microprocessor complex subunit DGCR8 (DGCR8) protein and positively modulate pri-miR-320b maturation process in an N6-methyladenosine (m6A)-dependent manner. Therefore, our findings uncover a VEGF-C-independent mechanism of exosomal and intracellular miR-320b-mediated LN metastasis and identify miR-320b as a novel predictive marker and therapeutic target for LN metastasis in ESCC.
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [197]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
In-vitro Model
 WPMY-1 Normal Homo sapiens CVCL_3814
VCaP Prostate carcinoma Homo sapiens CVCL_2235
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
DU145 Prostate carcinoma Homo sapiens CVCL_0105
Response Summary METTL3 promoted cell proliferation, migration, invasion and tumorigenesis in PCa. METTL3 upregulating the level of m6A, and interacted with Microprocessor complex subunit DGCR8 (DGCR8) to recognize the m6A modification of pre-miR-182 to regulate its splicing and maturation and promote the high expression of miRNA.
Chondropathies [ICD-11: FB82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [198]
Responsed Disease Chondropathies [ICD-11: FB82]
Target Regulation Up regulation
Cell Process RNA mature
In-vitro Model
 Cartilage cells (From the cartilage tissue samples from patients)
Response Summary Interleukin 1-beta (IL-1-beta) is an important inducer of cartilage degeneration that can induce an inflammatory cascade reaction in chondrocytes and inhibit the normal biological function of cells. METTL3 could regulate miR-126-5p maturation, we first confirmed that METTL3 can bind the key protein underlying pri-miRNA processing, Microprocessor complex subunit DGCR8 (DGCR8). Additionally, when METTL3 expression was inhibited, the miR-126-5p maturation process was blocked.
Mothers against decapentaplegic homolog 3 (SMAD3)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: 1.25E+00
p-value: 1.46E-105
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [124]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
Pathway Response Hippo signaling pathway hsa04390
Cell Process Cell invasion
Cell migration
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
In-vivo Model BALB/c nude mice (4 weeks old) were acquired from Vital River Laboratory (Beijing, China). HCT116 cells with stable circ1662 expression (2 × 106 in 100 L of PBS) were injected via the tail vein. After 45 days, the mice were sacrificed. The lung metastatic carcinoma specimens were processed into paraffin-embedded sections for subsequent H&E staining and IHC.
Response Summary METTL3-induced circ1662 promoted colorectal cancer cell invasion and migration by accelerating YAP1 nuclear transport. Circ1662 enhanced CRC invasion and migration depending on YAP1 and Mothers against decapentaplegic homolog 3 (SMAD3). This result implies that circ1662 is a new prognostic and therapeutic marker for CRC metastasis.
Liver cancer [ICD-11: 2C12]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [309]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Lenvatinib Approved
 Drug Info 
In-vitro Model
 Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
In-vivo Model When the tumors in the CDX and PDX mice grew to about 80-150 mm3, forty tumor-bearing mice were randomly divided into four groups (ten mice in each group) according to the size of the transplanted tumor and the principle of consistency between groups. The four groups were: as follows: solvent control group, Len (3 mg kg-1) administration group, Res (0.375 mg kg-1) administration group, and Len (3 mg kg-1) plus Res (0.375 mg kg-1) administration group. The administration mode of all groups was intragastric and the volume was 0.2 ml/20 g. Mouse body weight and xenograft tumor volume were measured every other day. Tumor volume was measured weekly and calculated as V = (length × width2)/2. Three weeks after the onset of treatment, the tumors were excised and weighed. After the experiment, the heart, liver, spleen, lung and kidney tissues of the mice were completely removed and weighed. Then the organ index was calculated as organ index = weight of each organ/body weight × 100 %.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [309]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Reserpine Approved
 Drug Info 
In-vitro Model
 Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
In-vivo Model When the tumors in the CDX and PDX mice grew to about 80-150 mm3, forty tumor-bearing mice were randomly divided into four groups (ten mice in each group) according to the size of the transplanted tumor and the principle of consistency between groups. The four groups were: as follows: solvent control group, Len (3 mg kg-1) administration group, Res (0.375 mg kg-1) administration group, and Len (3 mg kg-1) plus Res (0.375 mg kg-1) administration group. The administration mode of all groups was intragastric and the volume was 0.2 ml/20 g. Mouse body weight and xenograft tumor volume were measured every other day. Tumor volume was measured weekly and calculated as V = (length × width2)/2. Three weeks after the onset of treatment, the tumors were excised and weighed. After the experiment, the heart, liver, spleen, lung and kidney tissues of the mice were completely removed and weighed. Then the organ index was calculated as organ index = weight of each organ/body weight × 100 %.
Mothers against decapentaplegic homolog 7 (SMAD7)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: -6.27E-01
p-value: 8.80E-36
More Results Click to View More RNA-seq Results
Inflammatory response [ICD-11: MG46]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [162]
Responsed Disease Inflammatory response [ICD-11: MG46]
Target Regulation Down regulation
Pathway Response MAPK signaling pathway hsa04010
Cell Process RNA stability
In-vitro Model
 MC3T3-E1 Normal Mus musculus CVCL_0409
Response Summary METTL3 knockdown inhibits osteoblast differentiation and Smad-dependent signaling by stabilizing Mothers against decapentaplegic homolog 7 (SMAD7) and Smurf1 mRNA transcripts via YTHDF2 involvement and activates the inflammatory response by regulating MAPK signaling in LPS-induced inflammation.
NACHT/LRR/PYD domains-containing protein 1 (NLRP1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HUVEC cell line Homo sapiens
Treatment: shMETTL3 HUVEC cells
Control: shScramble HUVEC cells
 GSE157544
Regulation
logFC: -7.83E-01
p-value: 2.96E-03
More Results Click to View More RNA-seq Results
Atherosclerosis [ICD-11: BD40]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [85]
Responsed Disease Atherosclerosis [ICD-11: BD40.Z]
Target Regulation Up regulation
In-vitro Model
 MAEC Normal Mus musculus CVCL_U411
HUVEC-C Normal Homo sapiens CVCL_2959
Response Summary In the in vivo atherosclerosis model,partial ligation of the carotid artery led to plaque formation and up-regulation of METTL3 and NACHT/LRR/PYD domains-containing protein 1 (NLRP1), with down-regulation of KLF4; knockdown of METTL3 via repetitive shRNA administration prevented the atherogenic process, NLRP3 up-regulation, and KLF4 down-regulation. Collectively, it has demonstrated that METTL3 serves a central role in the atherogenesis induced by oscillatory stress and disturbed blood flow.
NAD-dependent protein deacetylase sirtuin-1 (SIRT1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Embryonic stem cells Mus musculus
Treatment: METTL3 knockout mESCs
Control: Wild type mESCs
 GSE156481
Regulation
logFC: -7.40E-01
p-value: 1.00E-18
More Results Click to View More RNA-seq Results
Type 2 diabetes mellitus [ICD-11: 5A11]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [48]
Responsed Disease Type 2 diabetes mellitus [ICD-11: 5A11]
Target Regulation Up regulation
Pathway Response Insulin resistance hsa04931
Cell Process Lipid metabolism
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model Hepatocyte-specific METTL3 knockout mice (TBG-Cre, METTL3 fl/fl) were generated by crossing mice with TBG-Cre Tg mice. METTL3 flox (METTL3 fl/fl) and hepatocyte-specific METTL3 knockout mice (TBG-Cre, METTL3 fl/fl) were used for experiments.
Response Summary Type 2 diabetes (T2D) is characterized by lack of insulin, insulin resistance and high blood sugar. METTL3 silence decreased the m6A methylated and total mRNA level of Fatty acid synthase (Fasn), subsequently inhibited fatty acid metabolism. The expression of Acc1, Acly, Dgat2, Ehhadh, Fasn, Foxo, Pgc1a and NAD-dependent protein deacetylase sirtuin-1 (SIRT1), which are critical to the regulation of fatty acid synthesis and oxidation were dramatically decreased in livers of hepatocyte-specific METTL3 knockout mice.
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [199]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Target Regulation Up regulation
In-vitro Model
 Chondrocytes (Chondrocytes were isolated from human cartilage and cultured)
Response Summary m6A-mediated LINC00680 regulates the proliferation and ECM degradation of chondrocytes through LINC00680/m6A/NAD-dependent protein deacetylase sirtuin-1 (SIRT1) mRNA axis. METTL3-mediated LINC00680 accelerates osteoarthritis(OA) progression, which provides novel understanding of the role of m6A and lncRNA in OA.
Cataract [ICD-11: 9B10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [318]
Responsed Disease Diabetic cataract [ICD-11: 9B10.21]
In-vitro Model
 B-3 Normal Homo sapiens CVCL_6367
In-vivo Model Male C57BL/6 mice (22-25 g; Animal Center of the Second Affiliated Hospital of Harbin Medical University) were housed under a 12-h light/dark cycle at a temperature of 22-24 °C, humidity between 50 ± 10%, and with ad libitum access to food and water. The mice were acclimatized for at least 1 week before the experiments. Type 1 DM was induced by intraperitoneally injecting streptozotocin (STZ) at a dose of 55 mg/kg for 5 days consecutively. Mice that received STZ injections were considered diabetic when their blood glucose levels consistently surpassed 16.7 mmol/L (300 mg/dL) for two days consecutively. Diabetic mice were used 4 months post-last STZ injection, with blood glucose levels above 16.7 mmol/L. Any mice that did not exhibit DM development were eliminated from the experiment. The control group of mice (CON) was administered a comparable dosage of citric acid buffer .Four weeks after successful STZ induction, AAV2sh-METTL3 (2 μL; 1 × 1013 vg/mL; WZ Biosciences Inc., China) was injected into the vitreous humor of the right eyes of these mice using a 30-gauge needle and a microinjector (Hamilto Sigma-Aldrich, St.Louis, MO, USA), forming the 'STZ + AAV2sh-METTL3' group. Mice injected with AAV2sh-NC were designated as the 'STZ + AAV2sh-NC' group. At the same time, the left eye was administered 2μL saline and was designated as the 'STZ' group. The eyes of control mice were administered the same saline dosage and were designated as the 'Control-sham' group. Mice were euthanized at 4 months, and their eyes were removed. The Second Affiliated Hospital Ethics Committee of Harbin Medical University authorized the animal experiments (YJSDW2023-088).
Presbycusis [ICD-11: AB54]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [319]
Responsed Disease Presbycusis [ICD-11: AB54]
Target Regulation Up regulation
Endometriosis [ICD-11: GA10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [320]
Responsed Disease Endometriosis [ICD-11: GA10]
Target Regulation Down regulation
In-vivo Model For in vivo studies, the shMETTL3 sequence was subcloned into adeno-associated virus (AAV) construct 9 (AAV9). Recombinant AAV9 was manufactured by GenePharma (Shanghai, China). The ectopic endometrium was obtained from a 28-year-old woman who had undergone an operation for ovarian endometriosis. The tissue sample was washed twice with PBS and cut into three 3- to 5-mm pieces, and suspended by PBS.he animals were administered intraperitoneal injections of 30 mg/kg 17-oestradiol every three days after the endometrial injections. Xenografts were generated under bilateral axillae after 14 days with tumour volumes of approximately 10 mm3.
Neurogenic locus notch homolog protein 1 (NOTCH1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -6.68E-01
p-value: 1.32E-12
More Results Click to View More RNA-seq Results
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [200]
Responsed Disease Esophageal squamous cell carcinoma [ICD-11: 2B70.1]
Target Regulation Up regulation
Pathway Response Notch signaling pathway hsa04330
Cell Process Cell migration
Cell invasion
In-vitro Model
 TE-9 Esophageal squamous cell carcinoma Homo sapiens CVCL_1767
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
In-vivo Model For induction of ESCC, 4-week-old mice were treated with drinking water containing 50 ug/mL 4NQO (Sigma-Aldrich, USA) for 16 weeks and then given normal drinking water for another 4-5 weeks. Cre was activated by the intraperitoneal injection of tamoxifen (Sigma-Aldrich, USA) at a dose of 9 mg per 40 g body weight every other day for a total of three injections. For tumor measurement, mice were sacrificed, and the esophagus was dissected immediately. The surface areas of tumors were measured as described previously.
Response Summary METTL3-catalyzed m6A modification promotes Neurogenic locus notch homolog protein 1 (NOTCH1) expression and the activation of the Notch signaling pathway. Forced activation of Notch signaling pathway successfully rescues the growth, migration, and invasion capacities of METTL3-depleted ESCC cells.
Aortic aneurysm or dissection [ICD-11: BD50]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [321]
Responsed Disease Thoracic aortic dissection [ICD-11: BD50.3]
Target Regulation Down regulation
Neurogenic locus notch homolog protein 2 (NOTCH2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: 1.84E+00
p-value: 2.61E-238
More Results Click to View More RNA-seq Results
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [201]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Responsed Drug Melittin Investigative
 Drug Info 
Target Regulation Down regulation
Cell Process miRNA maturation
Cell apoptosis
In-vitro Model
 T24 Bladder carcinoma Homo sapiens CVCL_0554
SV-HUC-1 Normal Homo sapiens CVCL_3798
EJ (Human bladder cancer cells)
BIU-87 Human bladder cancer cells Homo sapiens CVCL_6881
In-vivo Model For melittin treatment study, 4-week-old female BALB/c nude mice were subcutaneously injected with 1 × 107 T24 or BIU87 cells.
Response Summary METTL3 acts as a fate determinant that controls the sensitivity of bladder cancer cells to melittin treatment. Moreover, METTL3/miR-146a-5p/NUMB/Neurogenic locus notch homolog protein 2 (NOTCH2) axis plays an oncogenic role in bladder cancer pathogenesis and could be a potential therapeutic target for recurrent bladder cancer treatment.
Nuclear factor erythroid 2-related factor 2 (NFE2L2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -1.10E+00
p-value: 4.72E-06
More Results Click to View More RNA-seq Results
Diseases of the urinary system [ICD-11: GC2Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [65]
Responsed Disease Diseases of the urinary system [ICD-11: GC2Z]
Responsed Drug Colistin Approved
 Drug Info 
Target Regulation Up regulation
Cell Process Oxidative stress
Cell apoptosis
In-vivo Model The 60 female Kunming mice were divided into two groups (n = 30): control group (injection of physiological saline through the caudal vein) and colistin group (injection of 15 mg/kg colistin, twice a day, with an eight-hour interval).
Response Summary m6A methylation was involved in oxidative stress-mediated apoptosis in the mechanism of colistin nephrotoxicity. METTL3-mediated m6A methylation modification is involved in colistin-induced nephrotoxicity through apoptosis mediated by Keap1/Nuclear factor erythroid 2-related factor 2 (NFE2L2) signaling pathway.
Nuclear factor NF-kappa-B p105 subunit (NF-Kappa-B/NFKB1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -6.78E-01
p-value: 1.44E-07
More Results Click to View More RNA-seq Results
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [202]
Responsed Disease Glioma [ICD-11: 2A00.0]
Target Regulation Up regulation
Pathway Response NF-kappa B signaling pathway hsa04064
In-vitro Model
 U87 (A primary glioblastoma cell line)
N33 (The GBM patient-derived cell line)
LN-229 Glioblastoma Homo sapiens CVCL_0393
H4 Astrocytoma Homo sapiens CVCL_1239
In-vivo Model Five-week-old female BALB/c nude mice (Charles Rivers, Beijing, China) were selected for the experiments. U87 cells (5 × 105) transfected with an empty vector, YTHDF2 overexpression, or METTL3 overexpression vectors were suspended in PBS and injected into the right frontal node of nude mice. The inoculation position was 2 mm lateral and 2 mm posterior to the anterior fontanel. Tumor size was estimated from luciferase volume measurements and MRI. The mice were sacrificed when they exhibited disturbed activity or convulsion. The brain was then harvested and embedded in paraffin.
Response Summary YTHDF2 accelerated UBXN1 mRNA degradation via METTL3-mediated m6A, which, in turn, promoted Nuclear factor NF-kappa-B p105 subunit (NF-Kappa-B/NFKB1) activation. YTHDF2 promotes the malignant progression of gliomas and revealed important insight into the upstream regulatory mechanism of NF-Kappa-B activation via UBXN1 with a primary focus on m6A modification.
Obesity [ICD-11: 5B81]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [110]
Responsed Disease Obesity [ICD-11: 5B81]
Target Regulation Up regulation
Pathway Response mTOR signaling pathway hsa04150
HIF-1 signaling pathway hsa04066
In-vivo Model The 8-10 weeks old mice were fed either a high fat diet or HF-CDAA , ad lib for 6-12 weeks. Chow diet was used as control for HFD.The mouse liver was perfused with PBS through portal vein, and liver tissue was cut into small pieces by a scissor. The single cell was made using syringe plunger to mull the tissue, and passed through a 40 uM cell strainer.
Response Summary The contribution of METTL3-mediated m6A modif ication of Ddit4 mRNA to macrophage metabolic reprogramming in non-alcoholic fatty liver disease and obesity. In METTL3-deficient macrophages, there is a significant downregulation of mammalian target of rapamycin (mTOR) and Nuclear factor NF-kappa-B p105 subunit (NF-Kappa-B/NFKB1) pathway activity in response to cellular stress and cytokine stimulation, which can be restored by knockdown of DDIT4.
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [203]
Responsed Disease Nonalcoholic steatohepatitis [ICD-11: DB92.1]
Target Regulation Up regulation
In-vitro Model
 KCs (Mouse Kupffer cells (BeNa Culture Collection, Beijing, China; BNCC340733))
In-vivo Model At 8 weeks of age, METTL14 cKO and WT mice were challenged with LPS (Sigma-Aldrich, St. Louis, MO; L2880, single intraperitoneal injection at 5 mg/kg, n = 3) or CCl4 (10%, Macklin, Shanghai, China; C805332, intraperitoneal injection at 5 mL/kg diluted with corn oil, twice per week for 4 weeks, n = 3). The corresponding control groups were treated with single intraperitoneal injection of saline (n = 3) or intraperitoneal injection of corn oil twice per week for 4 weeks (n = 3), respectively. Two hours after LPS injection and 4 weeks after CCl4 treatment, METTL14 cKO and WT mice were etherized and the primary KCs were isolated from liver according to a previously published method.
Response Summary Nuclear factor NF-kappa-B p105 subunit (NF-Kappa-B/NFKB1) acts as transcription factor to transactivate METTL3/METTL14 genes upon LPS challenge, leading to global RNA m6A hypermethylation. m6A modification in TGF-beta1 upregulation, which helps to shed light on the molecular mechanism of nonalcoholic steatohepatitis(NASH) progression.
Nucleobindin-1 (NUCB1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line DKO-1 cell line Homo sapiens
Treatment: METTL3 knockdown DKO-1 cell
Control: DKO-1 cell
 GSE182382
Regulation
logFC: -7.45E-01
p-value: 2.41E-03
More Results Click to View More RNA-seq Results
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [204]
Responsed Disease Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
Responsed Drug Gemcitabine Approved
 Drug Info 
Target Regulation Down regulation
Pathway Response Autophagy hsa04140
Cell Process Cell proliferation
Cell autophagy
In-vitro Model
 SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
HEK293T Normal Homo sapiens CVCL_0063
CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
AsPC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
In-vivo Model 5 × 106 SW1990 cells expressing NUCB1 (oeNUCB1) or control vector (oeNC) were injected subcutaneously.
Response Summary METTL3-mediated m6A modification on Nucleobindin-1 (NUCB1) 5'UTR via the reader YTHDF2 as a mechanism for NUCB1 downregulation in PDAC. This study revealed crucial functions of NUCB1 in suppressing proliferation and enhancing the effects of gemcitabine in pancreatic cancer cells.
Nucleolar protein 3 (ARC)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Embryonic stem cells Mus musculus
Treatment: METTL3 knockout ESCs
Control: Wild type ESCs
 GSE146466
Regulation
logFC: 1.50E+00
p-value: 1.12E-06
More Results Click to View More RNA-seq Results
Alzheimer disease [ICD-11: 8A20]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [205]
Responsed Disease Alzheimer disease [ICD-11: 8A20]
Target Regulation Up regulation
In-vitro Model
 SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
Response Summary METTL3 rescues the A-Bete-induced reduction of Nucleolar protein 3 (ARC) expression via YTHDF1-Dependent m6A modification, which suggests an important mechanism of epigenetic alteration in AD.
Oxidative stress-induced growth inhibitor 1 (OSGIN1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3 knockout liver
Control: Wild type liver cells
 GSE198513
Regulation
logFC: -1.34E+00
p-value: 4.00E-87
More Results Click to View More RNA-seq Results
Trachea cancer [ICD-11: 2C24]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [206]
Responsed Disease Trachea cancer [ICD-11: 2C24]
Target Regulation Up regulation
Cell Process Cell injury
Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
HBE (Human bronchial epithelial cell line)
Response Summary METTL3 regulates PM 2.5-induced cell injury by targeting Oxidative stress-induced growth inhibitor 1 (OSGIN1) in human airway epithelial cells.
PI3-kinase subunit alpha (PI3k/PIK3CA)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HULEC-5a cell line Homo sapiens
Treatment: METTL3 knockdown HULEC-5a cells
Control: HULEC-5a cells
 GSE200649
Regulation
logFC: -2.36E+00
p-value: 7.04E-03
More Results Click to View More RNA-seq Results
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [207]
Responsed Disease Lung cancer [ICD-11: 2C25]
Target Regulation Up regulation
Pathway Response Apoptosis hsa04210
PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
Response Summary MiR-600 inhibited lung cancer via down-regulating METTL3 expression, and knockdown of METTL3 was used as a novel strategy for lung cancer therapy. The PI3-kinase subunit alpha (PI3k/PIK3CA)/Akt pathway is implicated in cell growth and survival and we also observed that knockdown of METTL3 changed the expression and phosphorylation of proteins of PI3K signaling pathway members.
Renal cell carcinoma [ICD-11: 2C90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [109]
Responsed Disease Renal cell carcinoma [ICD-11: 2C90]
Target Regulation Down regulation
Cell Process Epithelial-to-mesenchymal transition
Arrest cell cycle at G0/G1 phase
In-vitro Model
 ACHN Papillary renal cell carcinoma Homo sapiens CVCL_1067
Caki-1 Clear cell renal cell carcinoma Homo sapiens CVCL_0234
Caki-2 Papillary renal cell carcinoma Homo sapiens CVCL_0235
HK2 Normal Acipenser baerii CVCL_YE28
In-vivo Model Cells (5×106 cells in 200 uL) were suspended with 100 uL PBS and 100 uL Matrigel Matrix, and injected subcutaneously into the left armpit of each mouse.
Response Summary Knockdown of METTL3 could obviously promote cell proliferation, migration and invasion function, and induce G0/G1 arrest,METTL3 acts as a novel marker for tumorigenesis, development and survival of RCC. Knockdown of METTL3 promoted changes in PI3-kinase subunit alpha (PI3k/PIK3CA)/AKT/mTOR markers' expression with a gain in p-PI3k, p-AKT, p-mTOR and p-p70, and a loss of p-4EBP1.
Poly [ADP-ribose] polymerase 1 (PARP1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MOLM-13 cell line Homo sapiens
Treatment: shMETTL3 MOLM13 cells
Control: MOLM13 cells
 GSE98623
Regulation
logFC: 1.69E+00
p-value: 1.05E-54
More Results Click to View More RNA-seq Results
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [208]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Responsed Drug Oxaliplatin Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Nucleotide excision repair hsa03420
Signaling pathways regulating pluripotency of stem cells hsa04550
Cell Process RNA stability
Excision repair
In-vitro Model
 SNU-719 Gastric tubular adenocarcinoma Homo sapiens CVCL_5086
MKN74 Gastric tubular adenocarcinoma Homo sapiens CVCL_2791
HEK293T Normal Homo sapiens CVCL_0063
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
In-vivo Model 100,000 pLKO and PARP1-sh1 (PT1 and PT2) cells were mixed with matrix gel and inoculate into BALB/C nude mice, respectively. After 25 days, 6 organoid transplanted tumor mice were treated with oxaliplatin (Sellekchem, s1224) twice a week for 4 weeks at a dose of 5 mg/kg.
Response Summary m6A methyltransferase METTL3 facilitates oxaliplatin resistance in CD133+ gastric cancer stem cells by Promoting Poly [ADP-ribose] polymerase 1 (PARP1) mRNA stability which increases base excision repair pathway activity. METTTL3 enhances the stability of PARP1 by recruiting YTHDF1 to target the 3'-untranslated Region (3'-UTR) of PARP1 mRNA.
Polycomb complex protein BMI-1 (BMI1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Pancreatic islets Mus musculus
Treatment: Mettl3 knockout mice
Control: Mettl3 flox/flox mice
 GSE155612
Regulation
logFC: 5.95E-01
p-value: 1.91E-03
More Results Click to View More RNA-seq Results
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [209]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Target Regulation Up regulation
In-vitro Model
 UM1 Tongue squamous cell carcinoma Homo sapiens CVCL_VH00
SCC-9 Tongue squamous cell carcinoma Homo sapiens CVCL_1685
SCC-25 Tongue squamous cell carcinoma Homo sapiens CVCL_1682
SCC-15 Tongue squamous cell carcinoma Homo sapiens CVCL_1681
HSC-3 Tongue squamous cell carcinoma Homo sapiens CVCL_1288
HOK Normal Hexagrammos otakii CVCL_YE19
In-vivo Model To construct the subcutaneous tumorigenesis model, the cells were suspended in 100 uL of PBS and Matrigel matrix (BD Biosciences, USA) (1:1) and injected into the right flanks of 6-week-old female BALB/c nude mice.To construct the lymph node metastasis model, we injected 1 × 105/50 uL stably infected SCC9 cells into the left hind footpads of BALB/c mice.
Response Summary METTL3 promotes Polycomb complex protein BMI-1 (BMI1) translation in OSCC under the cooperation with m6A reader IGF2BP1. And the study revealed that METTL3 promotes OSCC proliferation and metastasis through BMI1 m6A methylation.
PPAR-gamma coactivator 1-alpha (PGC-1a/PPARGC1A)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MOLM-13 cell line Homo sapiens
Treatment: shMETTL3 MOLM13 cells
Control: MOLM13 cells
 GSE98623
Regulation
logFC: -3.59E+00
p-value: 8.55E-10
More Results Click to View More RNA-seq Results
Type 2 diabetes mellitus [ICD-11: 5A11]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [48]
Responsed Disease Type 2 diabetes mellitus [ICD-11: 5A11]
Target Regulation Up regulation
Pathway Response Insulin resistance hsa04931
Cell Process Lipid metabolism
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model Hepatocyte-specific METTL3 knockout mice (TBG-Cre, METTL3 fl/fl) were generated by crossing mice with TBG-Cre Tg mice. METTL3 flox (METTL3 fl/fl) and hepatocyte-specific METTL3 knockout mice (TBG-Cre, METTL3 fl/fl) were used for experiments.
Response Summary Type 2 diabetes (T2D) is characterized by lack of insulin, insulin resistance and high blood sugar. METTL3 silence decreased the m6A methylated and total mRNA level of Fatty acid synthase (Fasn), subsequently inhibited fatty acid metabolism. The expression of Acc1, Acly, Dgat2, Ehhadh, Fasn, Foxo, PPAR-gamma coactivator 1-alpha (PGC-1a/PPARGC1A) and Sirt1, which are critical to the regulation of fatty acid synthesis and oxidation were dramatically decreased in livers of hepatocyte-specific METTL3 knockout mice.
PR domain zinc finger protein 2 (PRDM2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Pancreatic islets Mus musculus
Treatment: Mettl3 knockout mice
Control: Mettl3 flox/flox mice
 GSE155612
Regulation
logFC: 1.05E+00
p-value: 2.68E-04
More Results Click to View More RNA-seq Results
Solid tumour/cancer [ICD-11: 2A00-2F9Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [27]
Responsed Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Responsed Drug Arsenite Phase 2
 Drug Info 
Target Regulation Up regulation
Pathway Response p53 signaling pathway hsa04115
In-vitro Model
 HaCaT Normal Homo sapiens CVCL_0038
Response Summary METTL3 significantly decreased m6A level, restoring p53 activation and inhibiting cellular transformation phenotypes in the arsenite-transformed cells. m6A downregulated the expression of the positive p53 regulator, PR domain zinc finger protein 2 (PRDM2), through the YTHDF2-promoted decay of PRDM2 mRNAs. m6A upregulated the expression of the negative p53 regulator, YY1 and MDM2 through YTHDF1-stimulated translation of YY1 and MDM2 mRNA. This study further sheds light on the mechanisms of arsenic carcinogenesis via RNA epigenetics.
Prominin-1 (CD133)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -7.09E-01
p-value: 5.71E-66
More Results Click to View More RNA-seq Results
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [122]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
In-vitro Model
 MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
BT-474 Invasive breast carcinoma Homo sapiens CVCL_0179
Response Summary Knockdown of METTL3 downregulated protein levels of SOX2, Prominin-1 (CD133) and CD44 in MCF-7 cells. METTL3 is upregulated in breast cancer, and it promotes the stemness and malignant progression of BCa through mediating m6A modification on SOX2 mRNA.
Prostaglandin G/H synthase 2 (Coll X/PTGS2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MOLM-13 cell line Homo sapiens
Treatment: shMETTL3 MOLM13 cells
Control: MOLM13 cells
 GSE98623
Regulation
logFC: -2.16E+00
p-value: 5.15E-154
More Results Click to View More RNA-seq Results
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [32]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Target Regulation Up regulation
Cell Process Inflammatory response and apoptosis
In-vitro Model
 ATDC-5 Mouse teratocarcinoma Mus musculus CVCL_3894
In-vivo Model The right knee joint of each OA mouse was injected with 1U of type VII collagenase over two consecutive days to obtain experimental OA joint, and the control mice received the equal volume of physiological saline.
Response Summary METTL3 has a functional role in mediates osteoarthritis progression by regulating NF-Kappa-B signaling and ECM synthesis in chondrocytes that shed insight on developing preventive and curative strategies for OA by focusing on METTL3 and mRNA methylation. Silencing of METTL3 promotes degradation of extracellular matrix (ECM) by reducing the expression of MMP-13 and Prostaglandin G/H synthase 2 (Coll X/PTGS2), elevating the expression of Aggrecan and Coll II.
Protein AATF (AATF/CHE1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3 knockout liver
Control: Wild type liver cells
 GSE198513
Regulation
logFC: -6.23E-01
p-value: 2.02E-10
More Results Click to View More RNA-seq Results
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [22]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Doxil Approved
 Drug Info 
Target Regulation Up regulation
Cell Process Cell growth and death
Cell apoptosis
In-vitro Model
 ADR-resistant MCF-7 (MCF-7/ADR) cells (Human breast cancer doxorubicin-resistant cell line)
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
In-vivo Model Cell suspensions (2 × 106 cells/mL) made with MCF-7/ADR cells stably expressing METTL3 and/or miR-221-3p inhibitor were subcutaneously implanted into each mouse. One week later, xenografted mice were injected with 0.1 mL ADR (25 mg/kg, intraperitoneal injection) twice a week.
Response Summary METTL3 promotes adriamycin resistance in MCF-7 breast cancer cells by accelerating pri-microRNA-221-3p maturation in a m6A-dependent manner. METTL3 knockdown was shown to reduce the expression of miR-221-3p by reducing pri-miR-221-3p m6A mRNA methylation, reducing the expression of MDR1 and BCRP, and inducing apoptosis. Identified the METTL3/miR-221-3p/HIPK2/Protein AATF (AATF/CHE1) axis as a novel signaling event that will be responsible for resistance of BC cells to ADR.
Protein kinase C eta type (PKC-eta)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 8.88E-01
p-value: 2.37E-29
More Results Click to View More RNA-seq Results
Diseases of arteries or arterioles [ICD-11: BD5Y]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [96]
Responsed Disease Diseases of arteries or arterioles [ICD-11: BD5Y]
Target Regulation Down regulation
In-vitro Model
 ACBRI-183 (Human retinal pericytes (ACBRI-183) was obtained from Cell Systems Corp. (CSC, USA))
In-vivo Model Mettl3 floxed mice were purchased from GemPharmatech Co. Ltd (Nanjing, China). Pdgfr-Beta-Cre mice were purchased from Beijing Biocytogen Co. Ltd (Beijing, China) generated on C57BL/6J background. Mettl3 flox/flox mice were crossed with Pdgfr-Beta-Cre mice to generate pericyte-specific Mettl3 knockout mice. All mice were bred under the specific-pathogen free condition with free access to diet and water or their nursing mothers with alternating 12/12 light-dark cycle (lights on at 08:00 and off at 20:00).
Response Summary Specific depletion of METTL3 in pericytes suppressed diabetes-induced pericyte dysfunction and Microvascular complication in vivo. METTL3 overexpression impaired pericyte function by repressing Protein kinase C eta type (PKC-eta), FAT4, and PDGFRA expression, which was mediated by YTHDF2-dependent mRNA decay.
Protein numb homolog (NUMB)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MDA-MB-231 Homo sapiens
Treatment: METTL3 knockdown MDA-MB-231 cells
Control: MDA-MB-231 cells
 GSE70061
Regulation
logFC: 9.75E-01
p-value: 1.24E-03
More Results Click to View More RNA-seq Results
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [201]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Responsed Drug Melittin Investigative
 Drug Info 
Target Regulation Down regulation
Cell Process miRNA maturation
Cell apoptosis
In-vitro Model
 T24 Bladder carcinoma Homo sapiens CVCL_0554
SV-HUC-1 Normal Homo sapiens CVCL_3798
EJ (Human bladder cancer cells)
BIU-87 Human bladder cancer cells Homo sapiens CVCL_6881
In-vivo Model For melittin treatment study, 4-week-old female BALB/c nude mice were subcutaneously injected with 1 × 107 T24 or BIU87 cells.
Response Summary METTL3 acts as a fate determinant that controls the sensitivity of bladder cancer cells to melittin treatment. Moreover, METTL3/miR-146a-5p/Protein numb homolog (NUMB)/NOTCH2 axis plays an oncogenic role in bladder cancer pathogenesis and could be a potential therapeutic target for recurrent bladder cancer treatment.
Protein yippee-like 5 (YPEL5)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -6.48E-01
p-value: 2.75E-26
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [210]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
In-vitro Model
 SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
NCM460 Normal Homo sapiens CVCL_0460
HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
In-vivo Model For the xenograft model, METTL3 stable overexpressed SW620 cells (1 × 107) or control cells were subcutaneously injected into the right axilla of the female anesthetized BALB/C nude mice (4-6 weeks old, 18-20 g, four mice per group), respectively. The body weight and tumor volumes (length × width2 × 0.5) were measured twice a week. After 21 days, all mice were sacrificed and tumors were surgically removed for hematoxylin-eosin (H&E) staining.For the metastasis model, MTTL3 stable overexpressed SW620 cells (1 × 106) or control cells were injected into the exposed spleen of the anesthetized BALB/C nude mice, respectively. After 21 days, liver metastases were carefully detected using a fluorescent stereoscope and embedded for H&E staining.
Response Summary METTL3-catalyzed m6A modification in CRC tumorigenesis, wherein it facilitates CRC tumor growth and metastasis through suppressing Protein yippee-like 5 (YPEL5) expression in an m6A-YTHDF2-dependent manner.
Protocadherin Fat 4 (FAT4)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HUVEC cell line Homo sapiens
Treatment: shMETTL3 HUVEC cells
Control: shScramble HUVEC cells
 GSE157544
Regulation
logFC: 9.37E-01
p-value: 7.13E-05
More Results Click to View More RNA-seq Results
Diseases of arteries or arterioles [ICD-11: BD5Y]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [96]
Responsed Disease Diseases of arteries or arterioles [ICD-11: BD5Y]
Target Regulation Down regulation
In-vitro Model
 ACBRI-183 (Human retinal pericytes (ACBRI-183) was obtained from Cell Systems Corp. (CSC, USA))
In-vivo Model Mettl3 floxed mice were purchased from GemPharmatech Co. Ltd (Nanjing, China). Pdgfr-Beta-Cre mice were purchased from Beijing Biocytogen Co. Ltd (Beijing, China) generated on C57BL/6J background. Mettl3 flox/flox mice were crossed with Pdgfr-Beta-Cre mice to generate pericyte-specific Mettl3 knockout mice. All mice were bred under the specific-pathogen free condition with free access to diet and water or their nursing mothers with alternating 12/12 light-dark cycle (lights on at 08:00 and off at 20:00).
Response Summary Specific depletion of METTL3 in pericytes suppressed diabetes-induced pericyte dysfunction and Microvascular complication in vivo. METTL3 overexpression impaired pericyte function by repressing PKC-Eta, Protocadherin Fat 4 (FAT4), and PDGFRA expression, which was mediated by YTHDF2-dependent mRNA decay.
RAC-alpha serine/threonine-protein kinase (AKT1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3 knockout liver
Control: Wild type liver cells
 GSE198512
Regulation
logFC: 1.27E+00
p-value: 1.77E-02
More Results Click to View More RNA-seq Results
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation Down regulation
Pathway Response Apoptosis hsa04210
Cell Process Cell differentiation and apoptosis
In-vitro Model
 HSPC (Human hematopoietic stem cell)
In-vivo Model 500,000 selected cells were injected via tail vein or retro-orbital route into female NSG (6-8 week old) recipient mice that had been sublethally irradiated with 475 cGy one day before transplantation.
Response Summary METTL3 depletion in human myeloid leukemia cell lines induces cell differentiation and apoptosis and delays leukemia progression in recipient mice in vivo. Single-nucleotide-resolution mapping of m6A coupled with ribosome profiling reveals that m6A promotes the translation of c-MYC, BCL2 and PTEN mRNAs in the human acute myeloid leukemia MOLM-13 cell line. Moreover, loss of METTL3 leads to increased levels of phosphorylated RAC-alpha serine/threonine-protein kinase (AKT1).
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [212]
Responsed Disease Esophageal cancer [ICD-11: 2B70]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Wnt signaling pathway hsa04310
mTOR signaling pathway hsa04150
Apoptosis hsa04210
Cell Process Cell proliferation and invasion
Cell apoptosis
In-vitro Model
 Eca-109 Esophageal squamous cell carcinoma Homo sapiens CVCL_6898
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
Normal esophageal epithelial cell line (HEEC) (Isolated from the human esophagus)
Response Summary METTL3 plays a carcinogenic role in human EC progression partially through RAC-alpha serine/threonine-protein kinase (AKT1) signaling pathways, suggesting that METTL3 serves as a potential therapeutic target for esophageal cancer therapy. A double-effect inhibitor (BEZ235) inhibited AKT and mTOR phosphorylation and hindered the effect of METTL3 overexpression on the proliferation and migration of Eca-109 and KY-SE150 cells.
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Pathway Response Apoptosis hsa04210
PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
Response Summary Down-regulation of METTL3 inhibits the proliferation and mobility of human gastric cancer cells and leads to inactivation of the AKT signaling pathway, suggesting that METTL3 is a potential target for the treatment of human gastric cancer. METTL3 knockdown decreased Bcl2 and increased Bax and active Caspase-3 in gastric cancer cells, which suggested the apoptotic pathway was activated. METTL3 led to inactivation of the AKT signaling pathway in human gastric cancer cells, including decreased phosphorylation levels of RAC-alpha serine/threonine-protein kinase (AKT1) and expression of down-stream effectors p70S6K and Cyclin D1.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [213]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Up regulation
Response Summary METTL3 contributes to the progression and chemoresistance of NSCLC by promoting RAC-alpha serine/threonine-protein kinase (AKT1) protein expression through regulating AKT1 mRNA m6A levels, and provides an efficient therapeutic intervention target for overcoming chemoresistance in NSCLC.
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [168]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Target Regulation Up regulation
Pathway Response Apoptosis hsa04210
PI3K-Akt signaling pathway hsa04151
Cell Process Cell cycle
Cell apoptosis
In-vitro Model
 OVCAR-3 Ovarian serous adenocarcinoma Homo sapiens CVCL_0465
SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
Response Summary METTL3 knockdown downregulated the phosphorylation levels of RAC-alpha serine/threonine-protein kinase (AKT1) and the expression of the downstream effector Cyclin D1 in ovarian cancer.
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [62]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
Pathway Response Oxidative phosphorylation hsa00190
In-vitro Model
 VCaP Prostate carcinoma Homo sapiens CVCL_2235
RWPE-1 Normal Homo sapiens CVCL_3791
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
DU145 Prostate carcinoma Homo sapiens CVCL_0105
22Rv1 Prostate carcinoma Homo sapiens CVCL_1045
In-vivo Model Approximately 2 × 106 PCa cells (PC-3 shNC, shYTHDF2, shMETTL3 cell lines) per mouse suspended in 100 uL PBS were injected in the flank of male BALB/c nude mice (4 weeks old). During the 40-day observation, the tumor size (V = (width2×length ×0.52)) was measured with vernier caliper. Approximately 1.5 × 106 PCa cells suspended in 100 uL of PBS (PC-3 shNC, shYTHDF2, and shMETTL3 cell lines) per mouse were injected into the tail vein of male BALB/c nude mice (4 weeks old). The IVIS Spectrum animal imaging system (PerkinElmer) was used to evaluate the tumor growth (40 days) and whole metastasis conditions (4 weeks and 6 weeks) with 100 uL XenoLight D-luciferin Potassium Salt (15 mg/ml, Perkin Elmer) per mouse. Mice were anesthetized and then sacrificed for tumors and metastases which were sent for further organ-localized imaging as above, IHC staining and hematoxylin-eosin (H&E) staining.
Response Summary Knock-down of YTHDF2 or METTL3 significantly induced the expression of LHPP and NKX3-1 at both mRNA and protein level with inhibited phosphorylated RAC-alpha serine/threonine-protein kinase (AKT1). YTHDF2 mediates the mRNA degradation of the tumor suppressors LHPP and NKX3-1 in m6A-dependent way to regulate AKT phosphorylation-induced tumor progression in prostate cancer.
Renal cell carcinoma [ICD-11: 2C90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [109]
Responsed Disease Renal cell carcinoma [ICD-11: 2C90]
Target Regulation Down regulation
Cell Process Epithelial-to-mesenchymal transition
Arrest cell cycle at G0/G1 phase
In-vitro Model
 ACHN Papillary renal cell carcinoma Homo sapiens CVCL_1067
Caki-1 Clear cell renal cell carcinoma Homo sapiens CVCL_0234
Caki-2 Papillary renal cell carcinoma Homo sapiens CVCL_0235
HK2 Normal Acipenser baerii CVCL_YE28
In-vivo Model Cells (5×106 cells in 200 uL) were suspended with 100 uL PBS and 100 uL Matrigel Matrix, and injected subcutaneously into the left armpit of each mouse.
Response Summary Knockdown of METTL3 could obviously promote cell proliferation, migration and invasion function, and induce G0/G1 arrest,METTL3 acts as a novel marker for tumorigenesis, development and survival of RCC. Knockdown of METTL3 promoted changes in pI3K/RAC-alpha serine/threonine-protein kinase (AKT1)/mTOR markers' expression with a gain in p-PI3k, p-AKT, p-mTOR and p-p70, and a loss of p-4EBP1.
Retina cancer [ICD-11: 2D02]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [44]
Responsed Disease Retinoblastoma [ICD-11: 2D02.2]
Responsed Drug Rapamycin Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
mTOR signaling pathway hsa04150
Apoptosis hsa04210
Cell Process Cell proliferation
Cell migration
Cell invasion
Cell apoptosis
In-vitro Model
 WERI-Rb-1 Retinoblastoma Homo sapiens CVCL_1792
Y-79 Retinoblastoma Homo sapiens CVCL_1893
In-vivo Model To establish a subcutaneous tumour model in nude mice, 2 × 107 Y79 cells (METTL3 knockdown group: shNC, shRNA1 and shRNA2; METTL3 up-regulated group: NC and METLL3) were resuspended in 1 mL of pre-cooled PBS, and 200 uL of the cell suspension was injected subcutaneously into the left side of the armpit to investigate tumour growth (4 × 106 per mouse).
Response Summary METTL3 promotes the progression of retinoblastoma through PI3K/RAC-alpha serine/threonine-protein kinase (AKT1)/mTOR pathways in vitro and in vivo. METTL3 has an impact on the PI3K-AKT-mTOR-P70S6K/4EBP1 pathway. The cell proliferation results show that the stimulatory function of METTL3 is lost after rapamycin treatment.
Ragulator complex protein LAMTOR5 (LAMTOR5/HBXIP)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Th1 cell line Mus musculus
Treatment: METTL3 knockout splenic Th1 cells
Control: Wild type splenic Th1 cells
 GSE129648
Regulation
logFC: -6.20E-01
p-value: 1.93E-04
More Results Click to View More RNA-seq Results
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [214]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Cell Process Cell differentiation and apoptosis
Glutamine metabolism
Apoptosis (hsa04210)
Response Summary Ragulator complex protein LAMTOR5 (LAMTOR5/HBXIP) up-regulates METTL3 by suppressing let-7g, in which METTL3 increased HBXIP expression forming a positive feedback loop of HBXIP/let-7g/METTL3/HBXIP, leading to accelerated cell proliferation in breast cancer.
Rho GTPase activating protein 5 (ARHGAP5)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Pancreatic islets Mus musculus
Treatment: Mettl3 knockout mice
Control: Mettl3 flox/flox mice
 GSE155612
Regulation
logFC: 9.85E-01
p-value: 6.23E-05
More Results Click to View More RNA-seq Results
Gastric cancer [ICD-11: 2B72]
In total 3 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [215]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cellular Processes
Transport and catabolism
In-vitro Model
 BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
Response Summary ARHGAP5-AS1 also stabilized ARHGAP5 mRNA in the cytoplasm by recruiting METTL3 to stimulate m6A modification of Rho GTPase activating protein 5 (ARHGAP5) mRNA. As a result, ARHGAP5 was upregulated to promote chemoresistance and its upregulation was also associated with poor prognosis in gastric cancer. downregulation of ARHGAP5-AS1 in resistant cells evidently reversed the resistance to chemotherapeutic drugs including cisplatin (DDP), ADM, and 5-FU.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [215]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Responsed Drug Fluorouracil Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cellular processes
Cellular transport
Cellular catabolism
In-vitro Model
 BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
Response Summary ARHGAP5-AS1 also stabilized ARHGAP5 mRNA in the cytoplasm by recruiting METTL3 to stimulate m6A modification of Rho GTPase activating protein 5 (ARHGAP5) mRNA. As a result, ARHGAP5 was upregulated to promote chemoresistance and its upregulation was also associated with poor prognosis in gastric cancer. downregulation of ARHGAP5-AS1 in resistant cells evidently reversed the resistance to chemotherapeutic drugs including cisplatin (DDP), ADM, and 5-FU.
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [215]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Responsed Drug Adriamycin Phase 3
 Drug Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cellular processes
Cellular transport
Cellular catabolism
In-vitro Model
 BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
Response Summary ARHGAP5-AS1 also stabilized ARHGAP5 mRNA in the cytoplasm by recruiting METTL3 to stimulate m6A modification of Rho GTPase activating protein 5 (ARHGAP5) mRNA. As a result, ARHGAP5 was upregulated to promote chemoresistance and its upregulation was also associated with poor prognosis in gastric cancer. downregulation of ARHGAP5-AS1 in resistant cells evidently reversed the resistance to chemotherapeutic drugs including cisplatin (DDP), ADM, and 5-FU.
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [328]
Responsed Disease Breast cancer [ICD-11: 2C60]
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
T-47D Invasive breast carcinoma Homo sapiens CVCL_0553
SK-BR-3 Breast adenocarcinoma Homo sapiens CVCL_0033
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
In-vivo Model Roughly 1 × 107 of MCF-7 or MDA-MB-231 cells stably transfected with ADAR1 sgRNA or Ctrl sgRNA (as described above) were injected subcutaneously into the thighs of the female athymic nude mice (5 weeks old, 17-18 g, three mice per group). Tumor growth was measured by measuring the width (W) and length (L) with calipers, and the volume (V) of the tumor was figured using the criterion V = (W2 × L)/2. At 42 days after injection, the mice were euthanized and tumors were removed and weighed. The tumor samples were further analyzed with IHC and Western blot assay. The animal studies were performed according to the institutional ethics guidelines for animal experiments and approved by the Chongqing Medical University Animal Care and Use Committee.
Serine-protein kinase ATM (ATM)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: -7.38E-01
p-value: 7.12E-06
More Results Click to View More RNA-seq Results
Solid tumour/cancer [ICD-11: 2A00-2F9Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [216]
Responsed Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Target Regulation Down regulation
Pathway Response Homologous recombination hsa03440
p53 signaling pathway hsa04115
In-vitro Model
 BJAB Burkitt lymphoma Homo sapiens CVCL_5711
Raji EBV-related Burkitt lymphoma Homo sapiens CVCL_0511
Response Summary m6A modification regulates ATM mRNA metabolism and ATM downstream signaling, which illustrates the importance of m6A modification-related molecules for being used as therapeutic targets in DNA damage-related diseases. METTL3 disrupts the ATM stability via m6A modification, thereby affecting the DNA-damage response.
Serine/arginine-rich splicing factor 11 (SRSF11)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3 knockout liver
Control: Wild type liver cells
 GSE198512
Regulation
logFC: -6.30E-01
p-value: 2.77E-03
More Results Click to View More RNA-seq Results
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [217]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Target Regulation Up regulation
Pathway Response RNA degradation hsa03018
Cell Process mRNA decay
In-vitro Model
 U251 (Fibroblasts or fibroblast like cells)
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
In-vivo Model For subcutaneous tumor model, each mouse was injected subcutaneously in the right flank with 2 × 106 U87MG cells (METTL3-KD or control) in 100 uL PBS.
Response Summary Silencing METTL3 or overexpressing dominant-negative mutant METTL3 suppressed the growth and self-renewal of Glioblastoma cells. Integrated transcriptome and MeRIP-seq analyses revealed that downregulating the expression of METTL3 decreased m6A modification levels of Serine/arginine-rich splicing factor 11 (SRSF11), which led to YTHDC1-dependent NMD of SRSF transcripts and decreased SRSF protein expression.
Serine/arginine-rich splicing factor 3 (SRSF3)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LNCaP cell line Homo sapiens
Treatment: shMETTL3 LNCaP cells
Control: shControl LNCaP cells
 GSE147884
Regulation
logFC: -6.96E-01
p-value: 4.00E-41
More Results Click to View More RNA-seq Results
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [217]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Target Regulation Up regulation
Pathway Response RNA degradation hsa03018
Cell Process mRNA decay
In-vitro Model
 U251 (Fibroblasts or fibroblast like cells)
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
In-vivo Model For subcutaneous tumor model, each mouse was injected subcutaneously in the right flank with 2 × 106 U87MG cells (METTL3-KD or control) in 100 uL PBS.
Response Summary Silencing METTL3 or overexpressing dominant-negative mutant METTL3 suppressed the growth and self-renewal of Glioblastoma cells. Integrated transcriptome and MeRIP-seq analyses revealed that downregulating the expression of METTL3 decreased m6A modification levels of Serine/arginine-rich splicing factor 3 (SRSF3), which led to YTHDC1-dependent NMD of SRSF transcripts and decreased SRSF protein expression.
Serine/arginine-rich splicing factor 6 (SRSF6)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: 2.87E+00
p-value: 5.80E-03
More Results Click to View More RNA-seq Results
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [217]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Target Regulation Up regulation
Pathway Response RNA degradation hsa03018
Cell Process mRNA decay
In-vitro Model
 U251 (Fibroblasts or fibroblast like cells)
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
In-vivo Model For subcutaneous tumor model, each mouse was injected subcutaneously in the right flank with 2 × 106 U87MG cells (METTL3-KD or control) in 100 uL PBS.
Response Summary Silencing METTL3 or overexpressing dominant-negative mutant METTL3 suppressed the growth and self-renewal of Glioblastoma cells. Integrated transcriptome and MeRIP-seq analyses revealed that downregulating the expression of METTL3 decreased m6A modification levels of Serine/arginine-rich splicing factor 6 (SRSF6), which led to YTHDC1-dependent NMD of SRSF transcripts and decreased SRSF protein expression.
Serine/threonine-protein kinase PLK1 (PLK1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -8.98E-01
p-value: 1.15E-18
More Results Click to View More RNA-seq Results
Pulpitis [ICD-11: DA09]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [218]
Responsed Disease Pulpitis [ICD-11: DA09]
Target Regulation Down regulation
Cell Process Cell senescence
In-vitro Model
 DPSC Normal Homo sapiens CVCL_AV90
Response Summary Impaired METTL3 expression in dental pulp stem cells led to increasing cell senescence and apoptosis by interfering with the mitotic cell cycle in a m6A-dependent manner. The protein interaction network of differentially expressed genes identified Serine/threonine-protein kinase PLK1 (PLK1), a critical cycle modulator, as the target of METTL3-mediated m6A methylation in DPSCs.
Signal transducer and activator of transcription 3 (STAT3)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Embryonic stem cells Mus musculus
Treatment: METTL3 knockout mESCs
Control: Wild type mESCs
 GSE156481
Regulation
logFC: -6.99E-01
p-value: 1.19E-15
More Results Click to View More RNA-seq Results
Atherosclerosis [ICD-11: BD40]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [130]
Responsed Disease Atherosclerosis [ICD-11: BD40.Z]
Target Regulation Up regulation
Pathway Response JAK-STAT signaling pathway hsa04630
Cell Process Cell proliferation and migration
In-vitro Model
 HUVEC-C Normal Homo sapiens CVCL_2959
In-vivo Model The adeno-associated viruses (AAV) that could silence METTL3 (sh-METTL3) and the negative control adeno-associated viruses (sh-NC) were obtained from WZ Biosciences Inc. (Jinan, China). APOE-/- mice were randomly divided into AS + sh-NC and AS + sh-METTL3 groups. Each group contains five mice. Mice were fed with the standard diet for 1 week to acclimatize. After 1 week of acclimation, mice were challenged with a high-fat and high-cholesterol feed H10540 (Beijing HFK BIOSCIENCE Co., Ltd., Beijing, China). The formula of the H10540 feed was shown in Supplementary File S1. After 8 weeks of HFD feeding, sh-NC or sh-METTL3 adeno-associated virus serotype 9 (AAV9, 1012 viral genome copies per mouse) were respectively delivered into mice in AS + sh-NC or AS + sh-METTL3 group through tail vein injection. At 14 weeks after HDF feeding, mice fasted overnight.
Response Summary METTL3 knockdown prevented Atherosclerosis progression by inhibiting JAK2/Signal transducer and activator of transcription 3 (STAT3) pathway via IGF2BP1.
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [334]
Responsed Disease Gastric cancer [ICD-11: 2B72]
In-vitro Model
 GES-1 Normal Homo sapiens CVCL_EQ22
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
In-vivo Model Male nude mice (age: 4 weeks) were obtained from Charles River (Hangzhou, Zhejiang, China). For tumorigenesis analysis, AGS cells (1 × 106) with stable knockdown of AGAP2-AS1 or scramble, were injected into mice. Next, we detected and measured the tumor volume each week. The weight of the tumor in each nude mouse was also measured at 4 weeks after injection. Immunohistochemistry (IHC) was used to detect Ki67- and caspase-3- positive cells in the tumor.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [335]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
In-vitro Model
 MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
HCCLM3 Adult hepatocellular carcinoma Homo sapiens CVCL_6832
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
SMMC-7721 Endocervical adenocarcinoma Homo sapiens CVCL_0534
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model The mice were housed according to the guidelines of the National Institutes of Health Guide for the Care and Use of Laboratory Animals. The corresponding cells (5 × 106) with luciferase signal were prepared and resuspended in 150 μl PBS/Matrigel (BD Biosciences, 1:1 mixture). The mice were randomly divided into 3 groups (n = 5 per group). The cells were injected into the mice's hepatic lobe. After 2 weeks, the mice were anesthetized with isoflurane and intraperitoneally injected with 150 mg/kg D-Luciferin once a week to evaluate tumor metastasis.
Spectrin beta, non-erythrocytic 2 (SPTBN2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -1.19E+00
p-value: 2.92E-45
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [219]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Cell Process Cell proliferation and metastasis
Cell apoptosis
In-vitro Model
 Caco-2 Colon adenocarcinoma Homo sapiens CVCL_0025
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
In-vivo Model The growth of CC cells in vivo was examined by subcutaneous injection of LoVo cells or Caco-2 cells into NSG mice, while the metastatic ability of cells in vivo by intracardiac injection into mice.
Response Summary Overexpression of LINC01605, regulated by SMYD2-EP300-mediated H3K27ac and H3K4me3 modifications, bound to METTL3 protein to promote m6A modification of Spectrin beta, non-erythrocytic 2 (SPTBN2) mRNA, leading to the development of colorectal cancer.
Sprouty-related, EVH1 domain-containing protein 2 (SPRED2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Embryonic stem cells Mus musculus
Treatment: METTL3 knockout mESCs
Control: Wild type mESCs
 GSE156481
Regulation
logFC: 5.88E-01
p-value: 1.67E-05
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [220]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
Cell Process Cell migration and invasion
In-vitro Model
 Caco-2 Colon adenocarcinoma Homo sapiens CVCL_0025
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
NCM460 Normal Homo sapiens CVCL_0460
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
In-vivo Model The spleen in the upper left lateral abdomen of the anesthetized mice were exposed, 106 cells suspended in 20 uL phosphate-buffered saline (PBS) were injected into the distal tip of the spleen. After injection, replacing the spleen, and closing the incision.
Response Summary METTL3/miR-1246/Sprouty-related, EVH1 domain-containing protein 2 (SPRED2) axis plays an important role in tumor metastasis and provides a new m6A modification pattern in Colorectal cancer development.
Stromelysin-1 (MMP-3)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HUVEC cell line Homo sapiens
Treatment: shMETTL3 HUVEC cells
Control: shScramble HUVEC cells
 GSE157544
Regulation
logFC: -1.52E+00
p-value: 7.27E-05
More Results Click to View More RNA-seq Results
Rheumatoid arthritis [ICD-11: FA20]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [187]
Responsed Disease Rheumatoid arthritis [ICD-11: FA20]
Target Regulation Up regulation
Cell Process Inflammatory response
In-vitro Model
 FLS (Rat fibroblast synovial cell line)
In-vivo Model To establish the adjuvant-induced arthritis (AIA) model, the rats were given complete Freund's adjuvant (CFA; Chondrex, Inc.) on the left paw of 0.1 ml per 100 g of body weight. Additionally, the rats were injected with normal saline to create the negative control (NC) group.
Response Summary METTL3 knockdown suppressed interleukin (IL)-6, matrix metalloproteinase Stromelysin-1 (MMP-3), and MMP-9 levels in human RA-FLSs and rat AIA-FLSs.
Suppressor of cytokine signaling 2 (SOCS2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: 8.91E-01
p-value: 2.94E-04
More Results Click to View More RNA-seq Results
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [221]
Responsed Disease Glioma [ICD-11: 2A00.0]
Target Regulation Down regulation
Pathway Response Transcriptional misregulation in cancer hsa05202
Cell Process RNA stability
In-vitro Model
 LN-229 Glioblastoma Homo sapiens CVCL_0393
LN-18 Glioblastoma Homo sapiens CVCL_0392
HEB (human normal glial cell line HEB were obtained from Tongpai (Shanghai) biotechnology co., LTD (Shanghai, China))
In-vivo Model Mice were subcutaneously injected with 2.5 × 106 U251 cells stably infected with OE-NC, OE-JMJD1C, OE-NC and sh-NC, OE-JMJD1C and sh-NC or OE-JMJD1C and sh-SOCS2 (n = 10 in each group) in 0.1 ml PBS.
Response Summary MiR-302a was identified to target METTL3, which could inhibit Suppressor of cytokine signaling 2 (SOCS2) expression via m6A modification in glioma.
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [222]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Down regulation
In-vitro Model
 AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
Response Summary METTL3-KO in gastric cancer cells resulted in the suppression of cell proliferation by inducing Suppressor of cytokine signaling 2 (SOCS2), suggesting a potential role of elevated METTL3 expression in gastric cancer progression.
Colon cancer [ICD-11: 2B90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [223]
Responsed Disease Colon cancer [ICD-11: 2B90]
Target Regulation Down regulation
Cell Process Cell proliferation
In-vitro Model
 SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary An increased level of METTL3 may maintain the tumorigenicity of colon cancer cells by suppressing Suppressor of cytokine signaling 2 (SOCS2).
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [224]
Responsed Disease Liver cancer [ICD-11: 2C12]
Target Regulation Down regulation
Cell Process Cells proliferation
Cells migration
Cells invasion
RNA degradation (hsa03018)
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
In-vivo Model For the subcutaneous implantation model, 2 × 106 METTL3 stable knockdown Huh-7 cells or METTL3 overexpression MHCC97L cells were injected subcutaneously into BABL/cAnN-nude mice. For orthotopic implantation, wild-type and METTL3 knockout Huh-7 cells were luciferase labelled, and 2 × 106 cells were then injected orthotopically into the left liver lobe of nude mice.
Response Summary METTL3 is frequently up-regulated in human HCC and contributes to HCC progression. METTL3 represses Suppressor of cytokine signaling 2 (SOCS2) expression in HCC through an m6A-YTHDF2-dependent mechanism.
Thyrotoxicosis [ICD-11: 5A02]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [225]
Responsed Disease Graves disease [ICD-11: 5A02.0]
Target Regulation Down regulation
In-vitro Model
 PBMCs (Human peripheral blood mononuclear cells (PBMCs) are isolated from peripheral blood and identified as any blood cell with a round nucleus)
Response Summary METTL3 knock-down experiment revealed that expressions of SOCS family members SOCS1, Suppressor of cytokine signaling 2 (SOCS2), SOCS4, SOCS5, and SOCS6 were increased after METTL3 knock-down. It indicated that METTL3 is involved in the development of Graves' disease (GD) by inducing mRNA m6A methylation modification of SOCS family members.
Thioredoxin (TXN/SASP)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: -7.32E-01
p-value: 1.61E-02
More Results Click to View More RNA-seq Results
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [131]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cellular senescence
Cell autophagy
In-vitro Model
 C-28/I2 Normal Homo sapiens CVCL_0187
FLS (Rat fibroblast synovial cell line)
In-vivo Model Mice were anaesthetized with isoflurane supplied in a mouse anaesthesia apparatus, followed with joint surgery on the right joint by sectioning the medial meniscotibial ligament.
Response Summary In osteoarthritis METTL3-mediated m6A modification decreased the expression of Thioredoxin (TXN/SASP), an E-1 enzyme crucial for the formation of autophagosomes, by attenuating its RNA stability. Silencing METTL3 enhanced autophagic flux and inhibited SASP expression in OA-FLS.
Thioredoxin domain-containing protein 5 (TXNDC5)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -6.19E-01
p-value: 4.11E-14
More Results Click to View More RNA-seq Results
Melanoma [ICD-11: 2C30]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [226]
Responsed Disease Melanoma [ICD-11: 2C30]
Target Regulation Up regulation
Cell Process Cell proliferation
cell migration
cell invasion
In-vitro Model
 SK-MEL-28 Cutaneous melanoma Homo sapiens CVCL_0526
MV3 Amelanotic melanoma Homo sapiens CVCL_W280
HMY-1 Melanoma Homo sapiens CVCL_2950
HEMa (The normal human epidermal melanocyte (HEMa) was extracted from fresh foreskin tissue donated after circumcision in adults and cultured in melanocyte medium with 5% fetal bovine serum (Sciencell, USA))
A-875 Melanoma Homo sapiens CVCL_4733
A375-MA2 Amelanotic melanoma Homo sapiens CVCL_X495
A2058 Amelanotic melanoma Homo sapiens CVCL_1059
In-vivo Model Sixteen BALB/c nude mice (male, 6-week-old) were raised under pathogen-free conditions and randomly divided into two groups. A total of 2 × 106 A375 NTC or sh-METTL3#2 cells were subcutaneously inoculated into the right hind flank. Body weight and tumor size were measured every other day. The tumors were harvested at the end of the observation period, and tumor weight and gross images were recorded (11 days after inoculation). The tumors were embedded in RNA later and 10% formalin for further detection.
Response Summary METTL3 regulates certain m6A-methylated transcripts, Thioredoxin domain-containing protein 5 (TXNDC5), targeting the m6A dependent-METTL3 signaling pathway serves as a promising therapeutic strategy for management of patients of acral melanomas.
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [346]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Transcription factor AP-2-alpha (TFAP2A)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 9.80E-01
p-value: 2.54E-26
More Results Click to View More RNA-seq Results
Urinary/pelvic organs injury [ICD-11: NB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [38]
Responsed Disease Injury of kidney [ICD-11: NB92.0]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell apoptosis
In-vitro Model
 NRK-52E Normal Rattus norvegicus CVCL_0468
In-vivo Model Rats were anesthetized and incised through the midline of the abdomen, and the left renal vertebral arch and arteries were blocked for 45 min, thereby resulting in left kidney ischemia. At the same time, the right kidney was removed, further aggravating the degree of left kidney injury.
Response Summary METTL3 contributes to renal ischemia-reperfusion injury by regulating Foxd1 methylation. When METTL3 was inhibited, m6A levels were accordingly decreased and cell apoptosis was suppressed in the H/R in vitro model. Based on MeRIP sequencing, Transcription factor AP-2-alpha (TFAP2A), cytochrome P-450 1B1 (cyp1b1), and forkhead box D1 (foxd1) were significantly differentially expressed, as was m6A, which is involved in the negative regulation of cell proliferation and kidney development.
Transcription factor p65 (RELA)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 6.33E-01
p-value: 3.93E-11
More Results Click to View More RNA-seq Results
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Cell Process Glucose metabolism
Response Summary AF4/FMR2 family member 4 (AFF4), two key regulators of NF-Kappa-B pathway (IKBKB and Transcription factor p65 (RELA)) and MYC were further identified as direct targets of METTL3-mediated m6A modification.overexpression of METTL3 significantly promoted Bladder cancer cell growth and invasion.
Thyroid Cancer [ICD-11: 2D10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [103]
Responsed Disease Papillary thyroid cancer [ICD-11: 2D10.1]
Target Regulation Down regulation
Pathway Response NF-kappa B signaling pathway hsa04064
In-vitro Model
 TPC-1 Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
Nthy-ori 3-1 Normal Homo sapiens CVCL_2659
KTC-1 Thyroid carcinoma Homo sapiens CVCL_6300
B-CPAP Thyroid gland carcinoma Homo sapiens CVCL_0153
In-vivo Model For xenograft models, 5 × 106 BCPAP or KTC-1 cells from each group were injected subcutaneously into the flanks of female BALB/c nude mice (4-6 weeks old, Shanghai SLAC Laboratory Animal, China, n = 5 per group) in a volume of 150 uL PBS. Tumor growth was measured with a digital caliper every 4 days and calculated using the following formula: (length × width2)/2. To study the effect of IL-8 on tumor growth in vivo, scramble or shMETTL3 BCPAP cells were implanted hypodermically into BALB/c nude mice (2 × 106 cells in 150 uL PBS, n = 10 per group). When palpable tumors formed on day 14, mice were treated with DMSO or the IL-8 inhibitor SB225002 (10 mg/kg) by intraperitoneal injection 3 times per week for 3 weeks. Six weeks post-injection, the mice were sacrificed, and the tumors were collected to analyze the frequency of TANs by flow cytometry. For the lung metastasis model, BCPAP and KTC-1 cells (2 × 106 cells in 100 uL PBS) with the corresponding vectors were injected into the tail veins of BALB/c nude mice. Eight weeks after injection, the mice were euthanized, and metastatic lung nodules were analyzed (n = 5 for each group).
Response Summary METTL3 played a pivotal tumor-suppressor role in papillary thyroid cancer carcinogenesis through c-Rel and Transcription factor p65 (RELA) inactivation of the nuclear factor Kappa-B (NF-Kappa-B) pathway by cooperating with YTHDF2 and altered TAN infiltration to regulate tumor growth.
Transcription factor Sp1 (SP1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Mouse testis Mus musculus
Treatment: Mettl3 knockout mouse testis
Control: Mouse testis
 GSE99771
Regulation
logFC: -5.88E+00
p-value: 2.22E-06
More Results Click to View More RNA-seq Results
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [227]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Cell Process Cell cycle
In-vitro Model
 EoL-1 Chronic eosinophilic leukemia Homo sapiens CVCL_0258
HEL Erythroleukemia Homo sapiens CVCL_0001
HL-60 Adult acute myeloid leukemia Homo sapiens CVCL_0002
Jurkat T acute lymphoblastic leukemia Homo sapiens CVCL_0065
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KG-1 Adult acute myeloid leukemia Homo sapiens CVCL_0374
Loucy Adult T acute lymphoblastic leukemia Homo sapiens CVCL_1380
MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
RN2c (Acute myeloid leukemia cell line)
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
In-vivo Model Performed an ex vivo genome wide CRISPR dropout screen (Screen 1) using Cas9-expressing mouse primary leukaemia cells driven by an MLL-AF9 fusion gene and a FLT3 internal tandem duplication.
Response Summary Genes regulated by METTL3 in this way are necessary for acute myeloid leukaemia. Two genes expressing the transcription factors Transcription factor Sp1 (SP1) and SP2, which have promoters occupied by METTL3.
Transcription factor Sp2 (SP2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Pancreatic islets Mus musculus
Treatment: Mettl3 knockout mice
Control: Mettl3 flox/flox mice
 GSE155612
Regulation
logFC: 8.11E-01
p-value: 3.84E-03
More Results Click to View More RNA-seq Results
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [227]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Cell Process Cell cycle
In-vitro Model
 EoL-1 Chronic eosinophilic leukemia Homo sapiens CVCL_0258
HEL Erythroleukemia Homo sapiens CVCL_0001
HL-60 Adult acute myeloid leukemia Homo sapiens CVCL_0002
Jurkat T acute lymphoblastic leukemia Homo sapiens CVCL_0065
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KG-1 Adult acute myeloid leukemia Homo sapiens CVCL_0374
Loucy Adult T acute lymphoblastic leukemia Homo sapiens CVCL_1380
MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
RN2c (Acute myeloid leukemia cell line)
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
In-vivo Model Performed an ex vivo genome wide CRISPR dropout screen (Screen 1) using Cas9-expressing mouse primary leukaemia cells driven by an MLL-AF9 fusion gene and a FLT3 internal tandem duplication.
Response Summary Genes regulated by METTL3 in this way are necessary for acute myeloid leukaemia. Two genes expressing the transcription factors SP1 and Transcription factor Sp2 (SP2), which have promoters occupied by METTL3.
Transcriptional repressor protein YY1 (YY1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Pancreatic islets Mus musculus
Treatment: Mettl3 knockout mice
Control: Mettl3 flox/flox mice
 GSE155612
Regulation
logFC: 9.11E-01
p-value: 3.29E-04
More Results Click to View More RNA-seq Results
Multiple myeloma [ICD-11: 2A83]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [228]
Responsed Disease Multiple myeloma [ICD-11: 2A83.1]
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model
 U266 (Human multiple myeloma cells)
RPMI-8226 Plasma cell myeloma Homo sapiens CVCL_0014
NCI-H929 Plasma cell myeloma Homo sapiens CVCL_1600
MM1.S Plasma cell myeloma Homo sapiens CVCL_8792
In-vivo Model BALB/C nude mice (5 weeks old, weighing 18-22 g) were fed in specific pathogen-free facilities and subcutaneously inoculated with U266 cells (1 × 106). The mice were randomly divided into 3 groups with 6 mice per group, when the tumor was measurable. Then, miR-27a-3p mimic or sh-METTL3 was injected intratumorally at an interval of 4 days a total of 4 times. Tumor volume was measured using a digital caliper every week and calculated using the formula V = 1/2 (width2 × length).
Response Summary METTL3 affected the growth, apoptosis, and stemness of MM cells through accelerating the stability of Transcriptional repressor protein YY1 (YY1) mRNA and the maturation of primary-miR-27a-3p in vitro and in vivo.
Tyrosine-protein kinase receptor UFO (AXL)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -1.33E+00
p-value: 3.11E-06
More Results Click to View More RNA-seq Results
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [229]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Target Regulation Up regulation
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 A2780 Ovarian endometrioid adenocarcinoma Homo sapiens CVCL_0134
COV504 Ovarian carcinoma Homo sapiens CVCL_2424
ES2 Ewing sarcoma Homo sapiens CVCL_AX39
HO-8910 Endocervical adenocarcinoma Homo sapiens CVCL_6868
OVCAR-3 Ovarian serous adenocarcinoma Homo sapiens CVCL_0465
SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
In-vivo Model 2 × 106 tumor cells (OVCAR3-METTL3 and OVCAR3-Ctrl) or 1 × 106 tumor cells (SKOV3-shMETTL3-1, SKOV3-shMETTL3-2 and SKOV3-shNC) were suspended in 200 uL of RPMI 1640 complete culture medium with 25% Matrigel (BD Biosciences) and inoculated subcutaneously into the right flank of the nude mice.
Response Summary METTL3 promoted epithelial-mesenchymal transition (EMT) by upregulating the receptor tyrosine kinase Tyrosine-protein kinase receptor UFO (AXL) and that METTL3 serves as a novel prognostic and/or therapeutic target of interest in ovarian cancer.
Ubiquitin carboxyl-terminal hydrolase 4 (USP4)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Mouse testis Mus musculus
Treatment: Mettl3 knockout mouse testis
Control: Mouse testis
 GSE99771
Regulation
logFC: -6.58E+00
p-value: 2.47E-06
More Results Click to View More RNA-seq Results
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [163]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Down regulation
In-vitro Model
 PC-3 Prostate carcinoma Homo sapiens CVCL_0035
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
DU145 Prostate carcinoma Homo sapiens CVCL_0105
In-vivo Model A total of 1 × 106 PC3 cells or DU145 cells suspended in a mixture of 100 uL PBS and Matrigel were subcutaneously injected into BALB/c nude mice. Tumor weight were measured 2 months after the engraftment. To evaluate the role of METTL3 in tumor metastasis, PC3 cells with or without knockdown of METTL3 were injected into SCID mice through the tail vein (1 × 106 cells per mouse). After eight weeks, mice were sacrificed and their lung tissues were collected for subsequent analyses.
Response Summary m6A modification levels were markedly upregulated in human PCa tissues due to increased expression of METTL3. METTL3 mediates m6A modification of Ubiquitin carboxyl-terminal hydrolase 4 (USP4) mRNA at A2696, and m6A reader protein YTHDF2 binds to and induces degradation of USP4 mRNA by recruiting RNA-binding protein HNRNPD to the mRNA. Decrease of USP4 fails to remove the ubiquitin group from ELAVL1 protein, resulting in a reduction of ELAVL1 protein. Lastly, downregulation of ELAVL1 in turn increases ARHGDIA expression, promoting migration and invasion of PCa cells.
Multiple myeloma [ICD-11: 2A83]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [356]
Responsed Disease Multiple myeloma [ICD-11: 2A83.1]
Responsed Drug Metformin Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 NCI-H929 Plasma cell myeloma Homo sapiens CVCL_1600
MM1.S Plasma cell myeloma Homo sapiens CVCL_8792
In-vivo Model 5-week-old male athymic BALB/C nude mice were obtained from Experimental animal center of Fujian Medical University, and subsequently randomly divided into four groups (5 mice per group), including control, metformin, pcDNA-METTL3 and pcDNA-METTL3 + metformin. For the control or metformin group, to induce tumors, 5 × 105 H929 cells were suspended in 0.2 ml phosphate buffered saline and inoculated subcutaneously into the peritoneum of mice. Once the subcutaneous nodules grown to a rice grain size (required approximately a week), the subcutaneous xenograft model of MM in nude mice was successfully constructed. One week later, PBS or Metformin was diluted in drinking water (2 mg/ml) and administered orally throughout the indicated time periods. For the pcDNA-METTL3 group and pcDNA-METTL3 + metformin group, firstly, we transfected pcDNA-METTL3 into H929 cells to overexpress METTL3, and then 5 × 105 H929 cells were suspended in 0.2 ml phosphate-buffered saline and inoculated subcutaneously into the peritoneum of mice. One week later, PBS or Metformin was diluted in drinking water (2 mg/ml) and administered orally throughout the indicated time periods. All nude mice were closely monitored for tumor growth, skin condition, and behavior daily and any tumor ulceration or irritation was noted. Tumor length and width were calculated with vernier calipers every 7 days. After 35 days, the mice were humanely sacrificed, and the subcutaneous tumors were excised and removed.
Ubiquitin carboxyl-terminal hydrolase 7 (USP7)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3 knockout liver
Control: Wild type liver cells
 GSE198513
Regulation
logFC: -7.46E-01
p-value: 2.02E-26
More Results Click to View More RNA-seq Results
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [230]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
Cell Process Cell invasion
Cell migration
Cell proliferation
In-vitro Model
 MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
HCCLM3 Adult hepatocellular carcinoma Homo sapiens CVCL_6832
In-vivo Model Male nu/nu mice between 4 and 6 weeks of age received subcutaneous injections of equivalent Hep3B cells expressing either LV-shMETTL3 or LV-USP7 within 30 min of harvesting on the right and left flanks. The tumor was weighed after approximately 4 weeks, and the volume was measured every 5 days.
Response Summary METTL3 regulates the expression of Ubiquitin carboxyl-terminal hydrolase 7 (USP7) through m6A methylation and facilitate the invasion, migration and proliferation of HCC cells. Besides, the elevated METTL3 expression was related to worse overall survival.
Ubiquitin-like-conjugating enzyme ATG3 (ATG3)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3-deficient liver
Control: Wild type liver cells
 GSE197800
Regulation
logFC: -1.62E+00
p-value: 2.55E-18
More Results Click to View More RNA-seq Results
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [17]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Sorafenib Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response FoxO signaling pathway hsa04068
Autophagy hsa04140
Cell Process Cell autophagy
Response Summary METTL3 can sensitise hepatocellular carcinoma cells to sorafenib through stabilising forkhead box class O3 (FOXO3) in an m6A-dependent manner and translated by YTHDF1, thereby inhibiting the transcription of autophagy-related genes, including Ubiquitin-like-conjugating enzyme ATG3 (ATG3), ATG5, ATG7, ATG12, and ATG16L1.
UBX domain-containing protein 1 (UBXN1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Embryonic stem cells Mus musculus
Treatment: METTL3 knockout mESCs
Control: Wild type mESCs
 GSE156481
Regulation
logFC: -9.05E-01
p-value: 4.00E-16
More Results Click to View More RNA-seq Results
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [202]
Responsed Disease Glioma [ICD-11: 2A00.0]
Target Regulation Down regulation
Pathway Response NF-kappa B signaling pathway hsa04064
In-vitro Model
 U87 (A primary glioblastoma cell line)
N33 (The GBM patient-derived cell line)
LN-229 Glioblastoma Homo sapiens CVCL_0393
H4 Astrocytoma Homo sapiens CVCL_1239
In-vivo Model Five-week-old female BALB/c nude mice (Charles Rivers, Beijing, China) were selected for the experiments. U87 cells (5 × 105) transfected with an empty vector, YTHDF2 overexpression, or METTL3 overexpression vectors were suspended in PBS and injected into the right frontal node of nude mice. The inoculation position was 2 mm lateral and 2 mm posterior to the anterior fontanel. Tumor size was estimated from luciferase volume measurements and MRI. The mice were sacrificed when they exhibited disturbed activity or convulsion. The brain was then harvested and embedded in paraffin.
Response Summary YTHDF2 accelerated UBX domain-containing protein 1 (UBXN1) mRNA degradation via METTL3-mediated m6A, which, in turn, promoted NF-Kappa-B activation. YTHDF2 promotes the malignant progression of gliomas and revealed important insight into the upstream regulatory mechanism of NF-Kappa-B activation via UBXN1 with a primary focus on m6A modification.
Uridine-cytidine kinase 2 (UCK2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: -6.22E-01
p-value: 2.07E-05
More Results Click to View More RNA-seq Results
Melanoma [ICD-11: 2C30]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [232]
Responsed Disease Melanoma [ICD-11: 2C30]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model
 Hs 294T Melanoma Homo sapiens CVCL_0331
Response Summary m6A-METTL3 axis induced abnormal Uridine-cytidine kinase 2 (UCK2) expression plays a role in melanoma metastasis by enhancing the Wnt/Bete-catenin pathway, which provided new clues for melanoma metastasis. It also provides a potential target for the prevention and treatment of melanoma.
Urokinase-type plasminogen activator (PLAU)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 1.68E+00
p-value: 4.01E-99
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [233]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
In-vitro Model
 LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model 1 × 106 cells in 100 uL PBS (shMETTL3-1 or shNC) were respectively injected into each mouse through the tail vein. Pulmonary metastases were monitored after fourteen days using the imaging system (IVIS) Spectrum (PerkinElmer, USA).
Response Summary METTL3 upregulated Urokinase-type plasminogen activator (PLAU) mRNA in an m6A-dependent manner, and then participated in MAPK/ERK pathway to promote angiogenesis and metastasis in CRC.
Vascular endothelial growth factor A (VEGFA)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MOLM-13 cell line Homo sapiens
Treatment: shMETTL3 MOLM13 cells
Control: MOLM13 cells
 GSE98623
Regulation
logFC: -8.11E-01
p-value: 1.38E-19
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [46]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Pathway Response PI3K-Akt signaling pathway hsa04151
In-vitro Model
 SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
NCM460 Normal Homo sapiens CVCL_0460
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
In-vivo Model A total of 8 × 106 wild-type (WT) or METTL3-knockdown cells were injected into the dorsal flanks of 6-week-old nude mice. Seven mice were randomly selected to calculate the volume according to the following formula: V = (width2 × length)/2. Mice were euthanized three weeks after injection and tumors removed, weighed, fixed, and embedded for immunohistochemical analysis.
Response Summary EphA2 and Vascular endothelial growth factor A (VEGFA) targeted by METTL3 via different IGF2BP-dependent mechanisms were found to promote vasculogenic mimicry (VM) formation via PI3K/AKT/mTOR and ERK1/2 signaling in CRC.
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Cell Process Cellular proliferation and survival
In-vitro Model
 UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
T24 Bladder carcinoma Homo sapiens CVCL_0554
In-vivo Model For induction of BCa, 6-8-week-old mice were treated with drinking water containing 500 ug/ml BBN for 16 weeks and then given normal water for another 10 weeks. Tamoxifen was intraperitonelly injected to the mice with 0.08 mg/g of body weight each day for 3 days in order to inductively knock out the target gene.
Response Summary Deletion of Mettl3 leads to the suppression of TEK and Vascular endothelial growth factor A (VEGFA),ablation of Mettl3 in bladder urothelial attenuates the oncogenesis and tumor angiogenesis of bladder cancer.
Diseases of the musculoskeletal system [ICD-11: FC0Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [234]
Responsed Disease Diseases of the musculoskeletal system [ICD-11: FC0Z]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process Alternative splicing
In-vitro Model
 BMSCs (BMSCs were obtained from the femurs and tibias of 2-3-week-old Sprague-Dawley male rats (Animal Center of Sun Yat-sen University))
Response Summary Mettl3 knockdown not only reduced the expression of Vascular endothelial growth factor A (VEGFA) but also decreased the level of its splice variants, vegfa-164 and vegfa-188, in Mettl3-deficient BMSCs. These findings contribute to novel progress in understanding the role of epitranscriptomic regulation in the osteogenic differentiation of BMSCs.
Herpes infection [ICD-11: 1F00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [357]
Responsed Disease Herpes simplex keratitis [ICD-11: 1F00.10]
Target Regulation Up regulation
In-vitro Model
HUVEC-CS
 N.A. Homo sapiens CVCL_0F27
3T3-Swiss albino
 N.A. Mus musculus CVCL_0120
Vimentin (vimentin)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -9.97E-01
p-value: 8.40E-43
More Results Click to View More RNA-seq Results
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [24]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 Neural progenitor cells (NPCs) (The progenitor cells of the CNS)
NP69 (A human immortalized nasopharyngeal epithelial)
HNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_FA07
HNE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_0308
CNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_6889
CNE-1 Normal Homo sapiens CVCL_6888
In-vivo Model 1 × 105 HNE2 cells (with or without METTL3 knockdown) were labeled with luciferase gene and injected into the tail vein of the nude mice.
Response Summary METTL3 activated the luciferase activity of TOPflash (a reporter for beta-catenin/TCF signaling), and downregulation of METTL3 inhibited the expression of beta-catenin/TCF target genes Vimentin (vimentin) and N-cadherin, which are two regulators of epithelial-mesenchymal transition. METTL3 silencing decreased the m6A methylation and total mRNA levels of Tankyrase, a negative regulator of axin. METTL3 is a therapeutic target for NPC.
Zinc finger protein SNAI1 (SNAI1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -7.78E-01
p-value: 5.01E-07
More Results Click to View More RNA-seq Results
Solid tumour/cancer [ICD-11: 2A00-2F9Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [235]
Responsed Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Target Regulation Up regulation
Pathway Response Adherens junction hsa04520
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Response Summary The expression of TGFbeta1 was up-regulated, while self-stimulated expression of TGFbeta1 was suppressed in METTL3Mut/- cells. m6A performed multi-functional roles in TGFbeta1 expression and EMT modulation, suggesting the critical roles of m6A in cancer progression regulation. Zinc finger protein SNAI1 (SNAI1), which was down-regulated in Mettl3Mut/- cells, was a key factor responding to TGF-Beta-1-induced EMT.
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [236]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 SUNE1 Nasopharyngeal carcinoma Homo sapiens CVCL_6946
Response Summary Overexpression of Zinc finger protein SNAI1 (SNAI1) partially reversed the regulatory effects of METTL3 on EMT-related gene expressions and metastatic abilities in nasopharyngeal carcinoma. Knockdown of METTL3 decreased the enrichment abundance of Snail in anti-IGF2BP2.
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [237]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Adherens junction hsa04520
Cell Process Cell proliferation
Cell invasion
In-vitro Model
 SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
NCM460 Normal Homo sapiens CVCL_0460
HT29 Colon cancer Mus musculus CVCL_A8EZ
HIEC-6 Normal Homo sapiens CVCL_6C21
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HEK293T Normal Homo sapiens CVCL_0063
Response Summary METTL3 acts as a critical m6A methyltransferase capable of facilitating colorectal cancer(CRC) progression, and revealed a novel mechanism by which METTL3 promotes CRC cell proliferation and invasion via stabilizing Zinc finger protein SNAI1 (SNAI1) mRNA in an m6A-dependent manner.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [238]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
Cell Process Epithelial-mesenchymal transition
cell migration
invasion
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model All animal experiments complied with Zhongshan School of Medicine Policy on Care and Use of Laboratory Animals. For subcutaneous transplanted model, sh-control and sh-METTL3 Huh7 cells (5 × 106 per mouse, n = 5 for each group) were diluted in 200 uL of PBS + 200 uL Matrigel (BD Biosciences) and subcutaneously injected into immunodeficient female mice to investigate tumor growth.
Response Summary The upregulation of METTL3 and YTHDF1 act as adverse prognosis factors for overall survival (OS) rate of liver cancer patients. m6A-sequencing and functional studies confirm that Zinc finger protein SNAI1 (SNAI1), a key transcription factor of EMT, is involved in m6A-regulated EMT.
Family with sequence similarity 225 member A (FAM225A)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 1.41E+00
p-value: 1.18E-04
More Results Click to View More RNA-seq Results
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [64]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation and metastasis
In-vitro Model
 5-8F Nasopharyngeal carcinoma Homo sapiens CVCL_C528
6-10B Nasopharyngeal carcinoma Homo sapiens CVCL_C529
C666-1 Nasopharyngeal carcinoma Homo sapiens CVCL_7949
CNE-1 Normal Homo sapiens CVCL_6888
CNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_6889
HK1 Nasopharyngeal carcinoma Acipenser baerii CVCL_YE27
HNE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_0308
HONE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_8706
N2Tert (The human immortalized nasopharyngeal epithelial cell lines)
NP69 (A human immortalized nasopharyngeal epithelial)
S18 Nasopharyngeal carcinoma Homo sapiens CVCL_B0U9
S26 Nasopharyngeal carcinoma Homo sapiens CVCL_B0UB
SUNE1 Nasopharyngeal carcinoma Homo sapiens CVCL_6946
In-vivo Model For the tumor growth model, 1 × 106 HNE1-Scrambled or HNE1-shFAM2225A 2# cells were injected into the axilla of the mice, and the tumor size was measured every 3 days.
Response Summary Family with sequence similarity 225 member A (FAM225A) functioned as a competing endogenous RNA (ceRNA) for sponging miR-590-3p and miR-1275, leading to the upregulation of their target integrin beta-3 (ITGB3), and the activation of FAK/PI3K/Akt signaling to promote Nasopharyngeal carcinoma cell proliferation and invasion. FAM225A showed lower RNA stability after silencing of METTL3.
H19 imprinted maternally expressed transcript (H19)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line DKO-1 cell line Homo sapiens
Treatment: METTL3 knockdown DKO-1 cell
Control: DKO-1 cell
 GSE182382
Regulation
logFC: -2.53E+00
p-value: 9.95E-11
More Results Click to View More RNA-seq Results
Abnormalities of breathing [ICD-11: MD11]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [240]
Responsed Disease Abnormalities of breathing [ICD-11: MD11]
Target Regulation Up regulation
Cell Process Cell viability
Cell apoptosis
In-vitro Model
 H9c2(2-1) Normal Rattus norvegicus CVCL_0286
In-vivo Model In vivo myocardial I/R injury was performed by 60 min of ligation of LAD followed by 5 h of reperfusion.
Response Summary Either knockdown of METTL3 or METTL14 notably reversed the hypoxic preconditioning-induced enhancement of cell viability, anti-apoptosis ability, and H19 imprinted maternally expressed transcript (H19) expression.
Long intergenic non-protein coding RNA 470 (LINC00470)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: 5.89E-01
p-value: 3.48E-02
More Results Click to View More RNA-seq Results
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [73]
Responsed Disease Chronic myeloid leukaemia [ICD-11: 2B33.2]
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process RNA stability
Cell autophagy
In-vitro Model
 K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KCL-22 Chronic myelogenous leukemia Homo sapiens CVCL_2091
In-vivo Model In the control mice or ADR mice group, the parental or chemo-resistant K562 cells were infected with LV-shCtrl. In the ADR + shLINC00470 group, the chemo-resistant K562 cells were infected with LV- shLINC00470. These cells were injected, respectively, into these 5-week-old mice subcutaneously.
Response Summary The molecular mechanism underlying the effect of Long intergenic non-protein coding RNA 470 (LINC00470) on chronic myelocytic leukaemia by reducing the PTEN stability via RNA methyltransferase METTL3, thus leading to the inhibition of cell autophagy while promoting chemoresistance in CML.
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [241]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Pathway Response Gastric cancer hsa05226
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
GES-1 Normal Homo sapiens CVCL_EQ22
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
Response Summary Long intergenic non-protein coding RNA 470 (LINC00470)-METTL3-mediated PTEN mRNA degradation relied on the m6A reader protein YTHDF2-dependent pathway.LINC00470 served as a therapeutic target for Gastric cancer patients.
Nuclear paraspeckle assembly transcript 1 (NEAT1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 1.39E+00
p-value: 3.32E-29
More Results Click to View More RNA-seq Results
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [242]
Responsed Disease Chronic myeloid leukaemia [ICD-11: 2B33.2]
Target Regulation Up regulation
Cell Process Cell viability and apoptosis
In-vitro Model
 BV-173 Chronic myelogenous leukemia Homo sapiens CVCL_0181
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KCL-22 Chronic myelogenous leukemia Homo sapiens CVCL_2091
MEG-01 Chronic myelogenous leukemia Homo sapiens CVCL_0425
Response Summary METTL3-mediated m6A modification induced the aberrant expression of Nuclear paraspeckle assembly transcript 1 (NEAT1) in chronic myelocytic leukemia. Overexpression of NEAT1 inhibited cell viability and promoted the apoptosis of chronic myelocytic leukemia cells. miR-766-5p was upregulated in CML PBMCs and abrogated the effects of NEAT1 on cell viability and apoptosis of the chronic myelocytic leukemia cells.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [371]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation Up regulation
In-vitro Model
 BEAS-2B Normal Homo sapiens CVCL_0168
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1650 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1483
In-vivo Model BALB/c male nude mice aged 6 weeks were randomly divided into two groups (n = 5 / group). A549 cells with transfection of sh-NC or sh-NEAT1 were injected into mice. After 28 days, the mice were euthanized and the tumor tissues were collected and measured.
microRNA 186 (MIR186)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: 8.42E-01
p-value: 2.96E-03
More Results Click to View More RNA-seq Results
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [243]
Responsed Disease Hepatoblastoma [ICD-11: 2C12.01]
Target Regulation Down regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Cell aggressive
In-vitro Model
 HCCLM9 Adult hepatocellular carcinoma Homo sapiens CVCL_A5CU
HEK293 Normal Homo sapiens CVCL_0045
Hepa 1-6 Hepatocellular carcinoma of the mouse Mus musculus CVCL_0327
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HuH-6 Hepatoblastoma Homo sapiens CVCL_4381
In-vivo Model Cells transfected with miR-186 overexpression lentivirus (Lenti-miR-186), miR-186 inhibitor (Lenti-anti-miR-186), Lenti-miR-186 & METTL3 overexpression plasmid (Lenti-METTL3), Lenti-anti-miR-186 & METTL3 shRNA (sh-METTL3) or empty lentivirus control (Lenti-NC) were subcutaneously injected into the lower flank of nude mice.
Response Summary microRNA 186 (MIR186)/METTL3 axis contributed to the progression of Hepatoblastoma via the Wnt/beta-catenin signalling pathway.
microRNA 221 (MIR221)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line DKO-1 cell line Homo sapiens
Treatment: METTL3 knockdown DKO-1 cell
Control: DKO-1 cell
 GSE182382
Regulation
logFC: 2.60E+00
p-value: 1.63E-02
More Results Click to View More RNA-seq Results
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [244]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Cell Process Cell proliferation
In-vitro Model
 EJ (Human bladder cancer cells)
T24 Bladder carcinoma Homo sapiens CVCL_0554
In-vivo Model About 1× 107 cells were injected subcutaneously into the axilla of the female athymic BALB/C nude mice (4-6 weeks old, 18-22 g, five mice per group).
Response Summary METTL3 has an oncogenic role in bladder cancer through interacting with the microprocessor protein DGCR8 and positively modulating the microRNA 221 (MIR221) process in an m6A-dependent manner.
Cardiomegaly [ICD-11: BC45]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [381]
Responsed Disease Cardiomegaly [ICD-11: BC45]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model
 NRCMs (Primary neonatal rat cardiomyocytes (NRCMs)NRCMs were prepared from the hearts of 2- to 3-day-old SD rats according to the following protocol)
In-vivo Model The pump was prefilled with Ang-II or saline and then incubated in sterile saline at 37 ℃ for 48 h. After the mice were anesthetized with 3.0% isoflurane mixed with oxygen, an incision was made on the back skin of the mice, and the pump was implanted into the subcutaneous area, followed by suturing the incision. After the operation, the mice were given buprenorphine (0.1 mg/kg) to reach analgesia. Finally, the regaining consciousness mice were returned to cages and fed until the end of the experiment.
Response Summary METTL3 positively modulates the pri-miR-221/222 maturation process in an m6A-dependent manner and subsequently activates Wnt/Beta-catenin signaling by inhibiting DKK2, thus promoting Ang-II-induced cardiac hypertrophy.
microRNA 335 (MIR335)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Mouse testis Mus musculus
Treatment: Mettl3 knockout mouse testis
Control: Mouse testis
 GSE99771
Regulation
logFC: 5.81E+00
p-value: 4.09E-06
More Results Click to View More RNA-seq Results
Acute ischemic stroke [ICD-11: 8B11]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [245]
Responsed Disease Acute ischemic stroke [ICD-11: 8B11]
Target Regulation Up regulation
Cell Process RNA maturation
Cell apoptosis
In-vitro Model
 PC-12 Lung papillary adenocarcinoma Homo sapiens CVCL_S979
In-vivo Model After a median incision on the neck, the left common carotid artery (CCA), internal carotid artery (ICA), and external carotid artery (ECA) were isolated. The left CCA and the ECA were ligated.
Response Summary METTL3-mediated m6A methylation increases the maturation of microRNA 335 (MIR335), which promotes SG formation and reduces the apoptosis level of injury neurons and cells, and provides a potential therapeutic strategy for acute ischemic stroke.
microRNA 370 (MIR370)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Embryonic stem cells Mus musculus
Treatment: METTL3 knockout mESCs
Control: Wild type mESCs
 GSE156481
Regulation
logFC: -4.78E+00
p-value: 3.06E-02
More Results Click to View More RNA-seq Results
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [56]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Pathway Response Transcriptional misregulation in cancer hsa05202
Cell Process Epithelial-mesenchymal transition
Cell autophagy
In-vitro Model
 Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
In-vivo Model To create the xenograft neoplasm system, 40 male BALB/c nude mice aged 5 weeks were randomly separated into sh-NC, sh-circHPS5, sh-circHPS5+CTRL, and sh-circHPS5+SAH groups (n = 5 for each group). HCC cells were subcutaneously injected into the axilla of the nude mice.
Response Summary In hepatocellular carcinoma, METTL3 could direct the formation of circHPS5, and specific m6A controlled the accumulation of circHPS5. YTHDC1 facilitated the cytoplasmic output of circHPS5 under m6A modification. CircHPS5 can act as a microRNA 370 (MIR370) sponge to regulate the expression of HMGA2 and further accelerate hepatocellular carcinoma cell tumorigenesis.
miR-182
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: 3.78E+00
p-value: 3.86E-02
More Results Click to View More RNA-seq Results
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [197]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
In-vitro Model
 WPMY-1 Normal Homo sapiens CVCL_3814
VCaP Prostate carcinoma Homo sapiens CVCL_2235
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
DU145 Prostate carcinoma Homo sapiens CVCL_0105
Response Summary METTL3 promoted cell proliferation, migration, invasion and tumorigenesis in PCa. METTL3 upregulating the level of m6A, and interacted with DGCR8 to recognize the m6A modification of pre-miR-182 to regulate its splicing and maturation and promote the high expression of miRNA.
miR-503
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MDA-MB-231 Homo sapiens
Treatment: METTL3 knockdown MDA-MB-231 cells
Control: MDA-MB-231 cells
 GSE70061
Regulation
logFC: 1.48E+00
p-value: 8.87E-04
More Results Click to View More RNA-seq Results
Injury of heart [ICD-11: NB31]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [246]
Responsed Disease Myocardial injury [ICD-11: NB31.Z]
Target Regulation Up regulation
Cell Process Mitochondrial metabolic dysfunction
In-vivo Model To generate an AMI mouse model, mice were anesthetised by intraperitoneal injection of sterile pentobarbital sodium at 50 mg/kg body weight.
Response Summary Hypoxia induced rapid H3K4 methylation of the promoter of the methyltransferase-like 3 gene (METTL3) and resulted in its overexpression. METTL3 overexpression evokes N6-methyladenosine (m6A)-dependent miR-503 biogenesis in endothelial cells. In summary, this study highlights a novel endogenous mechanism wherein EVs aggravate myocardial injury during the onset of AMI via endothelial cell-secreted miR-503 shuttling.
hsa-miR-26b
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Mouse testis Mus musculus
Treatment: Mettl3 knockout mouse testis
Control: Mouse testis
 GSE99771
Regulation
logFC: 6.72E+00
p-value: 1.75E-06
More Results Click to View More RNA-seq Results
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [57]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Down regulation
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 MDA-MB-468 Breast adenocarcinoma Homo sapiens CVCL_0419
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
In-vivo Model Eighteen BALB/C female nude mice aged 4-5 weeks and weighing 15-18 g were randomly assigned into three groups of six mice. The MCF-7 cell lines stably transfected with sh-NC + oe-NC, sh-METTL3 + oe-NC and sh-METTL3 + oe-HMGA2 were selected for subcutaneous establishment of the BC cell line MCF-7 as xenografts in the nude mice. For this purpose, MCF-7 cell lines in the logarithmic growth stage were prepared into a suspension with a concentration of about 1 × 107 cells/ml. The prepared cell suspension was injected into the left armpit of the mice, and the subsequent tumor growth was recorded.
Response Summary Silencing METTL3 down-regulate MALAT1 and HMGA2 by sponging hsa-miR-26b, and finally inhibit EMT, migration and invasion in BC, providing a theoretical basis for clinical treatment of BC.
Cyclin-dependent kinase inhibitor 2A (CDKN2A)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 7.42E+00 GSE60213
Mature T-cell lymphoma [ICD-11: 2A90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [247]
Responsed Disease Mature T-cell lymphoma [ICD-11: 2A90]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
Response Summary The decline in METTL3 levels was responsible for CTCL cell proliferation and migration,Cyclin-dependent kinase inhibitor 2A (CDKN2A) was a key regulator during this process in vitro and in vivo, and insufficient methylation modification blocked the interaction between CDKN2A and m6A reader IGF2BP2, resulting in mRNA degradation.
Cytochrome P450 2C8 (CYP2C8)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 4.67E+00 GSE60213
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [248]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
Pathway Response Drug metabolism - cytochrome P450 hsa00982
Cell Process Drug-metabolizing
In-vitro Model
 HepaRG Hepatitis C infection Homo sapiens CVCL_9720
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Response Summary In the Hepatocellular carcinoma cells YTHDC2 promotes CYP2C8 mRNA degradation via recognizing the m6A in CYP2C8 mRNA, which is installed by METTL3/14 and removed by FTO.
Differentiation antagonizing non-protein coding RNA (DANCR)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 9.97E+00 GSE60213
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [249]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 U2OS Osteosarcoma Homo sapiens CVCL_0042
SJSA-1 Osteosarcoma Homo sapiens CVCL_1697
SaOS-2 Osteosarcoma Homo sapiens CVCL_0548
MG-63 Osteosarcoma Homo sapiens CVCL_0426
HOS Osteosarcoma Homo sapiens CVCL_0312
hFOB 1.19 Normal Homo sapiens CVCL_3708
Response Summary METTL3 contributes to OS progression by increasing Putative uncharacterized protein DANCR (DANCR) mRNA stability via m6A modification, meaning that METTL3 is a promising therapeutic target for OS treatment.
Keratin, type II cytoskeletal 7 (KRT7)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.21E+00 GSE60213
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [137]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Cell Process Lung Metastasis
In-vitro Model
 MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
BT-549 Invasive breast carcinoma Homo sapiens CVCL_1092
In-vivo Model First, subcutaneous transplanted model was used to evaluate the growth of BT-549LMF3 and BT-549 cells. Cells (5 × 106 per mouse, n = 5 for each group) were diluted in 200 ul PBS + 200 ul Matrigel (BD Biosciences) and subcutaneously injected into immunodeficient female mice. Second, subcutaneous transplanted model was used to evaluate the metastasis potential of BT-549LMF3 and BT-549 cells. Cells (5 × 106 per mouse, n = 5 for each group) were diluted in 200 ul PBS + 200 ul Matrigel (BD Biosciences) and subcutaneously injected into immunodeficient female mice. Third, the in vivo lung metastasis model was established by injecting with BT-549, BT-549LMF3, FTO stable BT-549LMF3, sh-METTL3 BT-549LMF3, and sh-KRT7 BT-549LMF3 stable cells (1 × 106 per mouse, n = 5 for each group).
Response Summary Specifically, increased METTL3 methylated KRT7-AS at A877 to increase the stability of a KRT7-AS/Keratin, type II cytoskeletal 7 (KRT7) mRNA duplex via IGF2BP1/HuR complexes. m6A promotes breast cancer lung metastasis by increasing the stability of a KRT7-AS/KRT7 mRNA duplex and translation of KRT7.
L-glutamine amidohydrolase (GLS2)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 5.89E+00 GSE60213
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [250]
Responsed Disease Esophageal squamous cell carcinoma [ICD-11: 2B70.1]
Target Regulation Up regulation
Cell Process Cell migration
Cell invasion
In-vitro Model
 HEEC cell line (Normal esophageal epithelial cell line)
TE-1 Esophageal squamous cell carcinoma Homo sapiens CVCL_1759
TE-13 Esophageal squamous cell carcinoma Homo sapiens CVCL_4463
Eca-109 Esophageal squamous cell carcinoma Homo sapiens CVCL_6898
EC/CUHK1 Esophageal carcinoma Homo sapiens CVCL_RY08
Response Summary L-glutamine amidohydrolase (GLS2) as a downstream target of METTL3. These findings uncover METTL3/GLS2 signaling as a potential therapeutic target in antimetastatic strategies against esophageal Squamous Cell Carcinoma(ESCC).
Monocyte chemotactic and activating factor (CCL2)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 4.91E+00 GSE60213
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [251]
Responsed Disease Nonalcoholic steatohepatitis [ICD-11: DB92.1]
Target Regulation Down regulation
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model Mettl3flox/flox and Mettl3-HKO mice were fasted overnight and then injected intraperitoneally with 20 uM BODIPY FL C16 in 200 ul saline for 20 min.
Response Summary Mechanistically, METTL3 directly binds to the promoters of the Cd36 and Monocyte chemotactic and activating factor (CCL2) genes and recruits HDAC1/2 to induce deacetylation of H3K9 and H3K27 in their promoters, thus suppressing Cd36 and Ccl2 transcription. METTL3 negatively regulates hepatic Cd36 and Ccl2 gene transcription via a histone modification pathway for protection against Nonalcoholic steatohepatitis(NASH) progression.
Multidrug resistance-associated protein 1 (MRP1/ABCC1)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.47E+00 GSE60213
Gastrointestinal stromal tumor [ICD-11: 2B5B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [252]
Responsed Disease Gastrointestinal stromal tumour [ICD-11: 2B5B]
Responsed Drug Imatinib Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
In-vivo Model For tumor growth assay, 4 × 106 logarithmically growing GIST cells were transfected with T1S-vector, T1S-METTL3, 882S-vector, or 882S-METTL3 constructs, and subcutaneously injected in 100 ul of PBS into the flank of female nude mice(4-week-old). Mice were then randomly divided into 8 groups (n = 5 in each group): (1) injected with T1S-vector-harboring cells, and treated with imatinib (600 mg/l in drinking water); (2) injected with T1S-vector-harboring cells, and treated with imatinib (600 mg/l in drinking water) and MRP1 inhibitor (100 mg/l in drinking water); (3) injected with T1S-METTL3-harboring cells, and treated with imatinib (600 mg/l in drinking water); (4) injected with T1S-METTL3-harboring cells, and treated with imatinib (600 mg/l in drinking water) and MRP1 inhibitor (100 mg/l in drinking water); (5) injected with 882S-vector-harboring cells and treated with imatinib (600 mg/l in drinking water); (6) injected with 882S-vector-harboring cells, and treated with imatinib (600 mg/l in drinking water) and MRP1 inhibitor (100 mg/l in drinking water); (7) injected with 882S-METTL3-harboring cells, and treated with imatinib (600 mg/l in drinking water); and (8) injected with 882S-METTL3-harboring cells, and treated with imatinib (600 mg/l in drinking water) and MRP1 inhibitor (100 mg/l in drinking water).
Response Summary METTL3, and the YTHDF1/eEF-1 complex mediate the translation of Multidrug resistance-associated protein 1 (MRP1/ABCC1) mRNA in an m6A-dependent manner to regulate the intracellular concentration of imatinib and drug resistance of gastrointestinal stromal tumor (GIST).
Protein kinase C epsilon (PRKCE)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 3.25E+00 GSE60213
Ischemic heart disease [ICD-11: BA40-BA6Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [253]
Responsed Disease Ischemic heart disease [ICD-11: BA40-BA6Z]
Target Regulation Down regulation
Cell Process Pyroptosis
In-vitro Model
 H9c2(2-1) Normal Rattus norvegicus CVCL_0286
In-vivo Model The thoracic cavity of rats was exposed, and the left anterior descending coronary artery was ligated with a 6-0 silk thread. Successfully surgical MI could be observed, with myocardium color fading and pulse weakening. After 30 min of ischemia, the blood flow was restored by releasing the slipknot, and then 120-min perfusion was performed. Afterward, the thoracic cavity of rats was sutured. The rats were assigned into 4 groups, with 12 rats in each group. Lentivirus packaged short hairpin (sh)-negative control (NC) and sh-METTL3 (GenePharma, Shanghai, China) were injected into the rats via tail vein 24 h before operation. The titer of lentivirus was 1 × 109 TU/mL, and the injection rate was 0.2 ul/min for 10 min. Blood samples were collected 24 h after reperfusion.
Response Summary METTL3 promoted DGCR8 binding to pri-miR-143-3p through m6A modification, thus enhancing miR-143-3p expression to inhibit Protein kinase C epsilon (PRKCE) transcription and further aggravating cardiomyocyte pyroptosis and MI/R injury.
Sphingosine kinase 2 (SPHK2)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.82E+00 GSE60213
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [190]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
Cell invasion
Response Summary METTL3 promotes translation of Sphingosine kinase 2 (SPHK2) mRNA via an m6A-YTHDF1-dependent manner. Functionally, SPHK2 facilitates GC cell proliferation, migration and invasion by inhibiting KLF2 expression.
Suppressor of cytokine signaling 4 (SOCS4)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.78E+00 GSE60213
Thyrotoxicosis [ICD-11: 5A02]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [225]
Responsed Disease Graves disease [ICD-11: 5A02.0]
Target Regulation Down regulation
In-vitro Model
 PBMCs (Human peripheral blood mononuclear cells (PBMCs) are isolated from peripheral blood and identified as any blood cell with a round nucleus)
Response Summary METTL3 knock-down experiment revealed that expressions of SOCS family members SOCS1, SOCS2, Suppressor of cytokine signaling 4 (SOCS4), SOCS5, and SOCS6 were increased after METTL3 knock-down. It indicated that METTL3 is involved in the development of Graves' disease (GD) by inducing mRNA m6A methylation modification of SOCS family members.
Suppressor of cytokine signaling 6 (SOCS6)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.24E+00 GSE60213
Thyrotoxicosis [ICD-11: 5A02]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [225]
Responsed Disease Graves disease [ICD-11: 5A02.0]
Target Regulation Down regulation
In-vitro Model
 PBMCs (Human peripheral blood mononuclear cells (PBMCs) are isolated from peripheral blood and identified as any blood cell with a round nucleus)
Response Summary METTL3 knock-down experiment revealed that expressions of SOCS family members SOCS1, SOCS2, SOCS4, SOCS5, and Suppressor of cytokine signaling 6 (SOCS6) were increased after METTL3 knock-down. It indicated that METTL3 is involved in the development of Graves' disease (GD) by inducing mRNA m6A methylation modification of SOCS family members.
Transforming growth factor beta-1 proprotein (TGFB1)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.56E+00 GSE60213
Solid tumour/cancer [ICD-11: 2A00-2F9Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [235]
Responsed Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Target Regulation Up regulation
Pathway Response Adherens junction hsa04520
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Response Summary The expression of Transforming growth factor beta-1 proprotein (TGFB1) was up-regulated, while self-stimulated expression of TGFbeta1 was suppressed in METTL3Mut/- cells. m6A performed multi-functional roles in TGFbeta1 expression and EMT modulation, suggesting the critical roles of m6A in cancer progression regulation. Snail, which was down-regulated in Mettl3Mut/- cells, was a key factor responding to TGF-Beta-1-induced EMT.
Vasopressin V2 receptor (Avpr2/V2R)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 4.52E+00 GSE60213
Polycystic kidney disease [ICD-11: GB81]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [82]
Responsed Disease Polycystic kidney disease [ICD-11: GB81]
Target Regulation Up regulation
In-vitro Model
 mIMCD-3 Normal Mus musculus CVCL_0429
In-vivo Model The clone, with one wild-type Mettl3 allele and one L1L2_Bact_P cassette inserted allele, was injected into C57BL/6 blastocysts. Mettl3-targeted mouse line was established from a germline-transmitting chimera. The chimeric mouse was crossed to C57BL/6 Flp mice to excise the neomycin resistance system.
Response Summary Mettl3 activates the cyst-promoting c-Myc and cAMP pathways through enhanced c-Myc and Vasopressin V2 receptor (Avpr2/V2R) mRNA m6A modification and translation. Thus, Mettl3 promotes Autosomal dominant polycystic kidney disease and links methionine utilization to epitranscriptomic activation of proliferation and cyst growth.
LINC00035 (ABHD11-AS1)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 5.94E+00 GSE60213
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [254]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Up regulation
Pathway Response Central carbon metabolism in cancer hsa05230
In-vitro Model
 NCI-H1650 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1483
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
BEAS-2B Normal Homo sapiens CVCL_0168
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
In-vivo Model H1299 cells were transfected with sh-ABHD11-AS1 and harvested from six-well plates, then resuspended at a density 1 × 107 cells/ml. Mice were subsequently injected with 100 uL suspension at the right flank. After injection, tumor weight and length were examined every 3 days.
Response Summary LINC00035 (ABHD11-AS1) was upregulated in NSCLC tissue specimens and cells and the ectopic overexpression was closely correlated with unfavorable prognosis of NSCLC patients.METTL3 installed the m6 A modification and enhanced ABHD11-AS1 transcript stability to increase its expression.
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [364]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
In-vitro Model
 HCoEpiC (Healthy colon epithelial HCoEpiC cells)
HEK293T Normal Homo sapiens CVCL_0063
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HT-29 Colon adenocarcinoma Homo sapiens CVCL_0320
In-vivo Model Harvested cells were resuspended in PBS and each side of mouse was injected about 1 × 106 cells. Tumor volume was estimated every four days and calculated as 0.5 × length × width2.
Acute ischemic stroke [ICD-11: 8B11]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [365]
Responsed Disease Acute ischemic stroke [ICD-11: 8B11]
Target Regulation Up regulation
LOC10013.776 (AGAP2-AS1)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 6.67E+00 GSE60213
Psoriasis [ICD-11: EA90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [255]
Responsed Disease Psoriasis [ICD-11: EA90]
Target Regulation Up regulation
Pathway Response mTOR signaling pathway hsa04150
PI3K-Akt signaling pathway hsa04151),
Cell Process Cell proliferation
In-vitro Model
 HaCaT Normal Homo sapiens CVCL_0038
NHEK (Normal human epithelial keratinocytes)
Response Summary METTL3 resulted in the upregulation of AGAP2-AS1 in psoriasis. LOC10013.776 (AGAP2-AS1) is upregulated in the skin tissue of psoriasis patients and m6A methylation was involved in its upregulation.
Long intergenic non-protein coding RNA 1273 (LINC01273)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 7.26E+00 GSE60213
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [256]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Sorafenib Approved
 Drug Info 
Target Regulation Down regulation
In-vitro Model
 SMMC-7721 Endocervical adenocarcinoma Homo sapiens CVCL_0534
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Response Summary Long intergenic non-protein coding RNA 1273 (LINC01273) was modified with m6A, METTL3 increased LINC01273 m6A modification, followed by LINC01273 decay in the presence of YTHDF2, a m6A 'reader'. And LINC01273 plays a key role in sorafenib resistant HCC cells.
Long intergenic non-protein coding RNA 460 (LINC00460)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 6.69E+00 GSE60213
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [176]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response mRNA surveillance pathway hsa03015
Cell Process mRNA stability
Epithelial-mesenchymal transition
In-vitro Model
 DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
FHC Normal Homo sapiens CVCL_3688
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HEK293T Normal Homo sapiens CVCL_0063
HT29 Colon cancer Mus musculus CVCL_A8EZ
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model Groups of HCT116-Luc-shCtrl, HCT116-Luc-shLINC00460, and HCT116-Luc-shLINC00460 + HMGA1 cells (5 × 106) were injected subcutaneously into the flanks of mice correspondingly.
Response Summary Long intergenic non-protein coding RNA 460 (LINC00460) is a novel oncogene of colorectal cancer through interacting with IGF2BP2 and DHX9 and bind to the m6A modified HMGA1 mRNA to enhance the HMGA1 mRNA stability. The N6-methyladenosine (m6A) modification of HMGA1 mRNA by METTL3 enhanced HMGA1 expression in CRC.
Maternally expressed 3 (MEG3)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 6.64E+00 GSE60213
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [257]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Down regulation
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
THLE-3 Normal Homo sapiens CVCL_3804
Response Summary Maternally expressed 3 (MEG3) regulates the expression of BTG2 through miR-544b, thus affecting the malignant behavior of hepatocellular carcinoma. METTL3 regulates the m6A modification of MEG3 and its expression.
NIFK antisense RNA 1 (NIFK-AS1)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 7.43E+00 GSE60213
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [258]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Sorafenib Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
THLE-3 Normal Homo sapiens CVCL_3804
In-vivo Model For the PDX model, fresh patient HCC tissues were cut into fragments with a volume of 3 × 3 mm3 and then implanted subcutaneously into the flanks of nude mice. The mice were given sorafenib (30 mg/kg) or vehicle orally twice a week for 24 days. This procedure was approved by the Ethics Committee of Jinling Hospital.
Response Summary Identified the lncRNA NIFK antisense RNA 1 (NIFK-AS1) as being highly expressed in hepatocellular carcinoma tissues and cells, promotes disease progression and sorafenib resistance, and showed this up-regulation resulted from METTL3-dependent m6A methylation.
Pvt1 oncogene (PVT1)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.16E+01 GSE60213
Kidney failure [ICD-11: GB6Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [146]
Responsed Disease Kidney failure [ICD-11: GB6Z]
Target Regulation Up regulation
In-vitro Model
 NIT-1 Insulin tumor Mus musculus CVCL_3561
Response Summary m6A modification is co-regulated by METTL3 and FTO in cadmium-treated cells. LncRNA-MALAT1, Pvt1 oncogene (PVT1) and m6A modification could be key nodes for cadmium-induced oxidative damage, and highlight their importance as promising preventive and therapeutic targets in cadmium toxicity.
Small nucleolar RNA host gene 3 (SNHG3)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.17E+00 GSE60213
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [259]
Responsed Disease Esophageal cancer [ICD-11: 2B70]
Responsed Drug Pt Investigative
 Drug Info 
Target Regulation Up regulation
Cell Process Cellular Processes
Cell growth and death
Cell apoptosis
In-vitro Model
 Eca-9706 (Esophageal carcinoma cell line)
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
In-vivo Model Used 1 × 106 SNHG3 knocked down KY-SE150 cells and NC lentivirus to inject into the right flank of mice to generate xenografts.
Response Summary Platinum can increase the overall m6A level of esophageal cancer. Small nucleolar RNA host gene 3 (SNHG3)/miR-186-5p, induced by platinum, was involved in regulating m6A level by targeting METTL3. miR-186-5p binds to the 3'UTR of METTL3 to inhibit its expression. Our manuscript has provided clues that regulating m6A level was a novel way to enhance the platinum efficacy.
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [375]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Melanoma [ICD-11: 2C30]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [376]
Responsed Disease Melanoma [ICD-11: 2C30]
In-vitro Model
 A-375 Amelanotic melanoma Homo sapiens CVCL_0132
SK-MEL-28 Cutaneous melanoma Homo sapiens CVCL_0526
In-vivo Model A375 cells (1 × 107) transfected with sh-METTL3 or shNC lentiviruses were subcutaneously injected into the right flank of the mice. After 33 days, the mice were sacrificed and the xenografted tumors were collected for immunohistochemistry analysis. Animal experiments were approved by the Ethics Committee of Shanghai East Hospital (K-KYSB-2020-0).
SVIL antisense RNA 1 (SVIL-AS1)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 9.54E+00 GSE60213
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [260]
Responsed Disease Lung cancer [ICD-11: 2C25]
Target Regulation Up regulation
In-vitro Model
 NCI-H1650 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1483
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
In-vivo Model A549 cells (1 × 106 cells) were intraperitoneally injected into the abdomen of nude mice. Tumor length and width were measured and recorded every 4 days after inoculation. Tumor volume was calculated as 1/2 × length × width2. The tumor weight was weighed and recorded 20 days after inoculation.
Response Summary The reduction in cell proliferation induced by SVIL antisense RNA 1 (SVIL-AS1) overexpression could be rescued by E2F1 overexpression or METTL3 knockdown. In conclusion, METTL3-induced SVIL-AS1 in LUAD, which connects m6A and lncRNA in lung cancer carcinogenesis.
X inactive specific transcript (XIST)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.31E+00 GSE60213
Ossification of spinal ligaments [ICD-11: FA83]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [261]
Responsed Disease Ossification of spinal ligaments [ICD-11: FA83]
Target Regulation Up regulation
Pathway Response Ubiquitin mediated proteolysis hsa04120
Cell Process Ubiquitination degradation
In-vitro Model
 Human primary ligament fibroblasts (Ligaments were dissected from a non-ossified site)
Response Summary METTL3 regulates ossification of the posterior longitudinal ligament via the lncRNA X inactive specific transcript (XIST)/miR-302a-3p/USP8 axis.
ZNFX1 antisense RNA 1 (ZFAS1)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 3.61E+00 GSE60213
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [262]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation
Cell migration
Cell autophagy
In-vitro Model
 SUNE1 Nasopharyngeal carcinoma Homo sapiens CVCL_6946
S26 Nasopharyngeal carcinoma Homo sapiens CVCL_B0UB
S18 Nasopharyngeal carcinoma Homo sapiens CVCL_B0U9
NP69 (A human immortalized nasopharyngeal epithelial)
N2Tert (The human immortalized nasopharyngeal epithelial cell lines)
HONE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_8706
HNE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_0308
NPC/HK1 Nasopharyngeal carcinoma Homo sapiens CVCL_7084
CNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_6889
CNE-1 Normal Homo sapiens CVCL_6888
C666-1 Nasopharyngeal carcinoma Homo sapiens CVCL_7949
6-10B Nasopharyngeal carcinoma Homo sapiens CVCL_C529
In-vivo Model Female BALB/c nude mice (ages 4-5 weeks, 18-20 g) were purchased from the Charles River Laboratories. For the tumor growth model, 1 × 106 HONE-1 sh-NC or sh-ZFAS1 cells were injected into the axilla of the mice, and the tumor size was measured every 3 days. On day 30, the mice were killed, and the tumors were dissected and weighed.
Response Summary Knockout of METTL3 can reduce the total expression of ZNFX1 antisense RNA 1 (ZFAS1). ZFAS1 is used as an oncogenic lncRNA, which can promote NPCcell proliferation, migration and tumor growth.
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [263]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
Ca Ski Cervical squamous cell carcinoma Homo sapiens CVCL_1100
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
In-vivo Model Nude mice were subjected to a subcutaneous injection of 5× 106 control and ZFAS1 silencing CaSki cells suspended in 0.2 mL DMEM medium.
Response Summary ZNFX1 antisense RNA 1 (ZFAS1) sequestered miR-647, and this RNA-RNA interaction is regulated by METLL3-mediated m6A modification in cervical cancer.
Apoptotic chromatin condensation inducer in the nucleus (ACIN1)
 Target Gene 
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [269]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Up regulation
Pathway Response mRNA surveillance pathway hsa03015
RNA degradation hsa03018
Cell Process RNA stability
In-vitro Model
 SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
End1/E6E7 Normal Homo sapiens CVCL_3684
In-vivo Model 2 × 106 stably transfected HeLa cells were subcutaneously inoculated into the left flank of mice.
Response Summary METTL3 interacts with IGF2BP3 to promote the mRNA stability of Apoptotic chromatin condensation inducer in the nucleus (ACIN1), the overexpression of which induces the aggressiveness of CC cells.
Axin-1 (AXIN1)
 Target Gene 
Disorders of refraction [ICD-11: 9D00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [272]
Responsed Disease Disorders of refraction [ICD-11: 9D00.0]
Target Regulation Down regulation
In-vitro Model
RF/6A
 N.A. Macaca mulatta CVCL_4552
Bax inhibitor 1 (TMBIM6)
 Target Gene 
Pre-eclampsia [ICD-11: JA24]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [273]
Responsed Disease Pre-eclampsia [ICD-11: JA24]
Target Regulation Down regulation
In-vitro Model
 HTR-8/SVneo Normal Homo sapiens CVCL_7162
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (BNIP3)
 Target Gene 
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [271]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Bone morphogenetic protein 2 (BMP2)
 Target Gene 
Ossification of spinal ligaments [ICD-11: FA83]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [274]
Responsed Disease Ossification of spinal ligaments [ICD-11: FA83]
Target Regulation Up regulation
Low bone mass disorder [ICD-11: FB83]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [275]
Responsed Disease Osteoporosis [ICD-11: FB83.1]
Class E basic helix-loop-helix protein 41 (BHLHE41)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [280]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Cytokine-cytokine receptor interaction hsa04060
Chemokine signaling pathway hsa04062
Cell Process Cell immunity
Cell growth
Cell migration
In-vitro Model
 CT26 Mouse colon adenocarcinoma Mus musculus CVCL_7254
MC-38 Mouse colon adenocarcinoma Mus musculus CVCL_B288
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model METTL3 knockout or control CT26 and MC38 cells were injected subcutaneously into the dorsal flank of each 4- to 6-week-old male immunocompetent BALB/c and C57BL/6 mice, respectively. Anti-Gr-1 (BE0075; Bio-X-Cell, Lebanon, NH) or immunoglobulin (Ig)G isotype control (BE0090, Bio-XCell) was given every other day via intraperitoneal injection (150 ug/mouse). SB-265610 (Tocris, Bristol, UK) or phosphate-buffered saline was administrated through intraperitoneal injections at a dosage of 2 mg/kg per day. Tumor sizes were measured every other day. To establish an orthotopic mouse model of CRC, 5- to 6-week-old male C57BL/6 mice were treated with 1.7% dextran sodium sulfate in drinking water for 5 days, and then allowed to recover for 3 days. After 24 hours of fasting, METTL3 knockout or control MC38 cells suspended in 50 ul of 1 mg/mL Matrigel-phosphate-buffered saline (Corning, Corning, NY) were instilled into the colon lumen of anesthetized mice, coated sparingly with Vaseline.
Response Summary METTL3 promoted Class E basic helix-loop-helix protein 41 (BHLHE41) expression in m6A-dependent manner, which subsequently induced CXCL1 transcription to enhance MDSC migration in vitro. METTL3 as a potential therapeutic target for CRC immunotherapy whose inhibition reverses immune suppression through m6A-BHLHE41-CXCL1 axis.
Cytokine-responsive protein CR6 (GADD45-Gamma)
 Target Gene 
Endocrine glands benign cancer [ICD-11: 2F37]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [285]
Responsed Disease Endocrine glands benign cancer [ICD-11: 2F37]
Target Regulation Up regulation
Response Summary METTL3 promotes tumor growth and hormone secretion by increasing expression of GNAS and Cytokine-responsive protein CR6 (GADD45-Gamma) in a m6A-dependent manner. Thus, METTL3 and the methylated RNAs constitute suitable targets for clinical treatment of Pituitary growth hormone-secreting-pituitary adenomas(GH-PAs).
DNA-binding protein inhibitor ID-2 (ID2)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [288]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
In-vitro Model
 PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
HPDE6c7 Normal Homo sapiens CVCL_0P38
Panc02 Mouse pancreatic ductal adenocarcinoma Mus musculus CVCL_D627
In-vivo Model For the subcutaneous tumor model, cells from the treatment group and the control group (1 × 107) were subcutaneously injected into the right groin of BALB/c nude mice (4-6 weeks old, 18-20 g, 4 mice each). Both the treatment group and control group had 5 BALB/c nude mice each. After 21 days, all mice were sacrificed and tumor volume and weight were measured. For the pancreatic cancer in situ tumor model, mice were anesthetized with Avertin at a dose of 0.2 ml/10 g body weight, and 5 × 105 panc2 treatment group cells and control group cells were injected into the pancreas of mice respectively, and the abdomen was closed for disinfection. Both the treatment group and control group had 5 C57 mice each. After 21 days, the mice were sacrificed, the in-situ tumor was removed, and the volume and weight were measured for subsequent experiments.
E3 ubiquitin-protein ligase TRIM11 (TRIM11)
 Target Gene 
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [14]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Down regulation
Pathway Response ABC transporters hsa02010
Wnt signaling pathway hsa04310
Ubiquitin mediated proteolysis hsa04120
Cell Process Ubiquitination degradation
In-vitro Model
 CNE-1 Normal Homo sapiens CVCL_6888
CNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_6889
In-vivo Model A total of 2 × 106 cells was mixed with 0.2 ml PBS (pH 7.4) and 30% (v/v) Matrigel matrix (BD Biosciences).
Response Summary TRIM11 regulates nasopharyngeal carcinoma drug resistance by positively modulating the Daple/beta-catenin/E3 ubiquitin-protein ligase TRIM11 (TRIM11) signaling pathway. TRIM11 enhanced the multidrug resistance in NPC by inhibiting apoptosis in vitro and promoting cisplatin (DDP) resistance in vivo. METTL3-mediated m6A modification caused the upregulation of TRIM11 via IGF2BP2 in NPC drug-resistant cells.
Eukaryotic translation initiation factor 2 subunit 1 (EIF2S1/eIF2-Alpha)
 Target Gene 
Pulmonary hypertension [ICD-11: BB01]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [292]
Responsed Disease Pulmonary arterial hypertension [ICD-11: BB01.0]
Target Regulation Up regulation
In-vivo Model Adult male Sprague-Dawley (150-200 g in body weight) rats were randomly divided into control or MCT/vehicle rats. Experimental rats were administered an intraperitoneal injection of monocrotaline (60 mg/kg, Sigma, 315-22-0), and their littermates were injected with saline. For GSK2606414 treatment, rats that underwent monocrotaline treatment were treated either with vehicle or GSK2606414 (10 mg/kg, Sigma, 1,337,531-89-1) by intraperitoneal injection per day. GSK2606414 was dissolved in a mixture of dimethyl sulfoxide (DMSO): polyethylene glycol (PEG) 400: distilled water (1: 4: 5). After 4 weeks, RV systolic blood pressure (RVSP) was measured with pressure transducers under anesthesia. The RV hypertrophy was analyzed as a ratio of RV to left ventricular and septal weight. Left lung tissues were fixed in 4% paraformaldehyde solution for the following histology staining; right lung tissues and pulmonary arteries were excised and immediately frozen in liquid nitrogen for other experiments.
GTPase KRas (KRAS)
 Target Gene 
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [295]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Up regulation
In-vitro Model
 Ca Ski Cervical squamous cell carcinoma Homo sapiens CVCL_1100
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
In-vivo Model Subcutaneous xenograft model in nude mice: Each group of HeLa cells was prepared as a cell suspension at a concentration of 2 × 107/mL.
Guanine nucleotide-binding protein G (GNAS)
 Target Gene 
Endocrine glands benign cancer [ICD-11: 2F37]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [285]
Responsed Disease Endocrine glands benign cancer [ICD-11: 2F37]
Target Regulation Up regulation
Response Summary METTL3 promotes tumor growth and hormone secretion by increasing expression of Guanine nucleotide-binding protein G (GNAS) and GADD45-Gamma in a m6A-dependent manner. Thus, METTL3 and the methylated RNAs constitute suitable targets for clinical treatment of Pituitary growth hormone-secreting-pituitary adenomas(GH-PAs).
Histone H2AX (H2AX)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [297]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
In-vivo Model A549 cells (3 × 105 cells in 200 μl PBS) were subcutaneously injected into the nude mice to establish tumors. When the tumors had grown to almost 100 mm3, a 5-GyE dosage of carbon-ion irradiation was applied and the mice were examined every 3 days, then sacrificed 30 days after the injection.
Interleukin-1 beta (IL1B)
 Target Gene 
Abortion [ICD-11: JA00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [304]
Responsed Disease Abortion [ICD-11: JA00.09]
Target Regulation Up regulation
In-vitro Model
Swan 71
 N.A. Homo sapiens CVCL_D855
HTR-8/SVneo Normal Homo sapiens CVCL_7162
In-vivo Model Pregnant C57/BL6 were randomly assigned into four groups (each n = 10): (1) corn oil group, (2) BaP group, (3) BaP +AS-NC group, (4) BaP +AS-hz06 group.
Lactate dehydrogenase A (LDHA)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [305]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response HIF-1 signaling pathway hsa04066
Glycolysis / Gluconeogenesis hsa00010
Cell Process Glycolysis
In-vitro Model
 HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model For subcutaneous transplanted model, sh-control and sh-METTL3 HCT-116/5-FU cells (5 × 106 per mouse) were diluted in 100ul PBS + 100 ul Matrigel (BD Biosciences, San Jose, CA, USA) and injected subcutaneously in the rear flank fat pad of the nude mice.
Response Summary METTL3 enhances the expression of Lactate dehydrogenase A (LDHA), which catalyzes the conversion of pyruvate to lactate, to trigger glycolysis and 5-FU resistance. METTL3/LDHA axis-induced glucose metabolism is a potential therapy target to overcome 5-FU resistance in CRC cells.
Male infertility [ICD-11: GB04]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [306]
Responsed Disease Male infertility [ICD-11: GB04]
Responsed Drug MICROCYSTIN-LR Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
TM4
 N.A. Mus musculus CVCL_4327
Mammalian target of rapamycin complex 2 (mTORC2)
 Target Gene 
Endometrial cancer [ICD-11: 2C76]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [94]
Responsed Disease Endometrial cancer [ICD-11: 2C76]
Target Regulation Down regulation
Cell Process Cell proliferation and tumorigenicity
In-vitro Model
 HEC-1-A Endometrial adenocarcinoma Homo sapiens CVCL_0293
RL95-2 Endometrial adenosquamous carcinoma Homo sapiens CVCL_0505
T HESCs Normal Homo sapiens CVCL_C464
In-vivo Model 4×106 HEC-1-A endometrial cancer cells (shCtrl, shMETTL3, wild-type, METTL14+/-, or METTL14+/- rescued with wild-type or mutant METTL14) were injected intraperitoneally into 5 week old female athymic nude mice (Foxn1nu, Harlan; n=10 per group).
Response Summary About 70% of endometrial tumours exhibit reductions in m6A methylation that are probably due to either this METTL14 mutation or reduced expression of METTL3. Reductions in m6A methylation lead to decreased expression of the negative AKT regulator PHLPP2 and increased expression of the positive AKT regulator Mammalian target of rapamycin complex 2 (mTORC2). these results reveal reduced m6A mRNA methylation as an oncogenic mechanism in endometrial cancer and identify m6A methylation as a regulator of AKT signalling.
Mitogen-activated protein kinase 1 (MAPK/ERK2/MAPK1)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [308]
Responsed Disease Brain cancer [ICD-11: 2A00]
Target Regulation Up regulation
In-vitro Model
 LN-229 Glioblastoma Homo sapiens CVCL_0393
U-251MG Astrocytoma Homo sapiens CVCL_0021
Platelet glycoprotein 4 (CD36)
 Target Gene 
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [251]
Responsed Disease Nonalcoholic steatohepatitis [ICD-11: DB92.1]
Target Regulation Down regulation
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model Mettl3flox/flox and Mettl3-HKO mice were fasted overnight and then injected intraperitoneally with 20 uM BODIPY FL C16 in 200 ul saline for 20 min.
Response Summary Mechanistically, METTL3 directly binds to the promoters of the Platelet glycoprotein 4 (CD36) genes and recruits HDAC1/2 to induce deacetylation of H3K9 and H3K27 in their promoters, thus suppressing Cd36 and Ccl2 transcription. METTL3 negatively regulates hepatic Cd36 and Ccl2 gene transcription via a histone modification pathway for protection against Nonalcoholic steatohepatitis(NASH) progression.
Protein crumbs homolog 3 (CRB3)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [323]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
Pathway Response Hippo signaling pathway hsa04390
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
 FHC Normal Homo sapiens CVCL_3688
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
Response Summary m6A and METTL3 levels were substantially elevated in colorectal carcinoma(CRC) tissues, METTL3 knockdown substantially reduced the m6A level of Protein crumbs homolog 3 (CRB3), and inhibited the degradation of CRB3 mRNA to increase CRB3 expression. METTL3 regulated the progression of CRC by regulating the m6A-CRB3-Hippo pathway.
Protein FAM83D (FAM83D)
 Target Gene 
Triple-negative breast cancer [ICD-11: 2C6Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [324]
Responsed Disease Triple-negative breast cancer [ICD-11: 2C6Z]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model
 MCF-10A Normal Homo sapiens CVCL_0598
MDA-MB-468 Breast adenocarcinoma Homo sapiens CVCL_0419
BT-549 Invasive breast carcinoma Homo sapiens CVCL_1092
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
HEK293T Normal Homo sapiens CVCL_0063
Protein patched homolog 1 (PTCH1)
 Target Gene 
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [325]
Responsed Disease Esophageal cancer [ICD-11: 2B70]
Target Regulation Up regulation
In-vitro Model
TE1
 N.A. Mus musculus CVCL_C6K3
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
KYSE-410 Esophageal squamous cell carcinoma Homo sapiens CVCL_1352
CVCL_E307 Esophageal squamous cell carcinoma Homo sapiens CVCL_E307
HET-1A Normal Homo sapiens CVCL_3702
In-vivo Model Nude mice were assigned into four groups (control, sh-NC + LV-NC, sh-METTL3 + LV-NC, and sh-METTL3 + LV-PTCH1) by the random number table method with six mice per group. After nude mice were anesthetized by intraperitoneal injection of sodium pentobarbital (60 mg/kg), the right dorsal skin was routinely disinfected with iodophor. The control mice were injected with untreated KYSE-30 cell suspensions (1 × 106 cells), and the remaining three groups were injected with equal amounts of transfected KYSE-30 cell suspensions (1 × 106 cells). After injection, the syringe was slowly withdrawn and the injection site was gently pressed with an alcohol cotton ball for 10 s to prevent cell suspension from flowing out. Ten days later, tumor volumes were measured every 3 days.
Putative pituitary tumor-transforming gene 3 protein (PTTG3P)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [326]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
Pathway Response Hippo signaling pathway hsa04390
Cell Process Cell proliferation and suppression of apoptosis
In-vitro Model
 FHC Normal Homo sapiens CVCL_3688
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
HT29 Colon cancer Mus musculus CVCL_A8EZ
NCM460 Normal Homo sapiens CVCL_0460
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model Indicated cells (1 × 107) were subcutaneously injected into 4-week-old male nude mice. Tumor volume was measured every 5 days.
Response Summary In colorectal cancer, n6-methyladenosine (m6A) subunit METTL3 increased PTTG3P expression by influencing its stability, while insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2) could identify Putative pituitary tumor-transforming gene 3 protein (PTTG3P) m6A methylation status and bind to it.
RAD51-associated protein 1 (RAD51AP1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [327]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Fluorouracil Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
Response Summary METTL3 augmented 5 FU induced DNA damage and overcame 5 FU resistance in HCT 8R cells, which could be mimicked by inhibition of RAD51-associated protein 1 (RAD51AP1). The present study revealed that the METTL3/RAD51AP1 axis plays an important role in the acquisition of 5 FU resistance in CRC.
Runt-related transcription factor 2 (Runx2)
 Target Gene 
Maxillofacial bone defect is a critical obstacle for maxillofacial tumors and periodontal diseases. [ICD-11: NA02]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [329]
Responsed Disease Maxillofacial bone defect is a critical obstacle for maxillofacial tumors and periodontal diseases. [ICD-11: NA02]
Target Regulation Up regulation
Secreted frizzled-related protein 2 (SFRP2)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [330]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation Down regulation
Serine/threonine-protein kinase PINK1, mitochondrial (PINK1)
 Target Gene 
Chronic kidney disease [ICD-11: GB61]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [332]
Responsed Disease Diabetic nephropathy [ICD-11: GB61.Z]
Target Regulation Down regulation
In-vitro Model
 HK-2 [Human kidney] Normal Homo sapiens CVCL_0302
In-vivo Model Five week old male C57bl/6 mice (20 ± 2 g) were divided into the DKD model group and the control group. The fasting blood glucose of all the mice was measured before the experiment, and was required to be less than 7 mmol/L. The mice in the DKD model group were fed with a high-fat and high-sugar diet for 8 weeks. Then, 1 day after restoring the high-fat and high-sugar diet, the mice in the DKD model group were fasted for 16 h and injected with STZ at 50 mg/kg per day for 5 days. The fasting blood glucose was measured 2 weeks after the last injection. If the fasting blood glucose was greater than 16 mmol/L, the medium-term diabetes model had been established successfully. Then, the rat urine was collected and the ratio of urinary albumin to urinary muscle intoxication (AIb/Cr) was measured. The AIb/Cr was greater than 30 mg/g, indicating a diagnosis of DKD. The mice in the control group received standard chow and were injected with the same amount of normal saline. Subsequently, all DKD mice were randomly divided into the sh-NC group and the sh-METTL3 group. After establishment of the DKD model, the lentiviruses carrying sh-NC or sh-METTL3 (MOI = 50) were injected into the caudal vein at a dose of 1 μg/g according to the weight of mice, once a week for 8 weeks.
Serum response factor (SRF)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [333]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Responsed Drug Tislelizumab Approved
 Drug Info 
In-vitro Model
 U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
Staphylococcal nuclease domain-containing protein 1 (SND1)
 Target Gene 
Nasal-type natural killer/T-cell lymphoma [ICD-11: XH3400]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [336]
Responsed Disease Nasal-type natural killer/T-cell lymphoma [ICD-11: XH3400]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 NK-92 Natural killer cell lymphoblastic leukemia/lymphoma Homo sapiens CVCL_2142
YTS Lymphoblastic leukemia/lymphoma Homo sapiens CVCL_D324
SNT-8 Nasal type extranodal NK/T-cell lymphoma Homo sapiens CVCL_A677
SNK-6 Nasal type extranodal NK/T-cell lymphoma Homo sapiens CVCL_A673
In-vivo Model A total of 32 nude mice were randomly divided into four groups with eight mice in each group. Nude mice were subcutaneously injected with 2 × 106 cells (suspended in 100 μl of PBS) transfected with NC shRNA or SND1 shRNA into the back flank of mice. In DDP administration group, DDP (3 mg/kg per week for 2 weeks) was intraperitoneally injected into mice every 3 days. The control group received 200 μl of 0.1% DMSO. The tumor volume was measured every week for a total of 4 weeks. The mice were sacrificed after 4 weeks, then the tumors were harvested for weight measurement and other analysis. The tumor volume (mm3) was estimated with the formula (0.5 × length × width2).
Sterol regulatory element-binding protein 1 (SREBF1)
 Target Gene 
Acute kidney failure [ICD-11: GB60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [338]
Responsed Disease Acute kidney failure [ICD-11: GB60]
In-vitro Model
 HK-2 [Human kidney] Normal Homo sapiens CVCL_0302
Suppressor of cytokine signaling 1 (SOCS1)
 Target Gene 
Thyrotoxicosis [ICD-11: 5A02]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [225]
Responsed Disease Graves disease [ICD-11: 5A02.0]
Target Regulation Down regulation
In-vitro Model
 PBMCs (Human peripheral blood mononuclear cells (PBMCs) are isolated from peripheral blood and identified as any blood cell with a round nucleus)
Response Summary METTL3 knock-down experiment revealed that expressions of SOCS family members Suppressor of cytokine signaling 1 (SOCS1), SOCS2, SOCS4, SOCS5, and SOCS6 were increased after METTL3 knock-down. It indicated that METTL3 is involved in the development of Graves' disease (GD) by inducing mRNA m6A methylation modification of SOCS family members.
Pain disorders [ICD-11: 8E43]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [340]
Responsed Disease Neuropathic pain [ICD-11: 8E43.0]
Suppressor of cytokine signaling 3 (SOCS3)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [341]
Responsed Disease Liver cancer [ICD-11: 2C12]
Responsed Drug Colivelin Investigative
 Drug Info 
Diabetic [ICD-11: 5A14]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [342]
Responsed Disease Diabetic [ICD-11: 5A14]
Target Regulation Up regulation
In-vitro Model
 HUVEC-C Normal Homo sapiens CVCL_2959
Paraneoplastic or autoimmune disorders of the nervous system [ICD-11: 8E4A]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [343]
Responsed Disease Paraneoplastic or autoimmune disorders of the nervous system [ICD-11: 8E4A.1]
Target Regulation Down regulation
Chronic obstructive pulmonary disease [ICD-11: CA22]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [344]
Responsed Disease Chronic obstructive pulmonary disease [ICD-11: CA22]
Responsed Drug Cycloleucine Investigative
 Drug Info 
Target Regulation Down regulation
Human skin lesions [ICD-11: ME60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [345]
Responsed Disease Human skin lesions [ICD-11: ME60]
Responsed Drug Arsenite Phase 2
 Drug Info 
Target Regulation Down regulation
Pathway Response JAK-STAT signaling pathway hsa04630
In-vitro Model
 HaCaT Normal Homo sapiens CVCL_0038
Suppressor of cytokine signaling 5 (SOCS5)
 Target Gene 
Thyrotoxicosis [ICD-11: 5A02]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [225]
Responsed Disease Graves disease [ICD-11: 5A02.0]
Target Regulation Down regulation
In-vitro Model
 PBMCs (Human peripheral blood mononuclear cells (PBMCs) are isolated from peripheral blood and identified as any blood cell with a round nucleus)
Response Summary METTL3 knock-down experiment revealed that expressions of SOCS family members SOCS1, SOCS2, SOCS4, Suppressor of cytokine signaling 5 (SOCS5), and SOCS6 were increased after METTL3 knock-down. It indicated that METTL3 is involved in the development of Graves' disease (GD) by inducing mRNA m6A methylation modification of SOCS family members.
Transferrin receptor protein 1 (TFRC)
 Target Gene 
Intracerebral hemorrhage [ICD-11: 8B00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [354]
Responsed Disease Intracerebral hemorrhage [ICD-11: 8B00]
Target Regulation Up regulation
In-vitro Model
 PC12 Rat adrenal gland pheochromocytoma Rattus norvegicus CVCL_0481
In-vivo Model For ICH model establishment, the mice in the ICH group were intraperitoneally injected with 2% sodium pentobarbital (0.2 mL/100 g body weight). Subsequently, the mice were routinely sterilized, skin prepared and fixed on a brain stereotaxic apparatus. Then 0.2 units of collagenase 4 were injected into the left caudate putamen (0.8 mm posterior to the bregma, 3.5 mm lateral to the left, and 5.5 mm deep). The sham-operated control group was injected with an equal volume of normal saline. For METTL3 knockdown, the mice were intravenously injected with sh-METTL3 or sh-NC (1×109 plaque forming unit).
Tumor necrosis factor receptor superfamily member 6 (FAS)
 Target Gene 
Preeclampsia [ICD-11: JA23]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [355]
Responsed Disease Preeclampsia [ICD-11: JA23]
Target Regulation Up regulation
In-vitro Model
 HTR-8/SVneo Normal Homo sapiens CVCL_7162
Wnt inhibitory factor 1 (WIF1)
 Target Gene 
Endometriosis [ICD-11: GA10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [358]
Responsed Disease Endometriosis [ICD-11: GA10]
Target Regulation Up regulation
DBH antisense RNA 1 (Lnc_DBH-AS1)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [359]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Responsed Drug Gemcitabine Approved
 Drug Info 
In-vitro Model
 MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
HPDE Normal Homo sapiens CVCL_4376
CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
Canpan-2 (Pancreatic cancer cell line)
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
AsPC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
Response Summary DBH antisense RNA 1 (Lnc_DBH-AS1) expression in pancreatic cancer(PC) was found to be linked to the METTL3-dependent m6A methylation of the lncRNA. MechanisticallyDBH-AS1 was able to increase PC cell sensitivity to gemcitabine by sequestering miR-3163 and thus upregulating USP44 in these tumor cells.
Growth arrest specific 5 (GAS5)
 Target Gene 
Vascular disorders of the liver [ICD-11: DB98]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [360]
Responsed Disease Vascular disorders of the liver [ICD-11: DB98.8]
Target Regulation Down regulation
In-vivo Model The in vivo assay was approved by the Animal Care and Use Committee of Anhui Medical University. And all experimental procedures and animal care were in accordance with the institutional ethics guidelines for animal experiments. The C57BL/6 mice (male, 8-10 weeks old) were housed (six per cage) in a specific and opportunistic pathogen-free facility and maintained on a 12-hlight-dark cycle with casually access to food and water. Detailed descriptions of the cell culture, cardiac fibrosis model, and treatment with lentiviral, were given in the Supplementary methods online.
HOXD antisense growth-associated long non-coding RNA (HAGLR)
 Target Gene 
Pre-eclampsia [ICD-11: JA24]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [361]
Responsed Disease Pre-eclampsia [ICD-11: JA24]
Target Regulation Up regulation
In-vitro Model
 HTR-8/SVneo Normal Homo sapiens CVCL_7162
KCNQ1 opposite strand/antisense transcript 1 (KCNQ1OT1)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [362]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Doxil Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 MCF-10A Normal Homo sapiens CVCL_0598
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
LIFR antisense RNA 1 (LIFR-AS1)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [363]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation and metastasis
Response Summary METTL3 induced m6A hyper-methylation on the 3' UTR of LIFR antisense RNA 1 (LIFR-AS1) to enhance its mRNA stability and LIFR-AS1 could directly interact with miR-150-5p, thereby indirectly up-regulating VEGFA expressions within cells. A noval m6A-LIFR-AS1 axis promotes pancreatic cancer progression at least in part via regulation of the miR-150-5p/VEGFA axis, indicating that this regulatory axis can be a viable clinical target for the treatment of pancreatic cancer.
Long intergenic non-protein coding RNA 2598 (LINC02598/RP11)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [366]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Ubiquitin mediated proteolysis hsa04120
Cell Process Ubiquitination degradation
In-vitro Model
 HCT 15 Colon adenocarcinoma Homo sapiens CVCL_0292
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
NCM460 Normal Homo sapiens CVCL_0460
Response Summary Overexpression of METTL3 upregulates Long intergenic non-protein coding RNA 2598 (LINC02598/RP11) expression in colorectal cancer cells. Overexpression of ALKBH5 downregulates RP11 expression.
Long intergenic non-protein coding RNA 680 (LINC00680)
 Target Gene 
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [199]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Target Regulation Up regulation
In-vitro Model
 Chondrocytes (Chondrocytes were isolated from human cartilage and cultured)
Response Summary m6A-mediated Long intergenic non-protein coding RNA 680 (LINC00680) regulates the proliferation and ECM degradation of chondrocytes through LINC00680/m6A/SIRT1 mRNA axis. METTL3-mediated LINC00680 accelerates osteoarthritis(OA) progression, which provides novel understanding of the role of m6A and lncRNA in OA.
Small nucleolar RNA host gene (SNHG7)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [372]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
In-vitro Model
 GES-1 Normal Homo sapiens CVCL_EQ22
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [373]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
Pathway Response Central carbon metabolism in cancer hsa05230
Glycolysis / Gluconeogenesis hsa00010
Cell Process Glycolysis
In-vitro Model
 VCaP Prostate carcinoma Homo sapiens CVCL_2235
RWPE-1 Normal Homo sapiens CVCL_3791
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
DU145 Prostate carcinoma Homo sapiens CVCL_0105
Response Summary METTL3-stabilized lncRNA Small nucleolar RNA host gene (SNHG7) accelerates glycolysis in PCa via SRSF1/c-Myc axis and inspires the understanding of m6A roles in lncRNA metabolism and tumor progression.
microRNA 1246 (MIR1246)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [220]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
Cell Process Cell migration and invasion
In-vitro Model
 Caco-2 Colon adenocarcinoma Homo sapiens CVCL_0025
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
NCM460 Normal Homo sapiens CVCL_0460
HT29 Colon cancer Mus musculus CVCL_A8EZ
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
In-vivo Model The spleen in the upper left lateral abdomen of the anesthetized mice were exposed, 106 cells suspended in 20 uL phosphate-buffered saline (PBS) were injected into the distal tip of the spleen. After injection, replacing the spleen, and closing the incision.
Response Summary METTL3/microRNA 1246 (MIR1246)/SPRED2 axis plays an important role in tumor metastasis and provides a new m6A modification pattern in Colorectal cancer development.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [91]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
Cell invasion
Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
In-vivo Model The 40 nude mice of each large group were classified into 8 small groups (n = 5) and subcutaneously injected with transfected cell suspension in the back (5 × 106 cells/mL/mouse). The length and width of tumors were recorded every 4 days, and the tumor volume = (length × width2)/2. The tumor growth curve was thereby graphed. On the 28th day of injection, mice were euthanized by neck dislocation, and the xenografts were harvested, photographed, and weighed.
Response Summary METTL3 regulates the m6A modification to promote the maturation of microRNA 1246 (MIR1246), which targets PEG3 to participate in occurrence and development of non-small cell lung cancer.
microRNA 126 (MIR126)
 Target Gene 
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [377]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation Up regulation
In-vitro Model
 Mono-Mac-6 Adult acute monocytic leukemia Homo sapiens CVCL_1426
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model Cells were collected from the CD45.2 Ythdf2fl/flMx1-Cre mice, enriched for lin-population, and transduced with retroviral MA9 alone or retroviral MA9 + MSCV-pre-miR-126/MSCV-pre-miR-Control by spinoculation as described before. Clonal cells from CFA assays were washed and suspended together with healthy mouse BM cells (0.5 million CFA cells + 1 million healthy BM per mouse) with ice-cold PBS, and subsequently injected via the tail vein into lethally (900 rads) irradiated 8 to 10-week-old B6.SJL (CD45.1) recipient mice. Ten days after the injection, knockout was induced by i.p. delivering of poly I:C (428750 R&D Systems) at 300 μg each time per mice every other day for five times. Mice were observed regularly after cell injection and samples were collected at the end point.
Endometriosis [ICD-11: GA10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [378]
Responsed Disease Endometriosis [ICD-11: GA10]
Target Regulation Up regulation
In-vitro Model
 HESC (Human endometrial stromal cells)
Response Summary The METTL3/m6A/miR126 pathway, whose inhibition contributes to endometriosis development by enhancing cellular migration and invasion.
microRNA 1305 (MIR1305)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [379]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
Cell Process Reverse splicing and biogenesis
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model Mice were randomly divided into three groups, and subcutaneously injected with control, circ-ARL3-silenced and circ-ARL3&miR-1305-silenced HepG2.2.15 cells.
Response Summary Circ-ARL3 is a critical regulator in HBV-related HCC, targeting the axis of circ-ARL3/microRNA 1305 (MIR1305) can be a promising treatment for HBV+ HCC patients. HBx protein upregulated N6 -methyladenosine (m6A) methyltransferases METTL3 expression, increasing the m6A modification of circ-ARL3; then, m6A reader YTHDC1 bound to m6 A-modified of circ-ARL3 and favored its reverse splicing and biogenesis. Furthermore, circ-ARL3 was able to sponge miR-1305, antagonizing the inhibitory effects of miR-1305 on a cohort of target oncogenes, thereby promoting HBV+ HCC progression.
microRNA 150 (MIR150)
 Target Gene 
Pain disorders [ICD-11: 8E43]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [380]
Responsed Disease Neuropathic Pain [ICD-11: 8E43.0]
Target Regulation Up regulation
In-vitro Model
 RN-sc (The rat neuron cell line RN-sc was purchased from ScienCell)
In-vivo Model Based on our study design, the enrolled animals were blindingly grouped and received the following treatments: (1)Sham-NC vectors, (2)Sham-sh-METTL3, (3)Sham-sh-METTL3 + miR-150, (4)Sham-sh-METTL3 + Lv-YTHDF2, (5)Sham-sh-METTL3 + sh-BDNF, (6)Sham-anti-miR150, (7)Sham-anti-miR150+sh-BDNF, (8)SNI-Lv-METTL3, (9)SNI-Lv-METTL3 + anti-miR-150, (10)SNI-Lv-METTL3 + sh-YTHDF2, (11)SNI-Lv-METTL3 + Lv-BDNF, (12)SNI-miR150, (13)SNI-miR150+Lv-BDNF. The pain behaviors were detected in the respective time points and the expressions of METTL3 and miR-150 were determined at day 14 after the rats were sacrificed.
Response Summary Enhanced METTL3 promoted the m6A methylation in total RNAs and inhibited neuropathic pain (NP) progression. Mechanistically, METTL3 accelerated microRNA 150 (MIR150) maturation via mediating m6A methylation of primiR-150 at locus 498, cooperating with the "m6A reader" YTHDF2. Therefore, the METTL3/miR-150/BDNF pathway is a promising therapeutic target for NP patients.
microRNA 222 (MIR222)
 Target Gene 
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [244]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Cell Process Cell proliferation
In-vitro Model
 EJ (Human bladder cancer cells)
T24 Bladder carcinoma Homo sapiens CVCL_0554
In-vivo Model About 1× 107 cells were injected subcutaneously into the axilla of the female athymic BALB/C nude mice (4-6 weeks old, 18-22 g, five mice per group).
Response Summary METTL3 has an oncogenic role in bladder cancer through interacting with the microprocessor protein DGCR8 and positively modulating the microRNA 222 (MIR222) process in an m6A-dependent manner.
Cardiomegaly [ICD-11: BC45]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [381]
Responsed Disease Cardiomegaly [ICD-11: BC45]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model
 NRCMs (Primary neonatal rat cardiomyocytes (NRCMs)NRCMs were prepared from the hearts of 2- to 3-day-old SD rats according to the following protocol)
In-vivo Model The pump was prefilled with Ang-II or saline and then incubated in sterile saline at 37 ℃ for 48 h. After the mice were anesthetized with 3.0% isoflurane mixed with oxygen, an incision was made on the back skin of the mice, and the pump was implanted into the subcutaneous area, followed by suturing the incision. After the operation, the mice were given buprenorphine (0.1 mg/kg) to reach analgesia. Finally, the regaining consciousness mice were returned to cages and fed until the end of the experiment.
Response Summary METTL3 positively modulates the pri-miR221/pri-miR-222 maturation process in an m6A-dependent manner and subsequently activates Wnt/Beta-catenin signaling by inhibiting DKK2, thus promoting Ang-II-induced cardiac hypertrophy.
microRNA 25 (MIR25)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [382]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
HPDE6c7 Normal Homo sapiens CVCL_0P38
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
In-vivo Model Mice (five in each group) were injected subcutaneously with 0.1 ml of cell suspension containing 2 × 106 cells in the back flank.
Response Summary Cigarette smoke-induced microRNA 25 (MIR25) excessive maturation via m6A modification promotes the development and progression of pancreatic cancer. This modification is catalyzed by overexpressed methyltransferase-like 3 (METTL3) due to hypomethylation of the METTL3 promoter also caused by CSC.
microRNA 675 (MIR675)
 Target Gene 
Gastrointestinal stromal tumor [ICD-11: 2B5B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [383]
Responsed Disease Gastrointestinal stromal tumor [ICD-11: 2B5B]
In-vitro Model
 GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
In-vivo Model The GIST-T1 cells were injected into the back flanks of the C57BL/6 female mice (Age six-week-old) at the concentration of 1 × 106 cells diluting in 200 μl PBS buffer solution. The GIST-T1 cells were allowed to grow in mice for a total of 25 days, the mice were sacrificed at day 25 and the tumors were obtained and weighed to evaluate the tumorigenesis abilities of the GIST-T1 cells in vivo.
microRNA 93 (MIR93)
 Target Gene 
Emphysema [ICD-11: CA21]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [160]
Responsed Disease Emphysema [ICD-11: CA21]
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
Response Summary METTL3-mediated formation of EV microRNA 93 (MIR93), facilitated by m6A, is implicated in the aberrant cross-talk of epithelium-macrophages, indicating that this process is involved in the smoking-related emphysema. EV miR-93 was used as a novel risk biomarker for CS-induced emphysema. MiR-93 activated the JNK pathway by targeting dual-specificity phosphatase 2 (DUSP2), which elevated the levels of matrix metalloproteinase 9 (MMP9) and matrix metalloproteinase 12 (MMP12) and induced elastin degradation, leading to emphysema.
microRNA let-7b (MIRLET7B)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [384]
Responsed Disease Lung cancer [ICD-11: 2C25]
Responsed Drug Osimertinib Approved
 Drug Info 
Pathway Response Notch signaling pathway hsa04330
In-vitro Model
 NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
H1975OR (Osimertinib resistant H1975 cells)
HCC827OR (Osimertinib resistant HCC827 cells)
Response Summary The participation of Metformin decreased the bindings of DNMT3a/b to the METTL3 promoter with the help of the readers of NKAP and HNRNPA2B1.the mediation of m6A formation on pri-Let-7b processing increased the mature microRNA let-7b (MIRLET7B), whose key role is to suppress the Notch signaling and to re-captivate the Osimertinib treatment.The findings open up future drug development, targeting this pathway for lung cancer patients.
microRNA let-7g (MIRLET7G)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [214]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Down regulation
Cell Process Cell differentiation and apoptosis
Glutamine metabolism
Apoptosis (hsa04210)
Response Summary HBXIP up-regulates METTL3 by suppressing microRNA let-7g (MIRLET7G), in which METTL3 increased HBXIP expression forming a positive feedback loop of HBXIP/let-7g/METTL3/HBXIP, leading to accelerated cell proliferation in breast cancer.
hsa-miR-126-5p
 Target Gene 
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [385]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
Cell invasion
Response Summary METTL3 promoted the maturation of hsa-miR-126-5p via the m6A modification of pri-miR-126-5p. Finally, in vitro and in vivo experiments substantiated that silencing of METTL3 impeded the progression and tumorigenesis of ovarian cancer by impairing the miR-126-5p-targeted inhibition of PTEN and thus blocking the PI3K/Akt/mTOR pathway.
Chondropathies [ICD-11: FB82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [198]
Responsed Disease Chondropathies [ICD-11: FB82]
Target Regulation Up regulation
Cell Process RNA mature
In-vitro Model
 Cartilage cells (From the cartilage tissue samples from patients)
Response Summary Interleukin 1-beta (IL-1-beta) is an important inducer of cartilage degeneration that can induce an inflammatory cascade reaction in chondrocytes and inhibit the normal biological function of cells. METTL3 could regulate hsa-miR-126-5p maturation, we first confirmed that METTL3 can bind the key protein underlying pri-miRNA processing, DGCR8. Additionally, when METTL3 expression was inhibited, the miR-126-5p maturation process was blocked.
hsa-miR-140-3p
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [148]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
Response Summary METTL3/SNHG1/hsa-miR-140-3p/UBE2C axis plays a crucial role in cancer progression and the immune response in non-small cell lung cancer.
hsa-miR-143-3p
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [386]
Responsed Disease Lung cancer [ICD-11: 2C25]
Target Regulation Down regulation
Pathway Response RNA degradation hsa03018
Cell Process RNA splicing
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
In-vivo Model For subcutaneous transplanted model, control and miR-143-3p stable A549 cells (5 × 106 per mouse, n = 5 for each group) were diluted in 200 uL PBS + 200 uL Matrigel (BD Biosciences) and subcutaneously injected into immunodeficient mice to investigate tumor growth.
Response Summary m6A methyltransferase Mettl3 can increase the splicing of precursor hsa-miR-143-3p to facilitate its biogenesis. The miR-143-3p/VASH1 axis in BM of lung cancers and suggests their critical roles in lung cancer pathogenesis.
Ischemic heart disease [ICD-11: BA40-BA6Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [253]
Responsed Disease Ischemic heart disease [ICD-11: BA40-BA6Z]
Target Regulation Up regulation
Cell Process Pyroptosis
In-vitro Model
 H9c2(2-1) Normal Rattus norvegicus CVCL_0286
In-vivo Model The thoracic cavity of rats was exposed, and the left anterior descending coronary artery was ligated with a 6-0 silk thread. Successfully surgical MI could be observed, with myocardium color fading and pulse weakening. After 30 min of ischemia, the blood flow was restored by releasing the slipknot, and then 120-min perfusion was performed. Afterward, the thoracic cavity of rats was sutured. The rats were assigned into 4 groups, with 12 rats in each group. Lentivirus packaged short hairpin (sh)-negative control (NC) and sh-METTL3 (GenePharma, Shanghai, China) were injected into the rats via tail vein 24 h before operation. The titer of lentivirus was 1 × 109 TU/mL, and the injection rate was 0.2 ul/min for 10 min. Blood samples were collected 24 h after reperfusion.
Response Summary METTL3 promoted DGCR8 binding to pri-miR-143-3p through m6A modification, thus enhancing hsa-miR-143-3p expression to inhibit PRKCE transcription and further aggravating cardiomyocyte pyroptosis and MI/R injury.
Asthma [ICD-11: CA23]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [387]
Responsed Disease Asthma [ICD-11: CA23]
Target Regulation Up regulation
In-vitro Model
 16HBE14o- Normal Homo sapiens CVCL_0112
hsa-miR-146a-5p
 Target Gene 
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [201]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Responsed Drug Melittin Investigative
 Drug Info 
Target Regulation Up regulation
Cell Process miRNA maturation
Cell apoptosis
In-vitro Model
 T24 Bladder carcinoma Homo sapiens CVCL_0554
SV-HUC-1 Normal Homo sapiens CVCL_3798
EJ (Human bladder cancer cells)
BIU-87 Human bladder cancer cells Homo sapiens CVCL_6881
In-vivo Model For melittin treatment study, 4-week-old female BALB/c nude mice were subcutaneously injected with 1 × 107 T24 or BIU87 cells.
Response Summary METTL3 acts as a fate determinant that controls the sensitivity of bladder cancer cells to melittin treatment. Moreover, METTL3/hsa-miR-146a-5p/NUMB/NOTCH2 axis plays an oncogenic role in bladder cancer pathogenesis and could be a potential therapeutic target for recurrent bladder cancer treatment.
hsa-miR-181d-5p
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [88]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Fluorouracil Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
In-vivo Model A tumor-bearing model was established by subcutaneously injecting 100 ul HT29 cells (5×106) followed by an intravenous injection of CAFs-derived exosomes (50 ug/mouse every three days) into the tail vein of the mice. An intraperitoneal injection of 5-FU (50 mg/kg, every week) was administered on day 12.
Response Summary METTL3 dependent m6A methylation was upregulated in CRC to promote the processing of miR 181d 5p by DGCR8. This led to increased hsa-miR-181d-5p expression, which inhibited the 5 FU sensitivity of CRC cells by targeting NCALD.
hsa-miR-186-5p
 Target Gene 
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [259]
Responsed Disease Esophageal cancer [ICD-11: 2B70]
Responsed Drug Pt Investigative
 Drug Info 
Target Regulation Up regulation
Cell Process Cellular Processes
Cell growth and death
Cell apoptosis
In-vitro Model
 Eca-9706 (Esophageal carcinoma cell line)
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
In-vivo Model Used 1 × 106 SNHG3 knocked down KY-SE150 cells and NC lentivirus to inject into the right flank of mice to generate xenografts.
Response Summary Platinum can increase the overall m6A level of esophageal cancer. SNHG3/hsa-miR-186-5p, induced by platinum, was involved in regulating m6A level by targeting METTL3. miR-186-5p binds to the 3'UTR of METTL3 to inhibit its expression. Our manuscript has provided clues that regulating m6A level was a novel way to enhance the platinum efficacy.
hsa-miR-1914-3p
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [126]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Hippo signaling pathway hsa04390
Cell Process Metabolic
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Calu-6 Lung adenocarcinoma Homo sapiens CVCL_0236
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
In-vivo Model Mice were injected with 5 × 106 lung cancer cells with stably expression of relevant plasmids and randomly divided into two groups (five mice per group) after the diameter of the xenografted tumors had reached approximately 5 mm in diameter. Xenografted mice were then administrated with PBS or DDP (3 mg/kg per day) for three times a week, and tumor volume were measured every second day.
Response Summary METTL3, YTHDF3, YTHDF1, and eIF3b directly promoted YAP translation through an interaction with the translation initiation machinery. METTL3 knockdown inhibits tumor growth and enhances sensitivity to DDP in vivo.m6A mRNA methylation initiated by METTL3 directly promotes YAP translation and increases YAP activity by regulating the MALAT1-hsa-miR-1914-3p-YAP axis to induce Non-small cell lung cancer drug resistance and metastasis.
hsa-miR-1915-3p
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [102]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Down regulation
Pathway Response TNF signaling pathway hsa04668
Cell Process Cell migration
Cell invasion
Epithelial-mesenchymal transition
In-vitro Model
 NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Response Summary hsa-miR-1915-3p expression was regulated by METTL3/YTHDF2 m6A axis through transcription factor KLF4. miR-1915-3p function as a tumor suppressor by targeting SET and has an anti-metastatic therapeutic potential for lung cancer treatment.
hsa-miR-193b
 Target Gene 
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [169]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Up regulation
In-vitro Model
 SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
In-vivo Model Mice were divided into two groups (n = 4/group) randomly. 3×106 cells suspended in 200 uL PBS were administered via subcutaneous injection over the right flank region of nude mice. After the development of palpable tumors (average volume, 50 mm3), intratumoral injection of synthetic miR-193b, or negative control complexed with siPORT Amine transfection reagent (Ambion, USA) was given 6 times at a 4-day interval.
Response Summary METTL3 modulates miR-193b mature process in an m6A-dependent manner. Reintroduction of hsa-miR-193b profoundly inhibits tumorigenesis of cervical cancer cells both in vivo and in vitro through CCND1 targeting.
hsa-miR-199a-5p
 Target Gene 
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [166]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model
 hFOB 1.19 Normal Homo sapiens CVCL_3708
MG-63 Osteosarcoma Homo sapiens CVCL_0426
U2OS Osteosarcoma Homo sapiens CVCL_0042
Response Summary METTL3-mediated circNRIP1 exhibits oncogenic roles in osteosarcoma by regulating FOXC2 via sponging hsa-miR-199a-5p, which provides new ideas for the treatment of osteosarcoma.
hsa-miR-21-5p
 Target Gene 
Kidney disorders [ICD-11: GB90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [388]
Responsed Disease Kidney disorders [ICD-11: GB90]
Target Regulation Up regulation
Pathway Response NF-kappa B signaling pathway hsa04064
In-vitro Model
 HK2 Normal Acipenser baerii CVCL_YE28
In-vivo Model Each mouse was anaesthetized with inhaled isoflurane, and the left proximal ureter was exposed. Then, the ureter was ligated with 6-0 silk thread and severed. In the sham operation group, the left ureters of mice were exposed, but not ligated or severed. The 3rd, 7th and 14th days after surgery were the time points for killing. At each time point, a total of 10 mice in the UUO group were executed, and a total of 10 mice in the sham group were also executed to serve as controls.
Response Summary METTL3-m6A-miR-21-5p-SPRY1/ERK/NF-kB axis in obstructive renal fibrosis and provides a deeper understanding of renal fibrosis.
hsa-miR-221-3p
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [22]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Doxil Approved
 Drug Info 
Target Regulation Up regulation
Cell Process Cell growth and death
Cell apoptosis
In-vitro Model
 ADR-resistant MCF-7 (MCF-7/ADR) cells (Human breast cancer doxorubicin-resistant cell line)
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
In-vivo Model Cell suspensions (2 × 106 cells/mL) made with MCF-7/ADR cells stably expressing METTL3 and/or miR-221-3p inhibitor were subcutaneously implanted into each mouse. One week later, xenografted mice were injected with 0.1 mL ADR (25 mg/kg, intraperitoneal injection) twice a week.
Response Summary METTL3 promotes adriamycin resistance in MCF-7 breast cancer cells by accelerating hsa-miR-221-3p maturation in a m6A-dependent manner. METTL3 knockdown was shown to reduce the expression of miR-221-3p by reducing pri-miR-221-3p m6A mRNA methylation, reducing the expression of MDR1 and BCRP, and inducing apoptosis. Identified the METTL3/miR-221-3p/HIPK2/Che-1 axis as a novel signaling event that will be responsible for resistance of BC cells to ADR.
hsa-miR-222-3p
 Target Gene 
Thyroid Cancer [ICD-11: 2D10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [107]
Responsed Disease Thyroid Cancer [ICD-11: 2D10]
Target Regulation Up regulation
Response Summary Silencing METTL3 suppresses hsa-miR-222-3p expression and thus stimulates STK4 expression, thereby repressing the malignancy and metastasis of Thyroid Carcinoma.
hsa-miR-25-3p
 Target Gene 
Diabetes [ICD-11: 5A10-5A14]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [389]
Responsed Disease Diabetes [ICD-11: 5A10-5A14]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process Cell viability
Cell apoptosis
In-vitro Model
 ARPE-19 Normal Homo sapiens CVCL_0145
Response Summary METTL3 involves in the pathogenesis of diabetic retinopathy (DR). Both METTL3 mRNA and hsa-miR-25-3p were low-expressed in the peripheral venous blood samples of diabetes mellitus (DM) patients compared to normal volunteers, and high-glucose inhibited METTL3 and miR-25-3p expressions in RPE cells. Overexpression of METTL3 attenuates high-glucose induced RPE cell pyroptosis by regulating miR-25-3p/PTEN/Akt signaling cascade through DGCR8.
Retinopathy [ICD-11: 9B71]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [389]
Responsed Disease Diabetic retinopathy [ICD-11: 9B71.0]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process Cell viability
Cell apoptosis
In-vitro Model
 ARPE-19 Normal Homo sapiens CVCL_0145
Response Summary METTL3 involves in the pathogenesis of diabetic retinopathy (DR). Both METTL3 mRNA and hsa-miR-25-3p were low-expressed in the peripheral venous blood samples of diabetes mellitus (DM) patients compared to normal volunteers, and high-glucose inhibited METTL3 and miR-25-3p expressions in RPE cells. Overexpression of METTL3 attenuates high-glucose induced RPE cell pyroptosis by regulating miR-25-3p/PTEN/Akt signaling cascade through DGCR8.
hsa-miR-29a-3p
 Target Gene 
Acute respiratory distress syndrome [ICD-11: CB00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [390]
Responsed Disease Acute respiratory distress syndrome [ICD-11: CB00]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
In-vivo Model All the mice were randomly divided into three groups: the normal saline group (NS), the lipopolysaccharide + negative control group (LPS + NC), and the LPS + miR-29a-3p agomir group (LPS + Agomir).
Response Summary The knockout of methyltransferase 3 (N6-adenosine-methyltransferase complex catalytic subunit) removed the m6A modification of hsa-miR-29a-3p and reduced miR-29a-3p expression. These findings suggest that miR-29a-3p is a potential target that can be manipulated for ALI/ARDS.
hsa-miR-31-5p
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [157]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process Cell cycle
In-vitro Model
 BT-474 Invasive breast carcinoma Homo sapiens CVCL_0179
HCC1806 Breast squamous cell carcinoma Homo sapiens CVCL_1258
MCF-10A Normal Homo sapiens CVCL_0598
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MDA-MB-453 Breast adenocarcinoma Homo sapiens CVCL_0418
ZR-75-1 Invasive breast carcinoma Homo sapiens CVCL_0588
In-vivo Model Twelve female BALB/c nude mice (aged 4 weeks, 18-22g) were randomly divided into 2 groups. Stable circMETTL3-expression SUM1315 cells or control cells (1×106 cells in 0.1 mL PBS) was subcutaneously injected into mammary fat pads of the mice and the growth of tumors was followed up every week. Tumor volume was measured every week using a caliper, calculated as (length × width2)/2. After 4 weeks, mice were sacrificed and checked for final tumor weight.
Response Summary CircMETTL3 promotes breast cancer progression through circMETTL3/hsa-miR-31-5p/CDK1 axis.
hsa-miR-320b
 Target Gene 
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [196]
Responsed Disease Esophageal squamous cell carcinoma [ICD-11: 2B70.1]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation
Cell migration
Cell invasion
Epithelial-mesenchymal transition
In-vitro Model
 TE-1 Esophageal squamous cell carcinoma Homo sapiens CVCL_1759
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
HET-1A Normal Homo sapiens CVCL_3702
CVCL_E307 Esophageal squamous cell carcinoma Homo sapiens CVCL_E307
Eca-109 Esophageal squamous cell carcinoma Homo sapiens CVCL_6898
In-vivo Model Luciferase-labeled KYSE150 cells (5 × 106) were inoculated into the footpads of BALB/c nude mice (4-5 weeks old, 18-20 g) to establish the popliteal lymphatic metastasis model.
Response Summary METTL3 could interact with DGCR8 protein and positively modulate pri-miR-320b maturation process in an N6-methyladenosine (m6A)-dependent manner. Therefore, our findings uncover a VEGF-C-independent mechanism of exosomal and intracellular hsa-miR-320b-mediated LN metastasis and identify miR-320b as a novel predictive marker and therapeutic target for LN metastasis in ESCC.
hsa-miR-34a
 Target Gene 
Aortic aneurysm or dissection [ICD-11: BD50]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [391]
Responsed Disease Abdominal aortic aneurysm [ICD-11: BD50.4]
Target Regulation Up regulation
In-vitro Model
 VSMC (Human aortic vascular smooth muscle cells)
In-vivo Model Male C57BL/6J mice were anesthetized with an intraperitoneal injection of pentobarbital (40 mg/kg). The abdominal aorta between the renal arteries and the bifurcation of the iliac arteries was disassociated from the surrounding structures. Video microscopy was used to assay the diameter of the aorta in triplicate. After the measurements were taken, a small piece of gauze dipped in 0.5 mol/L CaCl2 was spread perivascularly onto the aortic passage for 15 min. Control mice received substitute treatment with NaCl (0.9%)-soaked gauze for 15 min. Then, the aorta was rinsed with 0.9% sterile saline, and the incision was sutured. After 3 or 6 weeks, all the animals were sacrificed, and the aortas were harvested for further analysis.
Response Summary METTL3/m6A-mediated hsa-miR-34a maturation in AAA formation and provide a novel therapeutic target and diagnostic biomarker for AAA treatment.
hsa-miR-375-3p
 Target Gene 
Atherosclerosis [ICD-11: BD40]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [392]
Responsed Disease Atherosclerosis [ICD-11: BD40.Z]
Target Regulation Up regulation
Pathway Response Focal adhesion hsa04510
In-vitro Model
 MOVAS (Mouse aortic vascular smooth muscle cell lines)
In-vivo Model The normal group consisted of C57BL/6J mice on normal diet and the HFD group consisted of ApoE C57BL/6J mice on HFD (containing 10% lard oil, 4% milk powder, 2% cholesterol, and 0.5% sodium cholate). Four weeks after HFD feeding, the mice were injected with 200 ul lentivirus containing 1 × 10-/--/-8 TU (lentivirus carrying sh-METTL3 or sh-NC; designed and constructed by GENCHEM (Shanghai, China)) via tail vein. Six weeks after transfection, all mice were euthanized by a tail vein injection of 200 mg/kg pentobarbital sodium.
Response Summary Silencing METTL3 inhibited m6A level and decreased the binding of DGCR8 to pri-miR-375 and further limited hsa-miR-375-3p expression. METTL3-mediated m6A modification promoted VSMC phenotype transformation and made Atherosclerosis (AS) plaques more vulnerable via the miR-375-3p/PDK1 axis.
hsa-miR-380-3p
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [393]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 HPDE Normal Homo sapiens CVCL_4376
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
Capan-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0026
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
AsPC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
In-vivo Model The PC cell line PANC1 was subcutaneously injected into the dorsal flank of the mice at the concentration of 1 × 106 cells per mouse.
Response Summary hsa-miR-380-3p was enriched with m6A modifications, and elimination of m6A modifications by deleting METTL3 and METTL14 synergistically suppressed miR-380-3p expressions in pancreatic cancer cells.
hsa-miR-422a
 Target Gene 
Unspecific body region injury [ICD-11: ND56]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [394]
Responsed Disease Unspecific body region injury [ICD-11: ND56]
Target Regulation Up regulation
Cell Process Neuronal cell apoptosis
In-vitro Model
 SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
Response Summary Oxygen glucose deprivation/re-oxygenation (OGD/R) induces neuronal injury via mechanisms that are believed to mimic the pathways associated with brain ischemia. METTL3 shRNA reversed OGD/R-induced Lnc-D63785 m6A methylation to decrease hsa-miR-422a accumulation.
hsa-miR-582-3p
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [395]
Responsed Disease Intrahepatic cholangiocarcinoma [ICD-11: 2C12.10]
In-vitro Model
 TFK-1 Cholangiocarcinoma Homo sapiens CVCL_2214
RBE Intrahepatic cholangiocarcinoma Homo sapiens CVCL_4896
HuH-28 Cholangiocarcinoma Homo sapiens CVCL_2955
HuCC-T1 Intrahepatic cholangiocarcinoma Homo sapiens CVCL_0324
HIBEpic (Human intrahepatic bile duct epithelial cells)
CC-LP-1 Intrahepatic cholangiocarcinoma Homo sapiens CVCL_0205
In-vivo Model To detect the effect of NKILA on CAA growth, 5 × 106 control and NKILA-depleted HuCCT1 cells (n = 4 per group) were subcutaneously injected into male BALB/c nude mice (4-6 weeks old).
Response Summary NKILA physically interacted with and suppressed hsa-miR-582-3p, which was regulated by METTL3-mediated N6 -methyladenosine (m6A) modification. YAP1 was a target of NKILA via miR-582-3p and NKILA functioned partially via YAP1 in CCA.
hsa-miR-589-5p
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [396]
Responsed Disease Liver cancer [ICD-11: 2C12]
Target Regulation Up regulation
Pathway Response Adherens junction hsa04520
Cell Process Cell migration
Cell invasion
In-vitro Model
 THLE-2 Normal Homo sapiens CVCL_3803
SNU-423 Adult hepatocellular carcinoma Homo sapiens CVCL_0366
SNU-387 Adult hepatocellular carcinoma Homo sapiens CVCL_0250
SNU-182 Adult hepatocellular carcinoma Homo sapiens CVCL_0090
SK-HEP-1 Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
PLC/PRF/5 Adult hepatocellular carcinoma Homo sapiens CVCL_0485
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model The mice were fed in an SPF environment (cycle of 12-h light and 12-h dark) with a free diet. All the mice were adaptively fed for 5 days before experiments and randomly divided into the following four groups: the siNC+MC group (n = 10), the METTL3 siRNA1+MC group (n = 10), siNC+M group (n = 10) and the METTL3 siRNA1+M group (n = 10). Then, the right forelimb of mice in the siNC+MC group was subcutaneously injected with 100 uL PBS containing 1 × 106 SK-Hep1 cells co-transfected with siNC and MC; the right forelimb of mice in the METTL3 siRNA1+MC group was subcutaneously injected with 100 uL PBS containing 1 × 106 SK-Hep1 cells co-transfected with METTL3 siRNA1 and MC; the right forelimb of mice in the siNC+M group was subcutaneously injected with 100 uL PBS containing 1 × 106 SK-Hep1 cells co-transfected with siNC and M; the right forelimb of mice in the METTL3 siRNA1+M group was subcutaneously injected with 100 uL PBS containing 1 × 106 SK-Hep1 cells co-transfected with METTL3 siRNA1 and M.
Response Summary METTL3 up-regulated the expression of hsa-miR-589-5p and promoted the maturation of miR-589-5p. Overexpressed miR-589-5p and METTL3 promoted the viability, migration and invasion of liver cancer cells.
hsa-miR-671-5p
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [21]
Responsed Disease Glioma [ICD-11: 2A00.0]
Target Regulation Up regulation
In-vitro Model
 T98G Glioblastoma Homo sapiens CVCL_0556
LN-229 Glioblastoma Homo sapiens CVCL_0393
LN-18 Glioblastoma Homo sapiens CVCL_0392
HEB (human normal glial cell line HEB were obtained from Tongpai (Shanghai) biotechnology co., LTD (Shanghai, China))
A-172 Glioblastoma Homo sapiens CVCL_0131
Response Summary METTL3-mediated m6A modification upregulated circDLC1 expression, and circDLC1 promoted CTNNBIP1 transcription by sponging hsa-miR-671-5p, thus repressing the malignant proliferation of glioma.
hsa-miR-766-5p
 Target Gene 
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [242]
Responsed Disease Chronic myeloid leukaemia [ICD-11: 2B33.2]
Target Regulation Up regulation
Cell Process Cell viability and apoptosis
In-vitro Model
 BV-173 Chronic myelogenous leukemia Homo sapiens CVCL_0181
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KCL-22 Chronic myelogenous leukemia Homo sapiens CVCL_2091
MEG-01 Chronic myelogenous leukemia Homo sapiens CVCL_0425
Response Summary METTL3-mediated m6A modification induced the aberrant expression of NEAT1 in chronic myelocytic leukemia. Overexpression of NEAT1 inhibited cell viability and promoted the apoptosis of chronic myelocytic leukemia cells. hsa-miR-766-5p was upregulated in CML PBMCs and abrogated the effects of NEAT1 on cell viability and apoptosis of the chronic myelocytic leukemia cells.
hsa-miR-873-5p
 Target Gene 
Diseases of the urinary system [ICD-11: GC2Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [397]
Responsed Disease Diseases of the urinary system [ICD-11: GC2Z]
Target Regulation Up regulation
Cell Process Oxidative stress and apoptosis
In-vitro Model
 mRTEC (Mouse renal tubular epithelial cells)
Response Summary METTL3 interacts with the microprocessor protein DGCR8 and positively modulates hsa-miR-873-5p mature process in an m6A-dependent manner.METTL3/m6A in colistin-induced nephrotoxicity and provide a new insight on m6A modification in drug induced toxicity.
hsa-miR-99a-5p
 Target Gene 
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [398]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Target Regulation Up regulation
In-vitro Model
 HOK Normal Hexagrammos otakii CVCL_YE19
CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
SCC-9 Tongue squamous cell carcinoma Homo sapiens CVCL_1685
SCC-15 Tongue squamous cell carcinoma Homo sapiens CVCL_1681
UM2 Tongue squamous cell carcinoma Homo sapiens CVCL_VH01
hsa_circ_0000677
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [399]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 NCM460 Normal Homo sapiens CVCL_0460
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HCT 15 Colon adenocarcinoma Homo sapiens CVCL_0292
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
Caco-2 Colon adenocarcinoma Homo sapiens CVCL_0025
In-vivo Model For the tumor xenograft, mice were randomly divided into three groups with four mice for each group. Then, 1 × 106 cells after indicated treatment were harvested and resuspended in 50 ul of PBS. Then the cells were subcutaneously injected into the right front flank of each mouse.
Response Summary hsa_circ_0000677 and its downstream target ABCC1 were upregulated in CRC cells, induced by the METTL3-mediated m6 A modification of circ_0000677 and SUMO1-mediated SUMOylation of METTL3. This work provided a new strategy for the therapeutic treatment of CRC.
mmu-miR-365-3p
 Target Gene 
Chronic pain [ICD-11: MG30]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [400]
Responsed Disease Chronic pain [ICD-11: MG30]
Target Regulation Up regulation
Pathway Response MicroRNAs in cancer hsa05206
Cell Process RNA stability
Response Summary METTL3 positively modulated the mmu-miR-365-3p processing in a microprocessor protein DiGeorge critical region 8-dependent manner.METTL3-mediated m6A modification in nociceptive sensitization and provide a novel perspective on m6A modification in the development of Inflammatory pain.
mmu-miR-7212-5p
 Target Gene 
Unspecific body region injury [ICD-11: ND56]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [401]
Responsed Disease Unspecific body region injury [ICD-11: ND56]
Target Regulation Up regulation
Cell Process Cell differentiation
In-vitro Model
 MC3T3-E1 Normal Mus musculus CVCL_0409
In-vivo Model A longitudinal incision was made on the skin and the muscles were separated to expose the femur. A transverse osteotomy was performed in the mid-diaphysis of the femur, and the bones were stabilized by inserting a 23-gauge intramedullary needle. Equal amounts (100 uL) of phosphate-buffered saline (PBS), plasmid METTL3 and agomiR-7212-5p (10 mg/kg body weight) were locally injected into the femoral fracture site.
Response Summary Down-regulation of METTL3 promotes osteogenic processes both in vitro and in vivo, and this effect is recapitulated by the suppression of mmu-miR-7212-5p maturation. miR-7212-5p inhibits osteoblast differentiation in MC3T3-E1 cells by targeting FGFR3.
hsa_circ_0004771 (circ_NRIP1)
 Target Gene 
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [166]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model
 hFOB 1.19 Normal Homo sapiens CVCL_3708
MG-63 Osteosarcoma Homo sapiens CVCL_0426
U2OS Osteosarcoma Homo sapiens CVCL_0042
Response Summary METTL3-mediated hsa_circ_0004771 (circNRIP1) exhibits oncogenic roles in osteosarcoma by regulating FOXC2 via sponging miR-199a, which provides new ideas for the treatment of osteosarcoma.
hsa_circ_0008399 (Circ_RBM3)
 Target Gene 
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [402]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Protein export hsa03060
Cell Process Eukaryotic translation
Cell apoptosis
In-vitro Model
 5637 Bladder carcinoma Homo sapiens CVCL_0126
RT-4 Bladder carcinoma Homo sapiens CVCL_0036
UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
In-vivo Model Chose 4-week-old female BALB/c nude mice for tumor xenograft experiments, which randomly were divided into four groups (n = 5 per group). Bladder cancer cells (3 × 106) were subcutaneously injected into the right axilla of the nude mice.
Response Summary Circ0008399 bound WTAP to promote formation of the WTAP/METTL3/METTL14 m6A methyltransferase complex, reduce cisplatin sensitivity in bladder cancer, implicating the potential therapeutic value of targeting this axis.
hsa_circ_0008542 (Circ_PHF12)
 Target Gene 
Diseases of the musculoskeletal system [ICD-11: FC0Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [403]
Responsed Disease Diseases of the musculoskeletal system [ICD-11: FC0Z]
Target Regulation Up regulation
Cell Process RNA stability
In-vitro Model
 RAW 264.7 Mouse leukemia Mus musculus CVCL_0493
MC3T3-E1 Normal Mus musculus CVCL_0409
In-vivo Model Circ_0008542, where rats were injected with exosomes containing circ_0008542 into the tail vein for 8 weeks.
Response Summary METTL3 acts on the m6A functional site of 1956 bp in hsa_circ_0008542. RNA demethylase ALKBH5 inhibits the binding of circ_0008542 with miRNA-185-5p to correct the bone resorption process.
hsa_circ_0021427 (circ_HPS5)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [56]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
Pathway Response Transcriptional misregulation in cancer hsa05202
Cell Process Epithelial-mesenchymal transition
Cell autophagy
In-vitro Model
 Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
In-vivo Model To create the xenograft neoplasm system, 40 male BALB/c nude mice aged 5 weeks were randomly separated into sh-NC, sh-circHPS5, sh-circHPS5+CTRL, and sh-circHPS5+SAH groups (n = 5 for each group). HCC cells were subcutaneously injected into the axilla of the nude mice.
Response Summary In hepatocellular carcinoma, METTL3 could direct the formation of hsa_circ_0021427 (circHPS5), and specific m6A controlled the accumulation of circHPS5. YTHDC1 facilitated the cytoplasmic output of circHPS5 under m6A modification. CircHPS5 can act as a miR-370 sponge to regulate the expression of HMGA2 and further accelerate hepatocellular carcinoma cell tumorigenesis.
hsa_circ_0029589 (Circ_CHFR)
 Target Gene 
Acute coronary syndrome [ICD-11: BA4Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [404]
Responsed Disease Acute coronary syndrome [ICD-11: BA4Z]
Target Regulation Down regulation
Cell Process Macrophage pyroptosis
In-vitro Model
 CD14 + cells (CD14+ cells from human peripheral blood)
Response Summary The relative RNA expression level of hsa_circ_0029589 in macrophages was decreased, whereas the N6-methyladenosine (m6A) level of hsa_circ_0029589 and the expression of m6A methyltransferase METTL3 were validated to be significantly elevated in macrophages in patients with acute coronary syndrome.
hsa_circ_0058493 (Circ_RHBDD1)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [405]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
Pathway Response Hepatocellular carcinoma hsa05225
Cell Process Cell growth and metastasis
In-vitro Model
 BEL-7404 Endocervical adenocarcinoma Homo sapiens CVCL_6568
HCCLM3 Adult hepatocellular carcinoma Homo sapiens CVCL_6832
L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
SK-HEP-1 Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
SMMC-7721 Endocervical adenocarcinoma Homo sapiens CVCL_0534
In-vivo Model Groups of HCT116-Luc-shCtrl, HCT116-Luc-shLINC00460, and HCT116-Luc-shLINC00460 + HMGA1 cells (5 × 106) were injected subcutaneously into the flanks of mice correspondingly.
Response Summary In hepatocellular carcinoma, hsa_circ_0058493 contained m6A methylation sites and that METTL3 mediated the degree of methylation modification of hsa_circ_0058493. YTHDC1 could bind to hsa_circ_0058493 and promote its intracellular localization from the nucleus to the cytoplasm.
hsa_circ_0081609 (circ_CUX1)
 Target Gene 
Hypopharyngeal cancer [ICD-11: 2B6D]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [406]
Responsed Disease Hypopharyngeal squamous cell carcinoma [ICD-11: 2B6D.0]
Target Regulation Up regulation
In-vitro Model
 CLA-27 cell line (The head and neck tumor cell lines)
HOK Normal Hexagrammos otakii CVCL_YE19
SAS Tongue squamous cell carcinoma Homo sapiens CVCL_1675
SCC-15 Tongue squamous cell carcinoma Homo sapiens CVCL_1681
SCC-4 Tongue squamous cell carcinoma Homo sapiens CVCL_1684
SCC-9 Tongue squamous cell carcinoma Homo sapiens CVCL_1685
Tca8113 Endocervical adenocarcinoma Homo sapiens CVCL_6851
Response Summary METTL3-mediated m6A modification plays a key role in stabilizing the expression of hsa_circ_0081609 (circCUX1), thereby inhibiting the expression of caspase 1 and conferring the radiotherapy resistance of hypopharyngeal squamous cell carcinoma.
hsa_circ_0092493 (circ_ARL3)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [379]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
Cell Process Reverse splicing and biogenesis
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model Mice were randomly divided into three groups, and subcutaneously injected with control, circ-ARL3-silenced and circ-ARL3&miR-1305-silenced HepG2.2.15 cells.
Response Summary hsa_circ_0092493 (circ_ARL3) is a critical regulator in HBV-related HCC, targeting the axis of circ-ARL3/miR-1305 can be a promising treatment for HBV+ HCC patients. HBx protein upregulated N6 -methyladenosine (m6A) methyltransferases METTL3 expression, increasing the m6A modification of circ-ARL3; then, m6A reader YTHDC1 bound to m6 A-modified of circ-ARL3 and favored its reverse splicing and biogenesis. Furthermore, circ-ARL3 was able to sponge miR-1305, antagonizing the inhibitory effects of miR-1305 on a cohort of target oncogenes, thereby promoting HBV+ HCC progression.
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 (PLCG2)
 Target Gene 
Nasal-type natural killer/T-cell lymphoma [ICD-11: XH3400]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [407]
Responsed Disease Nasal-type natural killer/T-cell lymphoma [ICD-11: XH3400]
Target Regulation Up regulation
2,4-dienoyl-CoA reductase [ (DECR1)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [408]
Responsed Disease Liver cancer [ICD-11: 2C12]
Responsed Drug Sorafenib Approved
 Drug Info 
Target Regulation Down regulation
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
SNU-449 Adult hepatocellular carcinoma Homo sapiens CVCL_0454
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
MIHA
 N.A. Homo sapiens CVCL_SA11
In-vivo Model For subcutaneous HCC mice xenograft model, the cell suspension was injected into the right flank of the mice (n = 5 per group).
AC026356.1
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [409]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
In-vitro Model
 THLE-2 Normal Homo sapiens CVCL_3803
SNU-398 Adult hepatocellular carcinoma Homo sapiens CVCL_0077
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
HCCLM3 Adult hepatocellular carcinoma Homo sapiens CVCL_6832
In-vivo Model Indicated HCC cells were intrasplenically injected into 5-week-old male BALB/C athymic nude mice (SpePharm Biotechnology, Beijing, China). After being fed in specific pathogen free condition for 35 days, the mice were euthanized and the livers were resected and subjected to HE staining.
Acyl-CoA synthetase short-chain family member 3, mitochondrial (ACSS3)
 Target Gene 
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [410]
Responsed Disease Non-alcoholic fatty liver disease [ICD-11: DB92]
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Alpha-actinin-4 (ACTN4)
 Target Gene 
SARS-CoV-2 [ICD-11: XN109]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [411]
Responsed Disease SARS-CoV-2 [ICD-11: XN109]
In-vitro Model
 A549-ACE2 Lung adenocarcinoma Homo sapiens CVCL_C0Q5
A549-ACE2 Lung adenocarcinoma Homo sapiens CVCL_C0Q5
Vero C1008
 N.A. Chlorocebus sabaeus CVCL_0574
HEK293T Normal Homo sapiens CVCL_0063
Alpha-aminoadipic semialdehyde dehydrogenase (ALDH7A1)
 Target Gene 
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [412]
Responsed Disease Head and neck squamous carcinoma [ICD-11: 2B6E]
In-vitro Model
 SCC-9 Tongue squamous cell carcinoma Homo sapiens CVCL_1685
In-vivo Model Bmi1CreER and RosatdTomato mice were obtained from The Jackson Laboratory, while Mettl3flox/flox and Mettl3KI/KI mice were provided from the laboratory of Prof. Quan Yuan at the West China Hospital of Stomatology. As previously described, we treated mice with 100 μg/mL 4-nitroquinoline 1-oxide (4NQO) (Sigma, N8141) to induce HNSCC formation. In brief, 6-week-old mice were fed with 4NQO for 16 weeks and then normal water for another 10 weeks. To lineage tracing and conditional knockout and knockin mouse model, tamoxifen (1 mg/mouse/day for 3 days; Sigma, T5648-1G) was injected intraperitoneally after 4NQO treatment. Then, we collected tongue samples, made frozen sections, and observed sections under a fluorescence microscope to calculate the positive percentage of BMI1 cells.+.
Amphiregulin (AREG)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [413]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Up regulation
In-vitro Model
 PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
PancTu-II Pancreatic ductal adenocarcinoma Homo sapiens CVCL_4013
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
Human Pancreatic Nestin-Expressing cells (Human Pancreatic Nestin-Expressing cells)
Angiopoietin-related protein 3 (ANGPTL3)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [414]
Responsed Disease Stomach adenocarcinoma [ICD-11: 2B72.0]
Target Regulation Down regulation
In-vitro Model
 AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
In-vivo Model For in vivo tumor formation, AGS cells (5 × 107) stably infected with sh-METTL3 lentivirus or sh-NC control cells were injected subcutaneously into nude mice (n = 3). The volume and size of the tumors were observed and recorded every three days from the third day after inoculation, calculated as 0.5×(length×width2).
Anillin (ANLN)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [415]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
Pathway Response mTOR signaling pathway hsa04150
In-vitro Model
 Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
HCCLM3 Adult hepatocellular carcinoma Homo sapiens CVCL_6832
PLC/PRF/5 Adult hepatocellular carcinoma Homo sapiens CVCL_0485
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
BEL-7402 Endocervical adenocarcinoma Homo sapiens CVCL_5492
HUVEC-C Normal Homo sapiens CVCL_2959
RAW 264.7 Mouse leukemia Mus musculus CVCL_0493
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
In-vivo Model Using a 100 μl Hamilton Microliter syringe, all the groups of 1 × 107 luciferase-labeled Huh-7 cells in 50 μl 1 x phosphate-buffered saline (PBS) was injected intracardially in the left ventricle of nu/nu, female 4-6-week-old nude mice.
Annexin A2 (ANXA2)
 Target Gene 
Acute ischemic stroke [ICD-11: 8B11]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [416]
Responsed Disease Acute ischemic stroke [ICD-11: 8B11]
Target Regulation Down regulation
Pathway Response MAPK signaling pathway hsa04010
Apolipoprotein C-III (APOC3)
 Target Gene 
COVID-19 [ICD-11: RA01]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [417]
Responsed Disease COVID-19 [ICD-11: RA01]
Aryl hydrocarbon receptor (AHR)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [333]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Responsed Drug Tislelizumab Approved
 Drug Info 
In-vitro Model
 U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
AT-rich interactive domain-containing protein 1B (ARID1B)
 Target Gene 
Disorders of refraction [ICD-11: 9D00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [272]
Responsed Disease Disorders of refraction [ICD-11: 9D00.0]
Target Regulation Down regulation
In-vitro Model
RF/6A
 N.A. Macaca mulatta CVCL_4552
ATP-dependent zinc metalloprotease YME1L1 (YME1L1)
 Target Gene 
Acute kidney failure [ICD-11: GB60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [338]
Responsed Disease Acute kidney failure [ICD-11: GB60]
In-vitro Model
 HK-2 [Human kidney] Normal Homo sapiens CVCL_0302
Autophagy related 8 (ATG8)
 Target Gene 
Chronic respiratory disease originating in the perinatal period [ICD-11: KB29]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [418]
Responsed Disease Chronic respiratory disease originating in the perinatal period [ICD-11: KB29.0]
Target Regulation Down regulation
In-vitro Model
 BEAS-2B Normal Homo sapiens CVCL_0168
In-vivo Model Neonatal C57BL/6J, B6.129S4-Ccr2tm1Ifc/J (METTL3-/-), and the respective Wild-Type (WT) control mice were purchased from the Experimental Animal Center of Nanjing Medical University. Mice were divided into three groups: 1) C57BL/6J mice were exposed to 21% oxygen (normoxia, NRMX) for 14 days; 2) C57BL/6J, METTL3-/- and WT control mice were exposed to 80% O2 oxygen (hyperoxia, HYRX) for 28 days; 3) Mice were injected with 15 μg of 3-MA 30 min before hyperoxia exposure. The procedures were performed in accordance with ARRIVE guidelines.
B-cell lymphoma 6 protein (BCL6)
 Target Gene 
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [419]
Responsed Disease Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
Cell Process Transcription
Cell proliferation
Cell migration
Cell invasion
Baculoviral IAP repeat-containing protein 5 (BIRC5)
 Target Gene 
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [420]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
A2780 Ovarian endometrioid adenocarcinoma Homo sapiens CVCL_0134
In-vivo Model Four weeks old female BALB/c nude mice were purchased from SJA Laboratory Animal Co, Ltd (Changsha, China), and acclimated in a specific pathogen free environment for 1 week. SKOV3/DDP cells treated with shBIRC5, or shBIRC5 combined with pcDNA-IGF2BP1 plasmid (IGF2BP1) or corresponding negative control were suspended in 100 μL McCoy's 5A medium and implanted subcutaneously into the left frank of mice in 1 × 107 cells/mice. After 7 days incubation, three groups of mice received 10 mg/kg cisplatin respectively, sacrificing and tumor collecting after 30 days.
BDNF/NT-3 growth factors receptor (NTRK2)
 Target Gene 
Single episode depressive disorder, severe, without psychotic symptoms [ICD-11: 6A70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [421]
Responsed Disease Major depressive disorder [ICD-11: 6A70.3]
In-vitro Model
 SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
In-vivo Model Rats were housed at 23°C and 55% humidity and were given ad libitum food and water. During acclimatization (1 week), rats were placed randomly (3/cage); however, after initial behavioral testing, they were grouped according to their behavioral phenotypes. All experiments were performed under a light cycle (8:00 AM and 10:00 AM). The protocol to induce LH behavior was approved by the Institutional Animal Care and Use Committee of the University of Alabama at Birmingham. The animal study also adhered to the international guidelines for the use and care of laboratory animals.
BRAF-activated non-protein coding RNA (BANCR)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [422]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Down regulation
In-vitro Model
 PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
Calcium-binding and coiled-coil domain-containing protein 1 (CALCOCO1)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [331]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Paclitaxel Approved
 Drug Info 
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model The experimental mice were housed in an SPF-grade animal laboratory at a temperature of approximately 25 °C, a humidity range of 50%, and an average daylight duration of 12 h. BALB/C female mice at 5-6 weeks of age were taken and prepared for tumor-bearing. After the mice were sacrificed, their tissues were collected, weighed and immediately snap-frozen in liquid nitrogen.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [331]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug STM2457 Investigative
 Drug Info 
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model The experimental mice were housed in an SPF-grade animal laboratory at a temperature of approximately 25 °C, a humidity range of 50%, and an average daylight duration of 12 h. BALB/C female mice at 5-6 weeks of age were taken and prepared for tumor-bearing. After the mice were sacrificed, their tissues were collected, weighed and immediately snap-frozen in liquid nitrogen.
Caspase-1 (CASP1)
 Target Gene 
Inflammatory response [ICD-11: MG46]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [322]
Responsed Disease Inflammatory response [ICD-11: MG46]
Cathepsin K (CTSK)
 Target Gene 
Certain specified inflammatory arthropathies [ICD-11: FA27]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [423]
Responsed Disease Certain specified inflammatory arthropathies [ICD-11: FA27.0]
In-vivo Model Two-to-three-week-old male C57BL/6 mice were randomly divided into five groups based on their body weight: control (deionised water), solvent control (0.5 % CMC Na), T-2 (200 ng/g T-2 toxin), treatment (administered a specially formulated methionine diet one month after exposure), and prevention groups (fed a specially formulated methionine diet). Each group consisted of six mice that received treatment for 8 weeks. The T-2 toxin gavage solution was prepared using 0.5 % CMC Na solution. The standard diet contained 0.57 % methionine, whereas the specially formulated diet contained 1.2 % methionine.
CCN family member 2 (CTGF)
 Target Gene 
Chronic kidney disease [ICD-11: GB61]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [424]
Responsed Disease Chronic kidney disease [ICD-11: GB61]
Target Regulation Up regulation
In-vitro Model
SV40 MES 13
 N.A. Mus musculus CVCL_5368
NRK-52E Normal Rattus norvegicus CVCL_0468
Other disorders of bladder [ICD-11: GC01]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [425]
Responsed Disease Other disorders of bladder [ICD-11: GC01.0]
Target Regulation Up regulation
In-vitro Model
 SV-HUC-1 Normal Homo sapiens CVCL_3798
In-vivo Model A 26 G pediatric venous indwelling catheter (0.6 mm outer diameter) was used for urethral catheterization. To create intravesical obstruction, a 6-0 nonabsorbable polypropylene suture was gently ligatured. Then, after the suture knot was made, the catheter was carefully removed. Rats in the sham-operated group underwent all of the same procedures, except for the urethral ligation step. At the end of the experiments, the rats were killed humanely.
CD40 ligand (CD40L)
 Target Gene 
Immune-related diseases [ICD-11: 4B4Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [426]
Responsed Disease Immune-related diseases [ICD-11: 4B4Z]
Target Regulation Down regulation
CD70 antigen (CD70)
 Target Gene 
Thyroid Cancer [ICD-11: 2D10]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [427]
Responsed Disease Papillary thyroid cancer [ICD-11: 2D10.1]
Responsed Drug JNJ-74494550 Phase 2
 Drug Info 
Target Regulation Down regulation
In-vitro Model
 Nthy-ori 3-1 Normal Homo sapiens CVCL_2659
B-CPAP Thyroid gland carcinoma Homo sapiens CVCL_0153
K1 Thyroid gland papillary carcinoma Homo sapiens CVCL_2537
C-643 Thyroid gland anaplastic carcinoma Homo sapiens CVCL_5969
BHT-101 Thyroid gland anaplastic carcinoma Homo sapiens CVCL_1085
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
In-vivo Model NCG mice (female, 4-5 weeks old, purchased from Jiangsu GemPharmatech) were acclimated for 1 week and were selected randomly to subcutaneously (s.c.) injected with 100 μl suspensions of 1 × 106 thyroid cancer cell lines. All mice were housed in animal facility under specific pathogen-free conditions. After 7 day, 5 × 106 huPBMCs were intravenously (i.v.) inoculated into mice. Mice were treated intravenously with anti-PD-1 mAb (nivolumab, 200 μg per injection), Combination (nivolumab + anti-CD70 mAb cusatuzumab, 200 μg per injection each), or PBS once a week. The treatment with M2-TAMs EVs or PBS continued in mice at 2ug EVs per injection at the tumor site twice a week [24]. The body weight of mice and the length (mm) and width (mm) of tumors were monitored every 3 or 4 days. Tumor volume (mm3) was calculated as Length × Width2 × 1/2. Tumor growth analyses were limited to 3 to 4 weeks because following this period mice started to show signs of xenograft-versus-host disease (xGVHD). Therefore, after 14 days or 21 days of PBMCs implantation, the mice were euthanized.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [427]
Responsed Disease Papillary thyroid cancer [ICD-11: 2D10.1]
Target Regulation Down regulation
In-vitro Model
 Nthy-ori 3-1 Normal Homo sapiens CVCL_2659
B-CPAP Thyroid gland carcinoma Homo sapiens CVCL_0153
K1 Thyroid gland papillary carcinoma Homo sapiens CVCL_2537
C-643 Thyroid gland anaplastic carcinoma Homo sapiens CVCL_5969
BHT-101 Thyroid gland anaplastic carcinoma Homo sapiens CVCL_1085
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
In-vivo Model NCG mice (female, 4-5 weeks old, purchased from Jiangsu GemPharmatech) were acclimated for 1 week and were selected randomly to subcutaneously (s.c.) injected with 100 μl suspensions of 1 × 106 thyroid cancer cell lines. All mice were housed in animal facility under specific pathogen-free conditions. After 7 day, 5 × 106 huPBMCs were intravenously (i.v.) inoculated into mice. Mice were treated intravenously with anti-PD-1 mAb (nivolumab, 200 μg per injection), Combination (nivolumab + anti-CD70 mAb cusatuzumab, 200 μg per injection each), or PBS once a week. The treatment with M2-TAMs EVs or PBS continued in mice at 2ug EVs per injection at the tumor site twice a week [24]. The body weight of mice and the length (mm) and width (mm) of tumors were monitored every 3 or 4 days. Tumor volume (mm3) was calculated as Length × Width2 × 1/2. Tumor growth analyses were limited to 3 to 4 weeks because following this period mice started to show signs of xenograft-versus-host disease (xGVHD). Therefore, after 14 days or 21 days of PBMCs implantation, the mice were euthanized.
Cell division cycle-associated protein 7 (CDCA7)
 Target Gene 
Colon cancer [ICD-11: 2B90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [428]
Responsed Disease Colon adenocarcinoma [ICD-11: 2B90.Y]
In-vitro Model
 FHC Normal Homo sapiens CVCL_3688
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
In-vivo Model Under a specific pathogen-free environment with a 12 h light/dark cycle, BALB/C male nude mice (Slaike Jingda Laboratory, Hunan, China) were randomly divided into two groups. Meanwhile, all mice had free access to fresh water and feed. For the COAD model, 5×106 DLD1 cells sh-NC or sh-CDCA7 were suspended in 100 μL PBS and subcutaneously injected into mice(n=5 for each group). During this period, the volume of tumors was continuously examined every week to generate the tumor growth curve. After injection for five weeks, all mice were euthanized, and tumors were subjected to image, weight, and western blot analysis. Meanwhile, Immunohistochemical (IHC) staining was used for the detection of CDCA7-positive expression in dissected tumor tissues.
Centromere protein F (CENPF)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [429]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
In-vitro Model
 HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HUVEC-C Normal Homo sapiens CVCL_2959
In-vivo Model Stably transfected GC cells (1 × 106) with sh-CENPF or CENPF overexpression were mixed in 0.1 mL PBS, and then were injected subcutaneously into the groin of 5-week-old BALB/C nude mice (n = 5 each group). After four weeks, the nude mice were sacrificed, and tumor tissues were dissected. Finally, the weight and volume of the tumors were measured. Tumor volume = length × width2 × 1/2.A total of 1 × 106 luciferase labeled GC cells were injected into the spleen of 5-week-old BALB/C nude mice. After 4-5 weeks, bioluminescence signals of liver metastases were detected via an IVIS imaging system (PerkinElmer, Norwalk, Connecticut, USA). Liver tissues were removed for hematoxylin-eosin (HE) (Beyotime, Shanghai, China) stained sections to evaluate metastatic liver lesions.
Centrosomal protein of 170 kDa (CEP170)
 Target Gene 
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [430]
Responsed Disease Esophageal cancer [ICD-11: 2B70]
In-vitro Model
 KYSE-450 Esophageal squamous cell carcinoma Homo sapiens CVCL_1353
chromosome 2 open reading frame 92 (C2orf92)
 Target Gene 
Thyroid Cancer [ICD-11: 2D10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [431]
Responsed Disease Papillary thyroid cancer [ICD-11: 2D10.1]
Target Regulation Up regulation
Circ_1662
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [124]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Hippo signaling pathway hsa04390
Cell Process Cell invasion
Cell migration
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
In-vivo Model BALB/c nude mice (4 weeks old) were acquired from Vital River Laboratory (Beijing, China). HCT116 cells with stable circ1662 expression (2 × 106 in 100 L of PBS) were injected via the tail vein. After 45 days, the mice were sacrificed. The lung metastatic carcinoma specimens were processed into paraffin-embedded sections for subsequent H&E staining and IHC.
Response Summary METTL3-induced Circ_1662 promoted colorectal cancer cell invasion and migration by accelerating YAP1 nuclear transport. Circ1662 enhanced CRC invasion and migration depending on YAP1 and SMAD3. This result implies that circ1662 is a new prognostic and therapeutic marker for CRC metastasis.
Circ_ABCC4
 Target Gene 
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [432]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
Circ_ASK1
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [433]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Responsed Drug Gefitinib Approved
 Drug Info 
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model
 SPC-A1 Endocervical adenocarcinoma Homo sapiens CVCL_6955
SK-LU-1 Lung adenocarcinoma Homo sapiens CVCL_0629
NCI-H1993 Lung adenocarcinoma Homo sapiens CVCL_1512
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H1650 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1483
HEK293T Normal Homo sapiens CVCL_0063
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
BEAS-2B Normal Homo sapiens CVCL_0168
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
16HBE14o- Normal Homo sapiens CVCL_0112
In-vivo Model Established a xenograft model in BALB/c nude mice by inoculating HCC827-GR cells transfected with the constructs for circASK1 silencing, ASK1-272a.a overexpression and ASK1-272a.a overexpression/circASK1 knockdown.
Response Summary Increased YTHDF2-mediated endoribonucleolytic cleavage of m6A-modified Circ_ASK1 accounts for its downregulation in gefitinib-resistant cells. Either METTL3 silencing or YTHDF2 silencing suppressed the decay of circASK1 in HCC827-GR cells. This study provides a novel therapeutic target to overcome gefitinib resistance in LUAD patients.
Circ_ASXL1
 Target Gene 
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [434]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Target Regulation Up regulation
In-vitro Model
 SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
OVCAR-3 Ovarian serous adenocarcinoma Homo sapiens CVCL_0465
ES-2 Ovarian clear cell adenocarcinoma Homo sapiens CVCL_3509
HEY Ovarian serous adenocarcinoma Homo sapiens CVCL_0297
A2780 Ovarian endometrioid adenocarcinoma Homo sapiens CVCL_0134
COV362 Ovarian serous adenocarcinoma Homo sapiens CVCL_2420
In-vivo Model SKOV3 cells were treated with sh-NC or sh-circASXL1. 100 μL of PBS containing 1 × 106 cells were implanted into mice. Tumor volume was measured every 5 days. After 30 days, mice were euthanized. The tumor was excised and weighed.
Circ_DLC1
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [21]
Responsed Disease Glioma [ICD-11: 2A00.0]
Target Regulation Up regulation
In-vitro Model
 T98G Glioblastoma Homo sapiens CVCL_0556
LN-229 Glioblastoma Homo sapiens CVCL_0393
LN-18 Glioblastoma Homo sapiens CVCL_0392
HEB (human normal glial cell line HEB were obtained from Tongpai (Shanghai) biotechnology co., LTD (Shanghai, China))
A-172 Glioblastoma Homo sapiens CVCL_0131
Response Summary METTL3-mediated m6A modification upregulated Circ_DLC1 expression, and circDLC1 promoted CTNNBIP1 transcription by sponging miR-671-5p, thus repressing the malignant proliferation of glioma.
Circ_EPHB4
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [435]
Responsed Disease Glioma [ICD-11: 2A00.0]
Target Regulation Up regulation
Circ_IGF2BP3
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [436]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Up regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Cell Process Immunity
In-vitro Model
 SW900 Lung squamous cell carcinoma Homo sapiens CVCL_1731
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H1703 Lung squamous cell carcinoma Homo sapiens CVCL_1490
NCI-H1650 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1483
HEK293T Normal Homo sapiens CVCL_0063
BEAS-2B Normal Homo sapiens CVCL_0168
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
16HBE14o- Normal Homo sapiens CVCL_0112
In-vivo Model A total of 106 LLC cells transfected with the following constructs were injected subcutaneously into C57BL/6 mice.
Response Summary In non-small-cell lung carcinoma, METTL3 mediates the N6-methyladenosine (m6A) modification of Circ_IGF2BP3 and promotes its circularization in a manner dependent on the m6A reader protein YTHDC1.
Circ_MIRLET7BHG
 Target Gene 
BackgroundAllergic rhinitis [ICD-11: CA08]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [437]
Responsed Disease BackgroundAllergic rhinitis [ICD-11: CA08.0]
Target Regulation Up regulation
In-vivo Model Briefly, the mice were intraperitoneally injected with 25 μg OVA mixed with 1 mg aluminum hydroxide gel was intraperitoneally injected into mice once a week for three weeks. Subsequently, nostril challenge with 500 μg OVA was performed once a day for one week. The control mice were exposed to PBS (vehicle). LV-sh-NC or LV-sh-circMIRLET7BHG (1 × 107 TU/mL, GenePharma) were injected into mice via the tail vein two days before the nostril challenge.
Circ_MYO1C
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [438]
Responsed Disease Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
Target Regulation Up regulation
In-vitro Model
 PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
Capan-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0026
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
In-vivo Model Male BALB/c nude mice (5-6 weeks) were obtained from Slac Laboratory Animal Center (Shanghai, China) and maintained under pathogen-free conditions. PANC-1 cells (2 × 106 cells suspended in 100 μl PBS) transfected with circMYO1C knockdown (sh-circMYO1C) or controls (sh-NC) were subcutaneously injected into the flank of nude mice. One week later, the tumor size was measured every three days.
Circ_PRKAR1B
 Target Gene 
Crohn disease [ICD-11: DD70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [439]
Responsed Disease Crohn disease [ICD-11: DD70.3]
In-vivo Model Twelve-week-old wild-type (WT) and IL-10-KO mice were allocated randomly to four groups (n = 5 per group): (1) the WT group; (2) the IL-10 KO + si-control group (administrated saline as a placebo via enema once); (3) the IL-10 KO + si-circPRKAR1B group (administrated 200 μL of 1e11 vg adeno-associated virus (AAV) vector carrying si-circPRKAR1B via enema once); and (4) the IL-10 KO + si-METTL3 group (administrated 200 μL of 1e11 vg AAV vector carrying si-METTL3 via enema once).
Circ_RNF13
 Target Gene 
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [440]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Down regulation
In-vitro Model
 SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
C-4-I Cervical squamous cell carcinoma Homo sapiens CVCL_2253
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
In-vivo Model Stably transfected cell lines were created by silencing circRNF13 in CC SiHa cells. Once xenografts were established, the tumors reached an approximate volume of 200 mm3. A single dose of 15 Gy irradiation was administered to female BALB/c nude mice (4-5 weeks old) in the murine model. The tumor volume was measured and recorded using vernier calipers every five days after irradiation. After 30 days, the mice were euthanized under anesthesia, and tumor tissue was collected for further investigations.
Circ_SETD2
 Target Gene 
Pre-eclampsia [ICD-11: JA24]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [441]
Responsed Disease Pre-eclampsia [ICD-11: JA24]
Target Regulation Up regulation
In-vivo Model Pregnant rats were randomly assigned to 5 groups: normal pregnancy (normal) group, PE group, circSETD2 overexpression (PE + oe-circSETD2) group, METTL3 overexpression (PE + oe-METTL3) group, overexpression control (PE + oe-NC) group, joint treatment (PE + oe-METTL3 + si-circSETD2) group, and joint treatment control (PE + oe-METTL3 + si-NC) group, with 6 rats in each group. After continuous injection of L-NAME for 4 days, the rats in the overexpression and overexpression control groups were further injected with 30 μl lentivirus vector oe-circSETD2, oe-METTL3 or oe-NC solution (GenePharma, Shanghai, China) through the tail vein; after continuous injection of L-NAME for 4 days, the rats in the PE + oe-METTL3 + si-circSETD2 group were further injected with 30 μl lentiviral vector oe-circSETD2 and si-circSETD2 (GenePharma) at the virus titer of 5 × 107 PFU/mL. The rats were euthanized on the 16th day of pregnancy. Then, the chorionic trophoblast tissues were isolated from the placenta of pregnant rats and divided into 2 parts, with 1 part for extraction and detection of tissue RNA, and the other part fixed in the buffer containing 10% formalin, embedded in paraffin, and made into 5 μm sections.
Circ_UHRF2
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [442]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
In-vivo Model To create a xenograft model, 1 × 107 SW620 cells stably transfected shMETTL3 and shcircUHRF2 were subcutaneously injected into the nude mice. Tumor sizes were calculated by measuring the length and width (V = length × width2/2). Mice were euthanized four weeks later, and tumors were weighed. For in vivo liver metastasis assay, 1 × 106 SW620 cells stably transfected shMETTL3 and shcircUHRF2 were injected into the distal tip of the spleen of mice according to previous studies.
Claspin (CLSPN)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [267]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Responsed Drug Celastrol Preclinical
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
AsPC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
In-vivo Model AsPC-1 cells suspended in 100 μl of PBS (2 × 106 cells/100 μl) were injected subcutaneously into the lateral flank of the mice, which were randomly divided into solvent group (n = 6), 1.0 mg/kg of celastrol group (n = 6) and 3.0 mg/kg of celastrol group (n = 6). The administration of celastrol was performed by intraperitoneal injection into tumor-bearing mice every 2 day after 10 day inoculation. The tumor sizes were monitored with calipers every 5 days, and the tumor volume was calculated with the formula: Volume (mm3) = 1/2 × length × width2.
Cohesin subunit SA-3 (STAG3)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [443]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
NCM460 Normal Homo sapiens CVCL_0460
In-vivo Model Oe-STAG3 and sh-METTL3 were transfected into HCT116 cells. Trypsin digestion and cell counting were performed on each set of cells after they had reached around 80% confluence. Nude mice were subcutaneously injected with 200 μL cells (2 × 106) and randomly assigned to 5 groups (n = 6 in each group): control group (mice were injected with cells without transfection plasmid), oe-NC group (mice were injected with cells transfected with oe-NC), oe-STAG3 group (mice were injected with cells transfected with oe-STAG3), oe-STAG3 + sh-NC group (mice were injected with cells transfected with oe-STAG3 and sh-NC) and oe-STAG3 + sh-METTL3 group.
Collagen alpha-1 (COL1A1)
 Target Gene 
Keloid [ICD-11: EE60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [444]
Responsed Disease Keloid [ICD-11: EE60]
Target Regulation Up regulation
Cell Process mRNA stability
In-vitro Model
CHSE-EC
 N.A. Oncorhynchus tshawytscha CVCL_DG46
In-vivo Model Six- to eight-week-old C57BL/6 mice were purchased from Cyagen Biosciences, Inc. (Cyagen, Suzhou, China). Alkbh3-/- C57BL/6 mice were generated via the CRISPR/Cas9 system. Single-guide RNAs (sgRNAs) were designed to target exons 3 to 5 of Alkbh3 and were coinjected with Cas9 into the zygotes. The pups obtained were genotyped by PCR. After genotyping, the F0 mice were subjected to serial mating to generate homozygous mutant offspring.
Collagen alpha-2(I) chain (COL1A2)
 Target Gene 
Vascular disorders of the liver [ICD-11: DB98]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [307]
Responsed Disease Vascular disorders of the liver [ICD-11: DB98.8]
Complement C1q subcomponent subunit A (C1QA)
 Target Gene 
Diffuse large B-cell lymphomas [ICD-11: 2A81]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [445]
Responsed Disease Diffuse large B-cell lymphomas [ICD-11: 2A81]
Responsed Drug Rituximab Approved
 Drug Info 
Target Regulation Down regulation
In-vivo Model Approximately 2 × 106 Farage/R or Farage/S cells stably transfected with shNC, shC1qA or shMETTL3 were subcutaneously injected into the left flank of each mouse. When the tumor volume reached ~100 mm3, each mouse received an intraperitoneal injection of Rituximab (20 mg/kg) every 4 days for a total of 5 injections. The diameter of each tumor was examined every 4 days using a caliper, and tumor volume was calculated as follows: (length × width2)/2. At 28 days after xenograft, the mice were sacrificed and the tumors were weighed and collected.
CX3C chemokine receptor 1 (CX3CR1)
 Target Gene 
Inflammatory response [ICD-11: MG46]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [322]
Responsed Disease Inflammatory response [ICD-11: MG46]
Cyclic AMP-responsive element-binding protein 1 (CREB1)
 Target Gene 
Single episode depressive disorder, severe, without psychotic symptoms [ICD-11: 6A70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [421]
Responsed Disease Major depressive disorder [ICD-11: 6A70.3]
In-vitro Model
 SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
In-vivo Model Rats were housed at 23°C and 55% humidity and were given ad libitum food and water. During acclimatization (1 week), rats were placed randomly (3/cage); however, after initial behavioral testing, they were grouped according to their behavioral phenotypes. All experiments were performed under a light cycle (8:00 AM and 10:00 AM). The protocol to induce LH behavior was approved by the Institutional Animal Care and Use Committee of the University of Alabama at Birmingham. The animal study also adhered to the international guidelines for the use and care of laboratory animals.
Cyclin-dependent kinase 2-associated protein 2 (CDK2AP2)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [446]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Cysteine methyltransferase DNMT3A (DNMT3A)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [447]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [291]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
Alzheimer disease [ICD-11: 8A20]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [448]
Responsed Disease Alzheimer disease [ICD-11: 8A20]
Target Regulation Up regulation
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
Cysteine protease ATG4A (ATG4A)
 Target Gene 
Intervertebral disc degeneration [ICD-11: FA80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [449]
Responsed Disease Intervertebral disc degeneration [ICD-11: FA80]
Target Regulation Down regulation
Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1)
 Target Gene 
Asthma [ICD-11: CA23]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [450]
Responsed Disease Asthma [ICD-11: CA23]
Target Regulation Down regulation
Cytochrome P450 2B6 (CYP2B6)
 Target Gene 
Insulin resistance [ICD-11: 5A44]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [451]
Responsed Disease Insulin resistance [ICD-11: 5A44]
Responsed Drug STM2457 Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model C57/BL6 male mice (eight per group) were randomly divided into four groups: basal CD group, HFD + 0.9% NaCl injection group, HFD + DMSO injection group, and HFD + STM2457 (Catalog No. 2499663-01-1, Selleck Chemicals, Houston, Texas) injection group. When the mean body weight of mice in HFD group was statistically different from that of mice in the control group [(mean body weight in HFD:mean body weight in CD)/mean body weight in CD > 30%], the treatment was started once a day for one or two weeks. STM2457 was administered at a dose of 50 mg/kg and weighed prior to each injection. DMSO or saline was also administered at an equal volume. Body weight was recorded every day. Injection of STM2457 was conducted daily and totally for one or two weeks.
D-3-phosphoglycerate dehydrogenase (PHGDH)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 3 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Lenvatinib Approved
 Drug Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
HepG3 Hepatoblastoma Homo sapiens CVCL_Y479
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/3 days off treatment regimen was applied.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Sorafenib Approved
 Drug Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/2 days off treatment regimen was applied.
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug STM2457 Investigative
 Drug Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/4 days off treatment regimen was applied.
D26496
 Target Gene 
Injury of nerves at hip or thigh level [ICD-11: NC74]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [453]
Responsed Disease Injury of nerves at hip or thigh level [ICD-11: NC74.0]
Target Regulation Down regulation
In-vitro Model
 Schwann cells (A type of glial cell that surrounds neurons)
In-vivo Model Rats were randomly divided into 4 groups: sham group (6 rats), SNI model group (24 rats), SNI + vector group (6 rats), and SNI + pcDNA-D26496 group (6 rats). D26496 overexpressed Adeno associated virus (AAVs, virus titer: 1.88E + 13) and vector (OBiO Technology Corp., Shanghai, China) were injected into the epineurium of sciatic nerve of rats (5 μL for each) in the SNI + vector group and SNI + pcDNA-D26496 group, respectively.
Discoidin domain-containing receptor 2 (DDR2)
 Target Gene 
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [454]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Target Regulation Up regulation
In-vitro Model
 SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
In-vivo Model BALB nude mice were purchased from Beijing Vital River Laboratory Animal Technology Co., Ltd. SKOV3 cells were transfected with sh-METTL3, sh-DDR2, DDR2 over-expression plasmid (oe-DDR2) or negative control. About one week later, the above SKOV3 cells were digested into single cells and subcutaneously injected to nude mice in different groups. After a duration of 4 weeks, the mice were euthanized by intraperitoneal injection of pentobarbital at a dosage 120 mg/kg. Finally, the subcutaneous tumors were removed to measure the size and volume (calculated according to volume = L (longest diameter) x W2 (shorter diameter)/2).
DNA (cytosine-5)-methyltransferase 1 (DNMT1)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [455]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
In-vitro Model
 BEAS-2B Normal Homo sapiens CVCL_0168
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1650 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1483
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
In-vivo Model To establishment the xenograftmodels, twenty mice were randomly divided into four groups, each of which contained five nude mice. In the sh-NC group, 4 × 106 A549 cells infected with LV-sh-NC were diluted in 100 μl of PBS and injected subcutaneously into nude mice. In the sh-DNMT1 group, 4 × 106 A549 cells infected with LV-sh-DNMT1 were diluted in 100 μl of PBS and injected subcutaneously into nude mice. In the sh-DNMT1 + sh-FOXO3a group, 4 × 106 A549 cells infected with LV-sh-DNMT1 and LV-sh-NC were diluted in 100 μl of PBS and injected subcutaneously into nude mice.
DNA-binding protein SATB2 (SATB2)
 Target Gene 
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [419]
Responsed Disease Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
Cell Process Transcription
Cell proliferation
Cell migration
Cell invasion
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (RPN2)
 Target Gene 
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [456]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Responsed Drug Cisplatin Approved
 Drug Info 
Pathway Response PI3K-Akt signaling pathway hsa04151
mTOR signaling pathway hsa04150
In-vitro Model
 5637 Bladder carcinoma Homo sapiens CVCL_0126
T24 Bladder carcinoma Homo sapiens CVCL_0554
UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
Dynamin-1-like protein (DRP1)
 Target Gene 
Acute myocardial infarction [ICD-11: BA41]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [457]
Responsed Disease Acute myocardial infarction [ICD-11: BA41]
Target Regulation Up regulation
E3 ubiquitin-protein ligase CHIP (STUB1)
 Target Gene 
Alzheimer disease [ICD-11: 8A20]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [458]
Responsed Disease Alzheimer disease [ICD-11: 8A20]
Target Regulation Up regulation
In-vitro Model
 SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
HT22 Normal Mus musculus CVCL_0321
eIF5-mimic protein 1 (BZW2)
 Target Gene 
Multiple myeloma [ICD-11: 2A83]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [459]
Responsed Disease Multiple myeloma [ICD-11: 2A83.1]
Target Regulation Up regulation
In-vitro Model
 NCI-H929 Plasma cell myeloma Homo sapiens CVCL_1600
MM1.S Plasma cell myeloma Homo sapiens CVCL_8792
U266B1 Plasma cell myeloma Homo sapiens CVCL_0566
INA-6 Plasma cell myeloma Homo sapiens CVCL_5209
OPM-2 Plasma cell myeloma Homo sapiens CVCL_1625
In-vivo Model MM1S cells infected with sh-METTL3/sh-NC (selected by 2 μg/mL puromycin) were subcutaneously injected into the left abdominal flanks of NOD-SCID mice (SPF Biotechnology Co., Ltd., Beijing, China) (n = 6/group). Tumor volume was measured every 7 days using the calipers. After 28 days, the mice were sacrificed, and tumor tissues were collected, weighed, and photographed. One part of the tissue was used to detect the expression of METTL3 and BZW2 using qRT-PCR and WB analysis, and the other part was prepared into paraffin sections and then performing Ki-67 immumohistochemical (IHC) staining according to the SP kit (Solarbio, Beijing, China) instructions.
Ena/VASP-like protein (EVL)
 Target Gene 
Macroscopic changes of size of the kidney [ICD-11: MF54]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [460]
Responsed Disease Macroscopic changes of size of the kidney [ICD-11: MF54.0]
Responsed Drug Isoforsythiaside Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 HEK293 Normal Homo sapiens CVCL_0045
HK-2 [Human kidney] Normal Homo sapiens CVCL_0302
In-vivo Model For the unilateral ureteral obstruction (UUO)-induced ON model, mice were subjected to permanent ureteral ligation of the left kidney ureter under aseptic and anaesthetic conditions, whereas sham-operated mice merely lacked ligation under equivalent conditions. The mice were sacrificed under anaesthesia at 3, 7 and 14 days postoperatively. For the ischemia/reperfusion (I/R)-induced renal fibrosis model, mice were recovered with blood supply after 42 min of bilateral renal artery clamping under both aseptic and anaesthetic conditions. These mice were sacrificed under anaesthesia at 7 and 14 days postoperatively. For drug treatment, isoforsythiaside was injected intraperitoneally at concentrations of 10, 25 and 50 mg/kg per day when the model was established. Similarly, the sham-operated group received an equivalent volume of saline intraperitoneally as a control. The harvested kidneys have been primarily used for morphological and histopathological observations and molecular biology studies.
EN_42575
 Target Gene 
Change in bowel habit [ICD-11: ME05]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [461]
Responsed Disease Change in bowel habit [ICD-11: ME05.1]
Target Regulation Up regulation
In-vitro Model
IPEC-J2
 N.A. Sus scrofa CVCL_2246
F-box only protein 43 (FBXO43)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [462]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
In-vitro Model
 HCCLM3 Adult hepatocellular carcinoma Homo sapiens CVCL_6832
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
Ferroptosis suppressor protein 1 (AIFM2)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [463]
Responsed Disease Glioma [ICD-11: 2A00.0]
Responsed Drug iFSP1 Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 U-251MG Astrocytoma Homo sapiens CVCL_0021
In-vivo Model Briefly, the mice were anesthetized and placed in a stereotactic frame. A burr hole was drilled into the skull (1.0 mm posterior and 3.0 mm lateral to the bregma). A 50 μL microinjector was used to inject 10 μL of 1 × 106 U251 cells suspended in the serum-free DMEM. The injection was performed slowly within 10 min and stayed for 10 min. After that, mice in cages and a cat were placed in the same room for fear stress induction .
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [464]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
FGD5 antisense RNA 1 (FGD5-AS1)
 Target Gene 
Endometrial cancer [ICD-11: 2C76]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [465]
Responsed Disease Endometrial cancer [ICD-11: 2C76]
Responsed Drug Paclitaxel Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 Ishikawa Endometrial adenocarcinoma Homo sapiens CVCL_2529
HHUA Endometrial adenocarcinoma Homo sapiens CVCL_3866
Fibronectin (FN1)
 Target Gene 
Keloid [ICD-11: EE60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [444]
Responsed Disease Keloid [ICD-11: EE60]
Target Regulation Up regulation
Cell Process mRNA stability
In-vitro Model
CHSE-EC
 N.A. Oncorhynchus tshawytscha CVCL_DG46
In-vivo Model Six- to eight-week-old C57BL/6 mice were purchased from Cyagen Biosciences, Inc. (Cyagen, Suzhou, China). Alkbh3-/- C57BL/6 mice were generated via the CRISPR/Cas9 system. Single-guide RNAs (sgRNAs) were designed to target exons 3 to 5 of Alkbh3 and were coinjected with Cas9 into the zygotes. The pups obtained were genotyped by PCR. After genotyping, the F0 mice were subjected to serial mating to generate homozygous mutant offspring.
Forkhead box protein P3 (FOXP3)
 Target Gene 
Lupus erythematosus [ICD-11: 4A40]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [466]
Responsed Disease Systemic lupus erythematosus [ICD-11: 4A40.0]
Target Regulation Up regulation
Fos-related antigen 2 (FOSL2)
 Target Gene 
Ovarian dysfunction [ICD-11: 5A80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [467]
Responsed Disease Polycystic ovary syndrome [ICD-11: 5A80.1]
Responsed Drug Short-chain fatty acid-butyric acid Phase 4
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 KGN Ovarian granulosa cell tumor Homo sapiens CVCL_0375
In-vivo Model Specific-pathogen-free (SPF) grade C57/B6 mice (6-8 weeks old) were purchased from Weitong Lihua Co. (Beijing, China). The mice were housed at constant temperature and humidity, and 12 h light/dark cycle a day and provided with adequate food and water.
Glucocorticoid receptor (NR3C1)
 Target Gene 
Single episode depressive disorder, severe, without psychotic symptoms [ICD-11: 6A70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [421]
Responsed Disease Major depressive disorder [ICD-11: 6A70.3]
In-vitro Model
 SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
In-vivo Model Rats were housed at 23°C and 55% humidity and were given ad libitum food and water. During acclimatization (1 week), rats were placed randomly (3/cage); however, after initial behavioral testing, they were grouped according to their behavioral phenotypes. All experiments were performed under a light cycle (8:00 AM and 10:00 AM). The protocol to induce LH behavior was approved by the Institutional Animal Care and Use Committee of the University of Alabama at Birmingham. The animal study also adhered to the international guidelines for the use and care of laboratory animals.
Glucose-6-phosphate exchanger SLC37A2 (SLC37A2)
 Target Gene 
Inflammatory bowel disease [ICD-11: DD7Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [468]
Responsed Disease Inflammatory bowel disease [ICD-11: DD7Z]
In-vitro Model
 RAW 264.7 Mouse leukemia Mus musculus CVCL_0493
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
In-vivo Model Mice were randomly allocated into three groups (n = 5/group): the negative control (NEG) group, the DSS-induced colitis (DSS) group, and the hucMSC-Ex-treated colitis (hucMSC-Ex) group. Mice in the NEG group were fed autoclaved water during the experiment, while mice in the DSS and hucMSC-Ex groups were fed autoclaved water containing 3% DSS (MP Biomedicals, USA). A total of 1 mg of hucMSC-Ex was administered by caudal vein to mice in the hucMSC-Ex group on the 3rd, 6th, and 9th day of modeling, while mice in other groups were injected with PBS. All mice were sacrificed when severe hematochezia and weight loss were observed in the DSS group. The disease progression of mice in the different groups was evaluated by weight change, DAI score, colorectal length, and weight ratio. After the mice were sacrificed, the general view of the spleen and colorectum of the mice was observed. The colorectal mucosa and spleen tissues of the mice in each group were separated, and RNA and protein of the tissues were extracted for subsequent experiments.
glucosylceramidase beta 1 like, pseudogene (GBA1LP)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [469]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
In-vitro Model
 L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
SMMC-7721 Endocervical adenocarcinoma Homo sapiens CVCL_0534
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model In vivo tumor growth assay, 1 × 107 Hep3B-GBAP1 or MHCC97H-shGBAP1 subclones and the corresponding control cells were transplanted into the body of 6-week-old BALB/c nude mice (Slac Laboratory Animal Center, Shanghai, China) via subcutaneous injection. Tumor size was measured every 3 days. Twenty-one days later, tumors were removed from mice in different groups. Tumor weight was calculated after dissection. Permission of conducting animal study was obtained from the Research Ethics Committee of Xi'an Jiaotong University. In vivo lung metastasis model, 1 × 106 cells were intravenously injected into the lateral tail vein of nude mice (n = 5 mice/group).
Glutaredoxin-1 (GLRX)
 Target Gene 
Parkinson disease [ICD-11: 8A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [470]
Responsed Disease Parkinson disease [ICD-11: 8A00]
Target Regulation Up regulation
In-vitro Model
 BV-2 Normal Mus musculus CVCL_0182
Glycogen phosphorylase, brain form (PYGB)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [471]
Responsed Disease Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
In-vitro Model
 BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
HPDE Normal Homo sapiens CVCL_4376
In-vivo Model Six BALB/c nude mice (male, 4 weeks) were randomly divided into 2 groups and inoculated with BXPC-3 cells (1 × 106) transfected with shPYGB or shNC by subcutaneous injection. Tumor volume was recorded every 7 days and mice were sacrificed after 6 weeks. To evaluate metastasis in vivo, transfected cells (5 × 106) were injected into nude mice through the tail vein.
Guanine nucleotide-binding protein G (GNAO1)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [472]
Responsed Disease Glioma [ICD-11: 2A00.0]
Responsed Drug Temozolomide Approved
 Drug Info 
Heme oxygenase 1 (HMOX1)
 Target Gene 
Acute ischemic stroke [ICD-11: 8B11]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [473]
Responsed Disease Acute ischemic stroke [ICD-11: 8B11]
Target Regulation Up regulation
Diseases of the female genital system [ICD-11: GA6Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [474]
Responsed Disease Diseases of the female genital system [ICD-11: GA6Z]
Target Regulation Down regulation
In-vivo Model Daily vaginal smears were collected between 4 and 6 PM, and rats showing four consecutive 4-day estrus cycles were chosen for constructing the endometrial injury model. Anesthesia was induced by injecting 3% mebumalnatrium (dose: 1.3 mL/kg) into the lumbar region, followed by a low midline abdominal incision for uterus exposure.
Histone acetyltransferase KAT2A (KAT2A)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [475]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation Down regulation
Histone deacetylase 9 (HDAC9)
 Target Gene 
Acute laryngitis or tracheitis [ICD-11: CA05]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [476]
Responsed Disease Acute laryngitis or tracheitis [ICD-11: CA05]
In-vitro Model
 TPC-1 Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
B-CPAP Thyroid gland carcinoma Homo sapiens CVCL_0153
Histone-lysine N-methyltransferase ASH1L (ASH1L)
 Target Gene 
Uveitis [ICD-11: 9A96]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [477]
Responsed Disease Uveitis [ICD-11: 9A96]
Target Regulation Up regulation
In-vitro Model
TH1
 N.A. Homo sapiens CVCL_5J51
Histone-lysine N-methyltransferase NSD2 (NSD2)
 Target Gene 
Chronic kidney disease [ICD-11: GB61]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [478]
Responsed Disease Diabetic nephropathy [ICD-11: GB61.Z]
Target Regulation Up regulation
Histone-lysine N-methyltransferase SETD2 (SETD2)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [479]
Responsed Disease Lung cancer [ICD-11: 2C25]
Target Regulation Down regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
HBE1
 N.A. Homo sapiens CVCL_0287
Histone-lysine N-methyltransferase SETMAR (SETMAR)
 Target Gene 
Thyroid Cancer [ICD-11: 2D10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [480]
Responsed Disease Thyroid Cancer [ICD-11: 2D10]
Target Regulation Up regulation
Histone-lysine N-methyltransferase SUV39H2 (SUV39H2)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [481]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
In-vivo Model The nude mice were inoculated in the inguinal region subcutaneously with 1 × 106 stably transfected GC cells which were suspended in 100 μL PBS. After one week, preestablished tumor xenografts were treated with DMSO or OTS186935 (50 mg/kg, 2 × /wk × 3).
Homeobox protein DLX-3 (DLX3)
 Target Gene 
Structural developmental anomalies of teeth and periodontal tissues [ICD-11: LA30]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [482]
Responsed Disease Structural developmental anomalies of teeth and periodontal tissues [ICD-11: LA30.0]
Homeobox protein Hox-C10 (HOXC10)
 Target Gene 
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [483]
Responsed Disease Head and neck squamous carcinoma [ICD-11: 2B6E]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model
 Tu 686 Laryngeal squamous cell carcinoma Homo sapiens CVCL_4916
FaDu Hypopharyngeal squamous cell carcinoma Homo sapiens CVCL_1218
HuLa-PC
 N.A. Homo sapiens CVCL_UC74
In-vivo Model Animals had free access to standard rodent chow and water. For the subcutaneous xenograft tumor model, transfected cells (5×106) were injected on the sides of the flanks of mice (n=5 per group). Subsequently, 30 days later, the mice were euthanized by cervical dislocation following anesthesia induced by intraperitoneal injection of 0.3% sodium pentobarbital (30 mg/kg). Euthanasia was confirmed by verifying respiratory and cardiac arrest, along with pupil dilation, for a minimum of 10 min. Tumor size and tumor weight were measured (max tumor diameter, 9.6 mm; max area, 82.56 mm2; max volume, 355.01 mm3). For the pulmonary metastasis model, transfected cells (2×106) were injected into the mouse tail veins (n=5 per group). Subsequently, 60 days later, the mice were sacrificed, and lungs were obtained. Finally, lung and tumor tissues were available for H&E staining at room temperature for 5 min or immunohistochemistry staining.
Homeobox protein Hox-C6 (HOXC6)
 Target Gene 
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [484]
Responsed Disease Prostate cancer [ICD-11: 2C82]
In-vitro Model
 VCaP Prostate carcinoma Homo sapiens CVCL_2235
DU145 Prostate carcinoma Homo sapiens CVCL_0105
HNC PC3 Retromolar trigone squamous cell carcinoma Homo sapiens CVCL_C8XA
RWPE-1 Normal Homo sapiens CVCL_3791
HOXA transcript antisense RNA, myeloid-specific 1 (HOTAIRM1)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [485]
Responsed Disease Glioma [ICD-11: 2A00.0]
Target Regulation Up regulation
In-vitro Model
 U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
In-vivo Model BALB/c nude mice (4 weeks old, male) were purchased from Vital River Laboratory Animals and maintained under specific pathogen-free conditions. For in vivo tumor xenograft model establishment, 10 mice were randomly chosen and divided into two groups: the sh-NC and sh-HOTAIRM1 groups. Next, U87 cells (approximately 1 × 106/200 μl PBS) transfected with shRNAs (sh-HOTAIRM1 or sh-NC) were subcutaneously inoculated into the right frontal node of nude mice. Tumor growth was monitored once weekly. Mice were killed by cervical dislocation until the fifth week (35 days), and tumors were resected and measured for weight and volume.
hsa-miR-148a-3p
 Target Gene 
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [486]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
In-vitro Model
 RWPE-1 Normal Homo sapiens CVCL_3791
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
DU145 Prostate carcinoma Homo sapiens CVCL_0105
VCaP Prostate carcinoma Homo sapiens CVCL_2235
LAPC-4 Prostate carcinoma Homo sapiens CVCL_4744
In-vivo Model Sixteen SPF female BALB/c nude mice (6 weeks old, weighing 20-22 g) (SLAC Laboratory Animal, Shanghai, China) were randomly arranged into the sh-NC group and the sh-METTL3 group, with 8 mice per group. After transfected with sh-NC and sh-METTL3, respectively, cells were rinsed with PBS to remove excess medium, detached with 0.25% trypsin, and detachment was terminated with complete medium, followed by centrifugation to collect cell precipitates. Appropriate amounts of physiological saline were added and gently pipetted into single-cell suspensions for cell counting. A total of 3 × 106 cells were resuspended in 50 μL normal saline, mixed with 50 μL 25% Matrigel (1:1), and inoculated subcutaneously into the right inguinal of nude mice. Tumor growth curves were plotted with 7, 14, 21, and 28 days as time points, and the short diameter (a) and long diameter (b) of the tumor were determined using a vernier caliper to estimate the tumor volume V = (a2b)/2. Tumor mass was weighed on a scale. Following 4 weeks, nude mice were euthanized by an intraperitoneal injection of 150 mg/kg pentobarbital (P3761, Sigma). The skin near the tumor was cut short using surgical scissors, and the tumor was separated using ball pointed pliers. The tumors were partially embedded with paraffin for histological examination, and the remaining part was kept at -80°C.
hsa-miR-181a-5p
 Target Gene 
Ageing-related disease [ICD-11: 9B10-9B60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [487]
Responsed Disease Ageing-related disease [ICD-11: 9B10-9B60]
Target Regulation Up regulation
In-vitro Model
 HK-2 [Human kidney] Normal Homo sapiens CVCL_0302
In-vivo Model The mice were randomly separated into four groups (n = 3-5): young mice group (YNG); naturally aging mice group (OLD); PBS-treated mice group (Con); D-gal-treated aging mice group (D-gal). YNG group was the directly purchased mice (8-week-old) actually. OLD group: mice bought continued to be raised in a specific pathogen-free facility (SPF) individually for 24 months. Mice in Con group were injected subcutaneously with phosphate buffered saline (PBS) solution formulated from powder, with the same volume as the D-gal group. Mice from D-gal group were made by injecting (D-gal, 500 mg/kg body weight) daily for 8 weeks, subcutaneously. All animals were kept under a standard environmental condition (25 ± 2 °C; 12-h light-dark cycle) and allowed free access to water and regular sterile chow diets. All animal studies were designed in accordance with ARRIVE guidelines and experiment protocols followed NIH guidelines.
hsa-miR-1908-5p
 Target Gene 
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [488]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
In-vitro Model
NP69SV40T
 N.A. Homo sapiens CVCL_F755
C666-1 Nasopharyngeal carcinoma Homo sapiens CVCL_7949
In-vivo Model Male BALB/c-nude mice (5-week-old) were used in this study. First, the Antigo miR-1908-5p (Antigo-miR) for knocking down miR-1908-5p as well as its negative control (Antigo-NC) were acquired from GenePharma (China). Antigo-miR and Antigo-NC were each introduced into C666-1 cells which were then delivered through the tail of every mouse (n = 3 per group). Thereafter, all mice were raised well, and the long diameter and short diameter of tumors were measured every week. The tumor volume was calculated as tumor volume (mm3) = (short diameter)2 × long diameter/2. After 5 weeks, the mice were euthanized, and their tumors were weighed. All animal protocols were followed in accordance with the Institutional Animal Care and Use Committee of our hospital.
hsa-miR-196b-5p
 Target Gene 
Structural developmental anomalies of teeth and periodontal tissues [ICD-11: LA30]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [489]
Responsed Disease Structural developmental anomalies of teeth and periodontal tissues [ICD-11: LA30.5]
Target Regulation Down regulation
In-vivo Model A total of 2.0 × 106 SCAPs were mixed with 20 mg HA/tricalcium phosphate (Engineering Research Center for Biomaterials, Sichuan University, Chengdu, China) at 37°C for 2 h, and then, the mixture was subcutaneously transplanted into the back of nude mice (10-week-old female, nu/nu).
hsa-mir-19a
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [490]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Responsed Drug Everolimus Approved
 Drug Info 
Target Regulation Up regulation
hsa-mir-19b-1
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [490]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Responsed Drug Everolimus Approved
 Drug Info 
Target Regulation Up regulation
hsa-miR-27a-3p
 Target Gene 
Infantile hemangioma [ICD-11: 2E81]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [491]
Responsed Disease Infantile hemangioma [ICD-11: 2E81]
Responsed Drug Propranolol Approved
 Drug Info 
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [491]
Responsed Disease Infantile hemangioma [ICD-11: 2E81]
Responsed Drug Oxymatrine Investigative
 Drug Info 
hsa_circ_0000677 (Circ_ABCC1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [219]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Apoptosis hsa04210
Cell Process Cell proliferation and metastasis
Cell apoptosis
hsa_circ_0007905 (Circ_STX6)
 Target Gene 
Cataract [ICD-11: 9B10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [492]
Responsed Disease Age-related cataracts [ICD-11: 9B10.0]
Target Regulation Up regulation
In-vitro Model
 B-3 Normal Homo sapiens CVCL_6367
hsa_circ_0072380 (Circ_ZNF131)
 Target Gene 
Gestational diabetes mellitus [ICD-11: JA63]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [493]
Responsed Disease Gestational diabetes mellitus [ICD-11: JA63]
Target Regulation Down regulation
In-vitro Model
 JEG-3 Gestational choriocarcinoma Homo sapiens CVCL_0363
hsa_circ_0124554
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [494]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
In-vitro Model
 DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
In-vivo Model HCT116 cells stably expressing sh-NC or sh-circ_0124554 were diluted to 2 × 106 cells in 0.2 mL phosphate buffer solution and injected into the mice, followed by 6 Gy irradiation once per day for 5 days. Ten days later, the tumor volume was calculated every 5 days for 5 cycles. Mice were sacrificed after 35 days, and the tumors were dissected for further analysis.
hsa_circ_0136959
 Target Gene 
Thyroid Cancer [ICD-11: 2D10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [495]
Responsed Disease Papillary thyroid cancer [ICD-11: 2D10.1]
Hypoxia up-regulated protein 1 (HYOU1)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [496]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Doxil Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
Insulin-like Growth Factor Binding Protein 7 Overlapping Transcript
 Target Gene 
Oosteoarthritis [ICD-11: FA0Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [497]
Responsed Disease Oosteoarthritis [ICD-11: FA0Z]
In-vivo Model 8-week-old male C57BL/6 mice were randomly divided into four groups: Ctrl+AAV-NC group (n = 6), Ctrl+AAV-OT group (n = 6), MIA+AAV-NC group (n = 8), and MIA+ AAV-OT group (n = 8). For the induction of OA, mice were given an intra-articular injection of MIA (Sigma-Aldrich) in the knee. Control mice were given normal saline in the same volume.
Insulin-like growth factor-binding protein 4 (IGFBP4)
 Target Gene 
Endometrial cancer [ICD-11: 2C76]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [498]
Responsed Disease Endometrial cancer [ICD-11: 2C76]
Pathway Response PI3K-Akt signaling pathway hsa04151
NF-kappa B signaling pathway hsa04064
In-vitro Model
 HEC-1-A Endometrial adenocarcinoma Homo sapiens CVCL_0293
In-vivo Model Ten specific pathogen-free (SPF) BALB/c nude mice (4-6 weeks old, 16 ± 2 g) were purchased from Shanghai Experimental Animal Center, Chinese Academy of Sciences. All experimental animals were kept in a SPF-level aseptic layer at 22-26 °C and 55 ± 5% humidity. Nude mice were randomly divided into sh-NC and sh-METTL3 groups, and these mice were anesthetized by intraperitoneal injection of pentobarbital sodium (60 mg/kg). After anesthesia, the right back skin of the nude mice was disinfected with conventional iodine. The mice in the sh-NC group were injected with 0.2 mL HEC-1-A cell suspension (1 × 106), and those in the sh-METTL3 group were injected with an equal volume of HEC-1-A cells that were stably transfected with sh-METTL3. The injector was slowly withdrawn, and the injection site was pressed for about 10 s to prevent an outflow of cell suspension. Three weeks later, the nude mice were euthanized by cervical dislocation, and subcutaneous tumors were separated and weighted. Tumor volume was measured as follows: tumor volume = 1/2 × length × width2.
Inter-alpha-trypsin inhibitor heavy chain H1 (ITIH1)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [499]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug LY2157299 Investigative
 Drug Info 
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model HCC cells stably transfected with a firefly luciferase expression vector (1 × 106 cells 30 μL) were injected into the left liver lobe of 5-week-old male BALB/c nude mice. Luciferase bioluminescence in each mouse was measured at week 6 after injection. Mice in all the groups were sacrificed 8 weeks after injection. ii) For the lung metastasis model, we slowly injected HCC cells (1 × 106cells 100 μL) into 5-week-old male BALB/c nude mice via the tail vein. Six weeks after injection, luciferase bioluminescence was measured, and the mice were then sacrificed. iii) As described in the previous study, 6-8-week-old male wild-type C57BL/6J mice were used for hydrodynamic tail vein injection (HTVi). The pT3-EF1alpha-myr-AKT-HA (human), pT3-EF1alpha-N90-beta-catenin (human), and pT3-EF1alpha-ITIH1 (human) plasmids were constructed by using the pT3-EF1alpha vector. The pooled pT3 plasmids and the Sleeping Beauty transposon plasmid (pCMV-SB) were mixed at a ratio of 25:1 and 20 μg of each pT3 plasmid was used for each mouse.
Interferon regulatory factor 4 (IRF4)
 Target Gene 
Lupus erythematosus [ICD-11: 4A40]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [500]
Responsed Disease Systemic lupus erythematosus [ICD-11: 4A40.0]
Interleukin-12 subunit beta (IL12B)
 Target Gene 
Inflammatory response [ICD-11: MG46]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [501]
Responsed Disease Inflammatory response [ICD-11: MG46]
Cell Process RNA decay
Interleukin-13 (IL13)
 Target Gene 
Allergy [ICD-11: 4A8Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [502]
Responsed Disease Allergy [ICD-11: 4A8Z]
Asthma [ICD-11: CA23]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [502]
Responsed Disease Asthma [ICD-11: CA23]
Interleukin-17A (IL17A)
 Target Gene 
Psoriasis [ICD-11: EA90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [503]
Responsed Disease Psoriasis [ICD-11: EA90]
Target Regulation Up regulation
Intraflagellar transport protein 80 homolog (IFT80)
 Target Gene 
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [504]
Responsed Disease Head and neck squamous carcinoma [ICD-11: 2B6E]
Target Regulation Up regulation
In-vitro Model
 HN4 Clear cell renal cell carcinoma Homo sapiens CVCL_IS30
HN-6 Tongue squamous cell carcinoma Homo sapiens CVCL_8129
WSU-HN30 Pharyngeal squamous cell carcinoma Homo sapiens CVCL_5525
SCC-4 Tongue squamous cell carcinoma Homo sapiens CVCL_1684
SCC-9 Tongue squamous cell carcinoma Homo sapiens CVCL_1685
SCC-25 Tongue squamous cell carcinoma Homo sapiens CVCL_1682
CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
In-vivo Model To determine whether lnc-H2AFV-1 overexpression could enhance tumorigenicity in vivo, 1 × 106 HN6 cells stably transduced with LV-lnc-H2AFV-1 or LV-NC were subcutaneously injected into the right and left flanks of six mice.
Kelch-like protein 5 (KLHL5)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [505]
Responsed Disease Gastric cancer [ICD-11: 2B72]
In-vitro Model
 GES-1 Normal Homo sapiens CVCL_EQ22
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
In-vivo Model Twenty nude mice were used to establish the transfer model. KLHL5 or normal SGC-7901 cells were knocked out using luciferase labeling (Genechem, China) and injected through the tail vein to construct tumor models. After 3 weeks, the tumor growth in mice was observed by small animal imaging technology. After the mice were euthanized, lung tissue was taken to observe tumor metastasis. In addition, eight nude mice were subcutaneously implanted with high/low KLHL5-expressing mass tissues from human subjects to evaluate the effect of KLHL5 on xenograft tumor proliferation.
Krueppel-like factor 6 (KLF6)
 Target Gene 
Injury of heart [ICD-11: NB31]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [506]
Responsed Disease Myocardial injury [ICD-11: NB31.Z]
Target Regulation Up regulation
In-vitro Model
 HL-1 Normal Mus musculus CVCL_0303
Krueppel-like factor 9 (KLF9)
 Target Gene 
Obesity [ICD-11: 5B81]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [507]
Responsed Disease Obesity [ICD-11: 5B81]
Responsed Drug Methyl piperidine-3-carboxylate Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 3T3-L1 Normal Mus musculus CVCL_0123
HEK293T Normal Homo sapiens CVCL_0063
AAV-293
 N.A. Homo sapiens CVCL_6871
In-vivo Model For compound treatment, mice were intraperitoneally injected with methyl piperidine-3-carboxylate (MP3C) (Shanghai Aladdin Biochemical Technology) at 2.5 mg/kg every 3 days for 2 weeks.
LCAT3
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [47]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Calu-1 Lung squamous cell carcinoma Homo sapiens CVCL_0608
HEK293T Normal Homo sapiens CVCL_0063
HOP-62 Lung adenocarcinoma Homo sapiens CVCL_1285
In-vivo Model For the in vivo tumorigenicity assay, female BALB/c nude mice (ages 4-5 weeks) were randomly divided into two groups (n = 6/group). Calu1 cells (4 × 106) that had been stably transfected with sh-LCAT3 or scramble were implanted subcutaneously into the nude mice. Tumor growth was measured after one week, and tumor volumes were calculated with the following formula: Volume (cm3) = (length × width2)/2. After four weeks, the mice were euthanized, and the tumors were collected and weighed. For the in vivo tumor invasion assay, 1.2 × 106 scramble or shLCAT3 cells were injected intravenously into the tail vein of nude mice (n = 6/group). 1.5 mg luciferin (Gold Biotech, St Louis, MO, USA) was administered once a week for 4 weeks, to monitor metastases using an IVIS@ Lumina II system (Caliper Life Sciences, Hopkinton, MA, USA).
Response Summary LCAT3 upregulation is attributable to N6-methyladenosine (m6A) modification mediated by methyltransferase like 3 (METTL3), leading to LCAT3 stabilization. LCAT3 as a novel oncogenic lncRNA in the lung, and validated the LCAT3-FUBP1-MYC axis as a potential therapeutic target for lung adenocarcinomas.
Lithostathine-1-alpha (REG1A)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [508]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 NCM460 Normal Homo sapiens CVCL_0460
FHC Normal Homo sapiens CVCL_3688
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
In-vivo Model For in vivo lung metastases model, a total of 2 × 106 CRC cells with REG1alpha-overexpression or REG1alpha-knockdown were injected into nude mice via lateral tail vein. Six weeks after injection, the mice were sacrificed and the lung tissues were collected.
Lnc668
 Target Gene 
Silicosis [ICD-11: CA60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [509]
Responsed Disease Pulmonary fibrosis [ICD-11: CA60]
Target Regulation Up regulation
Lnc_D63785
 Target Gene 
Unspecific body region injury [ICD-11: ND56]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [394]
Responsed Disease Unspecific body region injury [ICD-11: ND56]
Target Regulation Down regulation
Cell Process Neuronal cell apoptosis
In-vitro Model
 SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
Response Summary Oxygen glucose deprivation/re-oxygenation (OGD/R) induces neuronal injury via mechanisms that are believed to mimic the pathways associated with brain ischemia. METTL3 shRNA reversed OGD/R-induced Lnc_D63785 m6A methylation to decrease miR-422a accumulation.
Long intergenic non-protein coding RNA 1638 (LINC01638)
 Target Gene 
Periodontitis [ICD-11: DA0C]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [510]
Responsed Disease Periodontitis [ICD-11: DA0C]
Target Regulation Up regulation
long intergenic non-protein coding RNA 294 (LINC00294)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [294]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
PLC/PRF/5 Adult hepatocellular carcinoma Homo sapiens CVCL_0485
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Long intergenic non-protein coding RNA 426 (LINC00426)
 Target Gene 
Cervical cancer [ICD-11: 2C77]
In total 3 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [511]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Responsed Drug Bleomycin Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
In-vivo Model HeLa cells were stably transfected with LINC00426 overexpression lentivirus. Subsequently, for subcutaneously implanted tumor model, mice were randomly divided into two groups, and cells (1 × 107/100 μl) mixed with the same volume of matrix gel were injected subcutaneously into the right abdomen of mice. One month later the mice were executed and the tumors were stripped and weighed, measured for volume, and used for further analysis. For tumor metastasis assay, mice were randomly grouped, and 5 × 105/100 μl HeLa cells transfected with NC and LINC00426 overexpression lentivirus were intravenously injected into the tail vein of BALB/c nude mice which were sacrificed after 1 month.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [511]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
In-vivo Model HeLa cells were stably transfected with LINC00426 overexpression lentivirus. Subsequently, for subcutaneously implanted tumor model, mice were randomly divided into two groups, and cells (1 × 107/100 μl) mixed with the same volume of matrix gel were injected subcutaneously into the right abdomen of mice. One month later the mice were executed and the tumors were stripped and weighed, measured for volume, and used for further analysis. For tumor metastasis assay, mice were randomly grouped, and 5 × 105/100 μl HeLa cells transfected with NC and LINC00426 overexpression lentivirus were intravenously injected into the tail vein of BALB/c nude mice which were sacrificed after 1 month.
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [511]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Responsed Drug Imatinib Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
In-vivo Model HeLa cells were stably transfected with LINC00426 overexpression lentivirus. Subsequently, for subcutaneously implanted tumor model, mice were randomly divided into two groups, and cells (1 × 107/100 μl) mixed with the same volume of matrix gel were injected subcutaneously into the right abdomen of mice. One month later the mice were executed and the tumors were stripped and weighed, measured for volume, and used for further analysis. For tumor metastasis assay, mice were randomly grouped, and 5 × 105/100 μl HeLa cells transfected with NC and LINC00426 overexpression lentivirus were intravenously injected into the tail vein of BALB/c nude mice which were sacrificed after 1 month.
Long intergenic non-protein coding RNA 662 (LINC00662)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [512]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Up regulation
In-vitro Model
 PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
COLO 357 Pancreatic adenosquamous carcinoma Homo sapiens CVCL_0221
CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
Human Pancreatic Nestin-Expressing cells (Human Pancreatic Nestin-Expressing cells)
In-vivo Model For the tumor growth study, nude mice were subcutaneously inoculated into the flanks with PC cells (3 × 106) suspended in 0.1 mL PBS. Tumor volumes were calculated as 1/2 (length × width2) weekly. After 4 weeks, the xenograft tumors were harvested for analysis. To examine the role of the FAK inhibitor in tumor growth, nude mice were inoculated subcutaneously into the flanks with 3 × 106 stable cells suspended in 0.1 mL PBS. After 1 week, pre-established tumor xenografts were treated with Y15 (0.5 mg/kg, 2 ×/week × 3) (MCE, New Jersey, China). After another 3 weeks, the xenograft tumors were harvested for analysis. In the metastasis model, PC cells (2 × 106) in 0.1 mL PBS were injected into nude mice through their tail veins. Six weeks later, the lungs were removed for the evaluation of lung metastasis using hematoxylin and eosin (H&E) staining.
Triple-negative breast cancer [ICD-11: 2C6Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [513]
Responsed Disease Triple-negative breast cancer [ICD-11: 2C6Z]
Responsed Drug Docetaxel Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
Long-chain-fatty-acid--CoA ligase 4 (ACSL4)
 Target Gene 
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [514]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Target Regulation Up regulation
Injury of blood vessels of thorax [ICD-11: NB30]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [515]
Responsed Disease Sepsis-associated lung injury [ICD-11: NB30.4]
Responsed Drug STM2457 Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
MLE-12
 N.A. Mus musculus CVCL_3751
In-vivo Model To investigate the effect of lactate on sepsis-induced lung injury, sodium oxalate (0.75 g/kg body weight, Selleck, S6871) [18] or 2-DG (0.5 g/kg body weight, Selleck, S4701) [19] was injected intraperitoneally 3 h before CLP or sham operation to inhibit lactate production. To suppress METTL3 levels, mice were injected with STM2457 (30 mg/kg body weight, MedChemExpress, HY-134836) 12 h before CLP or sham surgery, with a supplemental injection of STM2457 before surgery.
Lysine-specific demethylase 6B (KDM6B)
 Target Gene 
Inflammatory response [ICD-11: MG46]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [516]
Responsed Disease Inflammatory response [ICD-11: MG46]
Target Regulation Down regulation
In-vitro Model
 THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
HEK293T Normal Homo sapiens CVCL_0063
m7GpppN-mRNA hydrolase (DCP2)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [517]
Responsed Disease Small cell lung cancer [ICD-11: 2C25.1]
Responsed Drug STM2457 Investigative
 Drug Info 
Target Regulation Down regulation
In-vitro Model
H-69
 N.A. Homo sapiens CVCL_8121
H69AR Lung small cell carcinoma Homo sapiens CVCL_3513
H446 Lung small cell carcinoma Homo sapiens CVCL_1562
HBE1
 N.A. Homo sapiens CVCL_0287
In-vivo Model SCLC cells were collected, and cell suspensions were prepared at a concentration of 1 × 106 cells per 100 μL PBS and injected subcutaneously into nude mice. When the tumour volume reached 60 mm3, mice were randomly divided into control and treatment groups with five mice in each group. The mice in the treatment group were treated regularly, and chemotherapy drugs (CDDP 3 mg/kg and VP16 2 mg/kg) were administered via intraperitoneal injection.
MAP kinase-activated protein kinase 2 (MAPKAPK2)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [291]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
Methyltransferase-like protein 1 (METTL1)
 Target Gene 
Cutaneous squamous cell carcinoma [ICD-11: 2C31]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [518]
Responsed Disease Neck squamous cell carcinoma [ICD-11: 2C31.Z]
Target Regulation Up regulation
Cell Process Cell proliferation
In-vitro Model
 SCC-4 Tongue squamous cell carcinoma Homo sapiens CVCL_1684
miR-17-92
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [490]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Responsed Drug Everolimus Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response mTOR signaling pathway hsa04150
PI3K-Akt signaling pathway hsa04151
Cell Process miRNA maturation
In-vitro Model
 MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
In-vivo Model For subcutaneous xenograft models, 0.1 mL of cell suspension containing 106 cells were injected subcutaneously into the right flank of mice (n = 6 for each group).
Response Summary In gastric cancer, m6A facilitated processing of pri-miR-17-92 into the miR-17-92 cluster through an m6A/DGCR8-dependent mechanism. METTL3-high tumors showed preferred sensitivity to an mTOR inhibitor, everolimus.
Mu-type opioid receptor (OPRM1)
 Target Gene 
Pain disorders [ICD-11: 8E43]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [520]
Responsed Disease Neuropathic pain [ICD-11: 8E43.0]
In-vivo Model Male Sprague-Dawley rats (8-10 weeks old) weighing 200-250 g were purchased from Guangdong Medical Experimental Animal Cente [License No. SCXX (Guangdong) 2018-0002]. Animals were hosted in a centralized location in the Experimental Animal Center of the Third People's Hospital of Shenzhen [License No. SYXK (Guangdong) 2017-0120], with a standardized circadian cycle of 12 h for light and darkness at 20-25 °C and 55-60% humidity. Food pellets and water were provided ad libitum in specific-pathogen-free cages. All rats entered the experiment after 7 days of quarantine in the animal room without any abnormalities (normal activity and weight, normal gait, etc.). Thirty-four rats were randomly divided into 4 groups: 1 Sham operation group (Sham group, n = 7): only the right sciatic nerve trunk was exposed without ligation; 2 Chronic constriction injury (CCI) model group (NPP group, n = 7): the right sciatic nerve was exposed and ligated; 3 Intrathecal injection of AAV-METTL3 shRNA + CCI model group( M3 + NPP group, n = 10): AAV-METTL3 shRNA was intrathecally injected, and the right sciatic nerve was ligated after 19 days; 4 Intrathecal injection of negative control virus + CCI model group (Scr + NPP group, n = 10): AAV-scrambled shRNA was intrathecally injected, and the right sciatic nerve was ligated 19 days later. This experiment has been approved by the Animal Ethics Committee of the Third People's Hospital of Shenzhen (IACUC: 2019019), and strictly follows the 3 R principle of reduction, refinement and replacement in animal experiments.
Myosin-3 (MYH3)
 Target Gene 
Cardiomyopathy [ICD-11: BC43]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [521]
Responsed Disease Cardiomyopathy [ICD-11: BC43]
Target Regulation Down regulation
In-vitro Model
 H9c2(2-1) Normal Rattus norvegicus CVCL_0286
In-vivo Model Eight-week-old male SD rats were purchased from SPF (Beijing) biotechnology co., LTD (Animal certificate number: 1103212101024214414). After the animals were kept for 7 days for environmental adaptation, the production of animal models was started. The rats were divided into 4 groups, control group, sepsis group, siMETTL3 group and sepsis+siMETTL3 group respectively. siMETTL3 was given at a dose of 5 nmol/ time/animal by tail vein injection. Doses were given every 3 days for a total of 18 days (i.e., 6 doses). The sepsis model was established by intraperitoneal injection of LPS (5 mg/kg) 24 h after the end of administration, the survival rate of LPS-treated mice was 75 % [[47], [48], [49]]. The control group was intraperitoneally injected with the same volume of normal saline. Echocardiography was performed 6 h after LPS injection. The animals were anesthetized by isoflavane induction and cardiac functions were evaluated by transthoracic echocardiography with an ultrasound machine (VisualSonics USA vevo 2100). The serum was stored in the refrigerator at 4 °C for 1 h and centrifuged for 3000r for 15 min. The packaged erum was stored at -80 °C for subsequent detection. The apical tissue was cut into 1 mm × 1 mm tissue blocks and placed in the electron microscope liquid at 4 °C for electron microscope detection.
N-myc proto-oncogene protein (MYCN)
 Target Gene 
Developmental anomalies [ICD-11: LD9Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [522]
Responsed Disease Developmental anomalies [ICD-11: LD9Z]
Target Regulation Down regulation
In-vitro Model
 E14 Lung carcinoma Homo sapiens CVCL_B4P5
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
HEK293T Normal Homo sapiens CVCL_0063
N-terminal Xaa-Pro-Lys N-methyltransferase 1 (NTMT1)
 Target Gene 
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [523]
Responsed Disease Head and neck squamous carcinoma [ICD-11: 2B6E]
Target Regulation Up regulation
In-vitro Model
 CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
FaDu Hypopharyngeal squamous cell carcinoma Homo sapiens CVCL_1218
NEDD4 family-interacting protein 1 (NDFIP1)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [524]
Responsed Disease Intrahepatic cholangiocarcinoma [ICD-11: 2C12.10]
Target Regulation Down regulation
In-vitro Model
 HIBEpic (Human intrahepatic bile duct epithelial cells)
HuCC-T1 Intrahepatic cholangiocarcinoma Homo sapiens CVCL_0324
RBE Intrahepatic cholangiocarcinoma Homo sapiens CVCL_4896
HCCC-9810 Intrahepatic cholangiocarcinoma Homo sapiens CVCL_6908
In-vivo Model Mice were housed in a specific pathogen-free animal facility with a 12-h light-dark cycle. Lentivirus-infected HUCCT1 or HCCC-9810 cells (4 × 106) were suspended in 0.1 mL of phosphate-buffered saline and were subcutaneously injected into the right flank of nude mice. Tumor size was monitored every 4 days for a total of 28 days, and tumor volume was calculated as length × width2/2. After 4 weeks, the mice were euthanized by intraperitoneal injection of 200 mg/kg sodium pentobarbital. Then, tumor tissues were excised and weighed for further analysis.
Neuronal acetylcholine receptor subunit alpha-4 (CHRNA4)
 Target Gene 
Cognitive disorders [ICD-11: 6E0Z]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [525]
Responsed Disease Cognitive disorders [ICD-11: 6E0Z]
Responsed Drug Bisphenol A Investigative
 Drug Info 
Target Regulation Up regulation
In-vivo Model Rats were tested in the Morris Water Maze (MWM) after PND 60. The experimental device was a circular tank with a diameter of 120 cm and depth of 40 cm, containing water held at a constant 23 ± 1 °C. Rats were allowed to swim to a settled platform (a round, clear acrylic panel) for no more than 90 s with its top surface submerged 1.5 cm below the water level. Caramel was dissolved in water to ensuring that rats cannot directly observe the platform position. Rats were released from different positions in the water maze, and each rat performed four trials daily for five days. The escape latency was automatically recorded. On the sixth day, the rats were given a 90-s retention trial in which the platform was removed, and the mean speed, relative time in zone 2 and relative distance in zone 2 were recorded.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [525]
Responsed Disease Cognitive disorders [ICD-11: 6E0Z]
Responsed Drug STM2457 Investigative
 Drug Info 
Target Regulation Up regulation
In-vivo Model Rats were tested in the Morris Water Maze (MWM) after PND 60. The experimental device was a circular tank with a diameter of 120 cm and depth of 40 cm, containing water held at a constant 23 ± 1 °C. Rats were allowed to swim to a settled platform (a round, clear acrylic panel) for no more than 90 s with its top surface submerged 1.5 cm below the water level. Caramel was dissolved in water to ensuring that rats cannot directly observe the platform position. Rats were released from different positions in the water maze, and each rat performed four trials daily for five days. The escape latency was automatically recorded. On the sixth day, the rats were given a 90-s retention trial in which the platform was removed, and the mean speed, relative time in zone 2 and relative distance in zone 2 were recorded.
Neurosecretory protein VGF [Cleaved into: Neuroendocrine regulatory peptide-1 (VGF)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [479]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
In-vivo Model For the in vivo tumor formation assay, transfected A549 cells (1 × 107) were injected subcutaneously into the right thigh of female BALBc nude mice. One month after transplantation, the mice were sacrificed and the tissue samples were measured, weighed, and immunohistochemically analyzed. The tumor volume was calculated by the formula 1/2 × length × width2. Female BALB/c nude mice were purchased from Beijing SPF (Beijing, China) and were grouped randomly (5 or 6 mice per group).
Neurotrophic factor BDNF precursor form (BDNF)
 Target Gene 
Endometrial cancer [ICD-11: 2C76]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [526]
Responsed Disease Endometrial cancer [ICD-11: 2C76]
Target Regulation Up regulation
In-vitro Model
 KLE Endometrial adenocarcinoma Homo sapiens CVCL_1329
AN3-CA Endometrial adenocarcinoma Homo sapiens CVCL_0028
In-vivo Model The mice were randomly divided into four groups (n=5 per group), labeled as OE-vector (caudal vein injection of 2×106 AN3CA cells), OE-SLERT (caudal vein injection of 2×106 SLERT-overexpressing AN3CA cells), OE-SLERT+ASO-BDNF (caudal vein injection of 2×106 SLERT-overexpressing AN3CA cells transfected with ASO-BDNF), and OE-SLERT+k252a (caudal vein injection of 2×106 SLERT-overexpressing AN3CA cells and intraperitoneal injection of 25μg/kg k252a). After 4 weeks, the lung tissues were dissected and weighted, followed by H&E staining.
Single episode depressive disorder, severe, without psychotic symptoms [ICD-11: 6A70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [421]
Responsed Disease Major depressive disorder [ICD-11: 6A70.3]
In-vitro Model
 SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
In-vivo Model Rats were housed at 23°C and 55% humidity and were given ad libitum food and water. During acclimatization (1 week), rats were placed randomly (3/cage); however, after initial behavioral testing, they were grouped according to their behavioral phenotypes. All experiments were performed under a light cycle (8:00 AM and 10:00 AM). The protocol to induce LH behavior was approved by the Institutional Animal Care and Use Committee of the University of Alabama at Birmingham. The animal study also adhered to the international guidelines for the use and care of laboratory animals.
NPC1-like intracellular cholesterol transporter 1 (NPC1L1)
 Target Gene 
Atherosclerosis [ICD-11: BD40]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [527]
Responsed Disease Atherosclerosis [ICD-11: BD40.Z]
Pathway Response MAPK signaling pathway hsa04010
In-vitro Model
HUVEC-CS
 N.A. Homo sapiens CVCL_0F27
In-vivo Model Eight-week-old male ApoE-/- and C57BL/6J mice were purchased from GemPharmatech Co., Ltd. All mice were housed in a 12-h light-dark environment with free access to food and water. ApoE-/- mice were fed a high-fat diet (21% crude fat, 0.15% cholesterol, 19.5% casein) for 8 weeks to establish an animal model of AS. C57BL/6J mice in control group were kept on a normal diet. Next, the modeled animals were randomly divided into 3 groups (n = 10): (1) mice in the AS group were fed with HFD for 8 weeks; (2) mice in the AS + sh-NC group were given Ad-sh-NC (2 × 109 pfu/mouse) injection every 14 days through the tail vein for 8 weeks, during which HFD was used to feed mice; (3) mice in the AS + sh-NPC1L1 group were given Ad-sh-NPC1L1 (2 × 109 pfu/mouse) injection every 14 days through the tail vein for 8 weeks, during which HFD was used to feed mice.
Nuclear factor of activated T-cells 5 (NFAT5)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [528]
Responsed Disease Intrahepatic cholangiocarcinoma [ICD-11: 2C12.10]
Responsed Drug Gemcitabine Approved
 Drug Info 
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [528]
Responsed Disease Intrahepatic cholangiocarcinoma [ICD-11: 2C12.10]
Responsed Drug STM2457 Investigative
 Drug Info 
Nuclear pore complex protein Nup214 (NUP214)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [529]
Responsed Disease Brain cancer [ICD-11: 2A00]
Target Regulation Up regulation
Nuclear receptor subfamily 4 group A member 2 (NR4A2)
 Target Gene 
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [530]
Responsed Disease Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
Responsed Drug Celecoxib Approved
 Drug Info 
In-vitro Model
 KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
Eca-109 Esophageal squamous cell carcinoma Homo sapiens CVCL_6898
KYSE-450 Esophageal squamous cell carcinoma Homo sapiens CVCL_1353
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
HET-1A Normal Homo sapiens CVCL_3702
HEK293T Normal Homo sapiens CVCL_0063
NUTM2B antisense RNA 1 (NUTM2B-AS1)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [531]
Responsed Disease Liver cancer [ICD-11: 2C12]
Target Regulation Up regulation
OIP5 antisense RNA 1 (OIP5-AS1)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [532]
Responsed Disease Gastric cancer [ICD-11: 2B72]
In-vitro Model
 MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
GES-1 Normal Homo sapiens CVCL_EQ22
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model Female BALB/c nude mice aged 4 weeks old were adopted. In the subcutaneous xenograft tumor, GC cells (2 × 106/200 μl) were subcutaneously injected into the mice flank.
Optineurin (OPTN)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [533]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Target Regulation Down regulation
Oxidized low-density lipoprotein receptor 1 (OLR1)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [534]
Responsed Disease Glioma [ICD-11: 2A00.0]
Responsed Drug Temozolomide Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 U-343MG Glioblastoma Homo sapiens CVCL_S471
U-251MG Astrocytoma Homo sapiens CVCL_0021
p-P70
 Target Gene 
Renal cell carcinoma [ICD-11: 2C90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [109]
Responsed Disease Renal cell carcinoma [ICD-11: 2C90]
Target Regulation Down regulation
Cell Process Epithelial-to-mesenchymal transition
Arrest cell cycle at G0/G1 phase
In-vitro Model
 ACHN Papillary renal cell carcinoma Homo sapiens CVCL_1067
Caki-1 Clear cell renal cell carcinoma Homo sapiens CVCL_0234
Caki-2 Papillary renal cell carcinoma Homo sapiens CVCL_0235
HK2 Normal Acipenser baerii CVCL_YE28
In-vivo Model Cells (5×106 cells in 200 uL) were suspended with 100 uL PBS and 100 uL Matrigel Matrix, and injected subcutaneously into the left armpit of each mouse.
Response Summary Knockdown of METTL3 could obviously promote cell proliferation, migration and invasion function, and induce G0/G1 arrest,METTL3 acts as a novel marker for tumorigenesis, development and survival of RCC. Knockdown of METTL3 promoted changes in pI3K/AKT/mTOR markers' expression with a gain in p-PI3k, p-AKT, p-mTOR and p-P70, and a loss of p-4EBP1.
Paired box protein Pax-8 (PAX8)
 Target Gene 
Thyroid Cancer [ICD-11: 2D10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [535]
Responsed Disease Thyroid Cancer [ICD-11: 2D10]
Responsed Drug Sodium iodide I 131 Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 B-CPAP Thyroid gland carcinoma Homo sapiens CVCL_0153
KTC-1 Thyroid carcinoma Homo sapiens CVCL_6300
TPC-1 Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
K1 Thyroid gland papillary carcinoma Homo sapiens CVCL_2537
CAL-62 Thyroid gland anaplastic carcinoma Homo sapiens CVCL_1112
C-643 Thyroid gland anaplastic carcinoma Homo sapiens CVCL_5969
Nthy-ori 3-1 Normal Homo sapiens CVCL_2659
In-vivo Model A concentration of 1 × 107 CAL62 cells stably transfected with OE METTL3 or OE METTL3/shPAX8-transfected CAL-62 cells were injected subcutaneously into the dorsal flanks of the mice (five mice per group) to establish a xenograft model.
Pappalysin-1 (PAPPA)
 Target Gene 
Endometrial cancer [ICD-11: 2C76]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [498]
Responsed Disease Endometrial cancer [ICD-11: 2C76]
Pathway Response PI3K-Akt signaling pathway hsa04151
NF-kappa B signaling pathway hsa04064
In-vitro Model
 HEC-1-A Endometrial adenocarcinoma Homo sapiens CVCL_0293
In-vivo Model Ten specific pathogen-free (SPF) BALB/c nude mice (4-6 weeks old, 16 ± 2 g) were purchased from Shanghai Experimental Animal Center, Chinese Academy of Sciences. All experimental animals were kept in a SPF-level aseptic layer at 22-26 °C and 55 ± 5% humidity. Nude mice were randomly divided into sh-NC and sh-METTL3 groups, and these mice were anesthetized by intraperitoneal injection of pentobarbital sodium (60 mg/kg). After anesthesia, the right back skin of the nude mice was disinfected with conventional iodine. The mice in the sh-NC group were injected with 0.2 mL HEC-1-A cell suspension (1 × 106), and those in the sh-METTL3 group were injected with an equal volume of HEC-1-A cells that were stably transfected with sh-METTL3. The injector was slowly withdrawn, and the injection site was pressed for about 10 s to prevent an outflow of cell suspension. Three weeks later, the nude mice were euthanized by cervical dislocation, and subcutaneous tumors were separated and weighted. Tumor volume was measured as follows: tumor volume = 1/2 × length × width2.
Phosphoenolpyruvate carboxykinase [GTP], mitochondrial (PCK2)
 Target Gene 
Hepatic inflammation [ICD-11: DB97]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [536]
Responsed Disease Hepatic inflammation [ICD-11: DB97]
Target Regulation Up regulation
Phosphoglycerate kinase 1 (PGK1)
 Target Gene 
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [484]
Responsed Disease Prostate cancer [ICD-11: 2C82]
In-vitro Model
 VCaP Prostate carcinoma Homo sapiens CVCL_2235
DU145 Prostate carcinoma Homo sapiens CVCL_0105
HNC PC3 Retromolar trigone squamous cell carcinoma Homo sapiens CVCL_C8XA
RWPE-2
 N.A. Homo sapiens CVCL_3792
Phospholipid hydroperoxide glutathione peroxidase GPX4 (GPX4)
 Target Gene 
Ovarian dysfunction [ICD-11: 5A80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [537]
Responsed Disease Polycystic ovary syndrome [ICD-11: 5A80.1]
In-vivo Model PCOS mice model was induced by the continuous subcutaneous injection of dehydroepiandrosterone (DHEA, GAOYUANbio, China) with a concentration of 60 mg/kg every day for 3 weeks. Meanwhile, mice in control group were subcutaneously injected with an equal volume of sesame oil. After three weeks, PCOS mice were divided into sh-NC and sh-METTL3 groups at random (n = 10). The ovary of mice in sh-NC group or sh-METTL3 group were subcutaneously injected with sh-NC or sh-METTL3 lentivirus at the concentration of 5 times; 108 PFU/mL synthesized by Shanghai GenePharma, Ltd. The estrus cycle, ovarian weight and follicular development were recorded 14 days following lentivirus infection. The ovary samples were collected for analysis.
Phosphoserine aminotransferase (PSAT1)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 3 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Lenvatinib Approved
 Drug Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/6 days off treatment regimen was applied.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Sorafenib Approved
 Drug Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/5 days off treatment regimen was applied.
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug STM2457 Investigative
 Drug Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/7 days off treatment regimen was applied.
Phosphoserine phosphatase (PSPH)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 3 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Lenvatinib Approved
 Drug Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/9 days off treatment regimen was applied.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Sorafenib Approved
 Drug Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/8 days off treatment regimen was applied.
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug STM2457 Investigative
 Drug Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/9 days off treatment regimen was applied.
Pirin (PIR)
 Target Gene 
Melanoma of uvea [ICD-11: 2D0Y]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [538]
Responsed Disease Melanoma of uvea [ICD-11: 2D0Y]
Target Regulation Up regulation
Pituitary homeobox 3 (PTX3)
 Target Gene 
Asthma [ICD-11: CA23]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [539]
Responsed Disease Allergic asthma [ICD-11: CA23.0]
Target Regulation Down regulation
In-vitro Model
 THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
In-vivo Model Briefly, the Mettl3 targeting vector was designed to flank exon 2-3 with LoxP sites and electroporated into C57BL/6 embryonic stem cells (ES). Positive ES clones were confirmed by PCR and sequencing, and injected into C57BL/6 blastocysts to generate chimeric offspring. Chimeric mice were mated with C57BL/6 mice to obtain Mettl3flox/flox mice. These Mettl3flox/flox mice were crossed with Lyz2-Cre mice (The Jackson Laboratory) to generate Mettl3fl/fl (WT) and Mettl3fl/flLyz2Cre/+ (KO) mice.
PncRNA-D
 Target Gene 
Liposarcoma [ICD-11: 2B59]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [540]
Responsed Disease Liposarcoma [ICD-11: 2B59]
Target Regulation Down regulation
Pathway Response Cell cycle hsa04110
Cell Process Cell cycle
In-vitro Model
 HAP1 Chronic myelogenous leukemia Homo sapiens CVCL_Y019
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Response Summary Knockdown of METTL3 prolonged the half-life of PncRNA-D, and among the known m6A recognition proteins, YTHDC1 was responsible for binding m6A of pncRNA-D Knockdown of METTL3 or YTHDC1 also enhanced the interaction of pncRNA-D with TLS, and results from RNA pulldown assays implicated YTHDC1 in the inhibitory effect on the TLS-pncRNA-D interaction.
Polyamine-transporting ATPase 13A3 (ATP13A3)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [541]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 HCoEpiC (Healthy colon epithelial HCoEpiC cells)
In-vivo Model The nude mice were randomly assigned to two groups consisting of six mice each. We injected transformed cells (P0 and P40) into the flank of each mouse in 0.1 mL of sterile PBS to form xenograft tumors. The tumor volume was measured every 2 or 3 days (volume = length × width2 × 1/2). The tumors were resected, imaged, and weighed after the mice were sacrificed. One piece of each tumor tissue was fixed in 4% (v/v) paraformaldehyde for hematoxylin and eosin (H&E) and immunohistochemistry (IHC) staining, and the remaining tissue was stored at -80 °C.
Polyunsaturated fatty acid lipoxygenase ALOX12 (ALOX12)
 Target Gene 
Renal cell carcinoma [ICD-11: 2C90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [277]
Responsed Disease Renal cell carcinoma [ICD-11: 2C90]
Responsed Drug Erianin Investigative
 Drug Info 
Target Regulation Down regulation
pre-miR-665
 Target Gene 
Structural developmental anomalies of teeth and periodontal tissues [ICD-11: LA30]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [482]
Responsed Disease Structural developmental anomalies of teeth and periodontal tissues [ICD-11: LA30.0]
pri-miR-143
 Target Gene 
Acute myocardial infarction [ICD-11: BA41]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [542]
Responsed Disease Acute myocardial infarction [ICD-11: BA41]
Target Regulation Down regulation
In-vitro Model
 neonatal ventricular myocytes (Mouse hearts were enzymatically digested to acquire the primary neonatal ventricular myocytes)
AC16 [Human hybrid cardiomyocyte] Normal Homo sapiens CVCL_4U18
Response Summary METTL3 deficiency contributes to heart regeneration after MI via METTL3-pri-miR-143-(miR-143)-Yap/Ctnnd1 axis.
pri-miR-196b
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [543]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
In-vitro Model
 HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Caco-2 Colon adenocarcinoma Homo sapiens CVCL_0025
pri-miR-27
 Target Gene 
Multiple myeloma [ICD-11: 2A83]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [228]
Responsed Disease Multiple myeloma [ICD-11: 2A83.1]
Target Regulation Down regulation
Cell Process Cell apoptosis
In-vitro Model
 U266 (Human multiple myeloma cells)
RPMI-8226 Plasma cell myeloma Homo sapiens CVCL_0014
NCI-H929 Plasma cell myeloma Homo sapiens CVCL_1600
MM1.S Plasma cell myeloma Homo sapiens CVCL_8792
In-vivo Model BALB/C nude mice (5 weeks old, weighing 18-22 g) were fed in specific pathogen-free facilities and subcutaneously inoculated with U266 cells (1 × 106). The mice were randomly divided into 3 groups with 6 mice per group, when the tumor was measurable. Then, miR-27a-3p mimic or sh-METTL3 was injected intratumorally at an interval of 4 days a total of 4 times. Tumor volume was measured using a digital caliper every week and calculated using the formula V = 1/2 (width2 × length).
Response Summary METTL3 affected the growth, apoptosis, and stemness of MM cells through accelerating the stability of YY1 mRNA and the maturation of pri-miR-27 in vitro and in vivo.
pri-miR-935
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [544]
Responsed Disease Intrahepatic cholangiocarcinoma [ICD-11: 2C12.10]
Target Regulation Up regulation
In-vitro Model
 JEG-3 Gestational choriocarcinoma Homo sapiens CVCL_0363
JAR Gestational choriocarcinoma Homo sapiens CVCL_0360
HTR-8/SVneo Normal Homo sapiens CVCL_7162
HUVEC-CS
 N.A. Homo sapiens CVCL_0F27
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model The animals were first injected with JAR cells for 7 days, and the mice in AgomiR-935 group, AgomiR-NC group, AntagomiR-935 group, and AntagomiR-NC group were injected via tail vein with miR-935 agomiR (2 nmoL, Ribobio), miR-935 antagomiR (5 nmoL, Ribobio), or same dosage of negative controls (Ribobio) every 3 days for 2 weeks.
Procathepsin L (CTSL)
 Target Gene 
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [545]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Up regulation
In-vitro Model
 Ca Ski Cervical squamous cell carcinoma Homo sapiens CVCL_1100
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
HEK293-FT Normal Homo sapiens CVCL_6911
In-vivo Model Female BALB/c nude mice (4-5 weeks old) were purchased from the Center of Experimental Animals of Guangdong. To establish a tail vein metastasis model, 2 × 106 SiHa cells in 200 μl PBS were injected into the tail vein of each mouse (n = 6 for both METTL3-overexpressing and empty vector groups). The mice were killed at approximately 8 weeks, and lung tissues were isolated and embedded in paraffin. Hematoxylin and eosin staining was then used to determine the number of lung metastasis nodules. To establish the popliteal lymph node metastasis model, 1 × 106 SiHa cells in 50 μl PBS were injected subcutaneously into the footpad of each mouse (n = 6 for both groups). Cells from the experimental and control groups were inoculated under the right and left footpads of each mouse, respectively. After 8 weeks, the popliteal lymph nodes were excised.
Prostaglandin E2 receptor EP4 subtype (PTGER2)
 Target Gene 
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [546]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Responsed Drug Carboplatin Approved
 Drug Info 
Target Regulation Up regulation
Protein E6 (E6)
 Target Gene 
Malignant neoplasms of tonsil [ICD-11: 2B69]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [547]
Responsed Disease Malignant neoplasms of tonsil [ICD-11: 2B69]
Target Regulation Up regulation
In-vitro Model
 WSU-HN26 Squamous cell carcinoma of the oral cavity Homo sapiens CVCL_5523
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
C33A2 (The C33A2 cell line originates from C33A and has the subgenomic HPV16 plasmid pBELsLuc stably integrated into the genome)
Response Summary Overexpression of the ALKBH5 promoted production of intron retention on the human papillomavirus type 16 (HPV16) E6 mRNAs thereby promoting Protein E6 (E6) mRNA production.METLL3 induced production of intron-containing HPV16 E1 mRNAs over spliced E2 mRNAs and altered HPV16 L1 mRNA splicing in a manner opposite to ALKBH5. Overexpression of YTHDC1, enhanced retention of the E6-encoding intron and promoted E6 mRNA production. HPV16 mRNAs are m6A-methylated in tonsillar cancer cells.
Protein mono-ADP-ribosyltransferase PARP10 (PARP10)
 Target Gene 
Cardiomegaly [ICD-11: BC45]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [548]
Responsed Disease Cardiomegaly [ICD-11: BC45]
Target Regulation Down regulation
Protein NLRC5
 Target Gene 
Endometrial cancer [ICD-11: 2C76]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [549]
Responsed Disease Endometrial cancer [ICD-11: 2C76]
Target Regulation Up regulation
Protein SON
 Target Gene 
Inflammatory response [ICD-11: MG46]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [550]
Responsed Disease Inflammatory response [ICD-11: MG46]
Target Regulation Up regulation
Protein-tyrosine kinase 2-beta (PYK2)
 Target Gene 
Inflammatory response [ICD-11: MG46]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [551]
Responsed Disease Inflammatory response [ICD-11: MG46]
In-vitro Model
 RAW 264.7 Mouse leukemia Mus musculus CVCL_0493
Pseudorabies Virus (PRV)
 Target Gene 
Rabies [ICD-11: 1C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [552]
Responsed Disease Rabies [ICD-11: 1C82]
Responsed Drug 3-deazidenosine Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
PK-15
 N.A. Sus scrofa CVCL_2160
Putative microRNA 17 host gene protein (MIR17HG)
 Target Gene 
Endometriosis [ICD-11: GA10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [553]
Responsed Disease Endometriosis [ICD-11: GA10]
Target Regulation Up regulation
Ras-related C3 botulinum toxin substrate 3 (RAC3)
 Target Gene 
Cancer-associated fibroblasts [ICD-11: XH45F3]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [554]
Responsed Disease Cancer-associated fibroblasts [ICD-11: XH45F3]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
NF-kappa B signaling pathway hsa04064
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H661 Lung large cell carcinoma Homo sapiens CVCL_1577
In-vivo Model Nude mice were assigned randomly into two groups. For the first group, 2.5×106 A549 cells were injected subcutaneously into the right flank of mice, and 2.5×106 A549 cells mixed with 5×106 CAFs were injected into the left flank. For the second group, 2.5×106 A549-METTL3-KD cells were injected into the right flank, and A549-METTL3-KD cells mixed with 5×106 CAFs were injected into the left flank. Tumor volumes were measured every week.
Ras-related protein R-Ras (RRAS)
 Target Gene 
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [555]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Down regulation
In-vitro Model
 SV-HUC-1 Normal Homo sapiens CVCL_3798
UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
T24 Bladder carcinoma Homo sapiens CVCL_0554
J82 Bladder carcinoma Homo sapiens CVCL_0359
TCCSUP Bladder carcinoma Homo sapiens CVCL_1738
5637 Bladder carcinoma Homo sapiens CVCL_0126
In-vivo Model A total of 16 male, 4- to 6-week-old BALB/c nude mice weighing 18-26 g, were purchased from the Institute of Model Animals, Nanjing University and raised in a specific pathogen-free (SPF) environment for the xenograft model. The mice were raised in animal individually ventilated cage (IVC cages) with a room temperature of 24°C and relative humidity of 70% and the air exchange rate was 15 times/h. The mice could drink filtered tap water and commercial feed ad libitum under a strict 12-h light/dark cycle. The animal laboratory was cleaned twice one day and sterilized with ultraviolet light for 1 h each week. Each mouse was injected with 100 μl PBS containing 1×106 T24 cell lines expressing either LV-NC or LV-shMETTL3 subcutaneously under the right armpit. Tumor volumes were recorded on day 7 after the injection and then measured each week. At day 28, the mice were sacrificed by cervical dislocation following the inhalation of 3% isoflurane anesthesia and the death of the mice was confirmed by respiratory arrest. Tumor weights were also compared. The data from each group of mice are expressed as the mean ± standard deviation (SD).
Receptor-interacting serine/threonine-protein kinase 3 (RIP3)
 Target Gene 
Aortic aneurysm or dissection [ICD-11: BD50]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [556]
Responsed Disease Abdominal aortic aneurysm [ICD-11: BD50.4]
Target Regulation Up regulation
Receptor-interacting serine/threonine-protein kinase 4 (RIPK4)
 Target Gene 
Malignant mixed epithelial mesenchymal tumour [ICD-11: 2B5D]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [557]
Responsed Disease Malignant mixed epithelial mesenchymal tumour of ovary [ICD-11: 2B5D.0]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response NF-kappa B signaling pathway hsa04064
In-vitro Model
 SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
A2780 Ovarian endometrioid adenocarcinoma Homo sapiens CVCL_0134
In-vivo Model Animals were purchased from Changzhou Cavens Laboratory Animal Company (Changzhou, China) and maintained under specific pathogen-free (SPF) conditions. All animal experiments were performed in accordance with the guidelines of the Laboratory Animal Health Committee of Jiangsu University. Approximately 1 × 107 cells were injected subcutaneously into the dorsal surface of female BALB/c nude mice (n = 5 for each group, 4 weeks old, 15 ± 2 g). When the xenograft volume reached approximately 60 mm3 (after 1 week), DDP was intraperitoneally injected three times per week for 3 weeks. On Day 28, the mice were sacrificed and the tumors were frozen at -80 °C for follow-up experiments.
Retinaldehyde dehydrogenase 3 (ALDH1A3)
 Target Gene 
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [412]
Responsed Disease Head and neck squamous carcinoma [ICD-11: 2B6E]
In-vitro Model
 SCC-9 Tongue squamous cell carcinoma Homo sapiens CVCL_1685
In-vivo Model Bmi1CreER and RosatdTomato mice were obtained from The Jackson Laboratory, while Mettl3flox/flox and Mettl3KI/KI mice were provided from the laboratory of Prof. Quan Yuan at the West China Hospital of Stomatology. As previously described, we treated mice with 100 μg/mL 4-nitroquinoline 1-oxide (4NQO) (Sigma, N8141) to induce HNSCC formation. In brief, 6-week-old mice were fed with 4NQO for 16 weeks and then normal water for another 10 weeks. To lineage tracing and conditional knockout and knockin mouse model, tamoxifen (1 mg/mouse/day for 3 days; Sigma, T5648-1G) was injected intraperitoneally after 4NQO treatment. Then, we collected tongue samples, made frozen sections, and observed sections under a fluorescence microscope to calculate the positive percentage of BMI1 cells.+.
Retinoic Acid Receptor Alpha-Retinoic Acid Receptor Alpha (PML-RARalpha)
 Target Gene 
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [558]
Responsed Disease Blood malignancies [ICD-11: 2B33.Y]
Target Regulation Up regulation
Cell Process Cell differentiation
Ribose-5-phosphate isomerase (RPIA)
 Target Gene 
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [419]
Responsed Disease Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
Cell Process Transcription
Cell proliferation
Cell migration
Cell invasion
Ribosome-binding protein 1 (RRBP1)
 Target Gene 
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [559]
Responsed Disease Prostate cancer [ICD-11: 2C82]
In-vitro Model
 HNC PC3 Retromolar trigone squamous cell carcinoma Homo sapiens CVCL_C8XA
DU145 Prostate carcinoma Homo sapiens CVCL_0105
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
VCaP Prostate carcinoma Homo sapiens CVCL_2235
In-vivo Model Approximately 1 × 106 PCa cells (PC3-shNC, PC3-sh812 cell lines) or 2 × 106 DU145 cells (DU145-shNC, DU145-sh812, DU145-OENC, DU145-OEMETTL3-WT, DU145-OEMETTL3-Mut cell lines) per injection were suspended in a mixture of 100 μL PBS and Matrigel (1:1), and then injected subcutaneously into male BALB/c nude mice aged around 6 ~ 7 weeks old. Tumor volume was monitored at regular intervals and the volume was calculated as (length × width2)/2. Finally, the mice were sacrificed and the tumors were dissected and weighed.
RNA component of 7SK nuclear ribonucleoprotein (RN7SK)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [561]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H23 Lung adenocarcinoma Homo sapiens CVCL_1547
HEK293T Normal Homo sapiens CVCL_0063
NCI-H2009 Lung adenocarcinoma Homo sapiens CVCL_1514
MRC-5 Normal Homo sapiens CVCL_0440
RNA-binding protein 25 (RBM25)
 Target Gene 
Multiple myeloma [ICD-11: 2A83]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [356]
Responsed Disease Multiple myeloma [ICD-11: 2A83.1]
Responsed Drug Metformin Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 NCI-H929 Plasma cell myeloma Homo sapiens CVCL_1600
MM1.S Plasma cell myeloma Homo sapiens CVCL_8792
In-vivo Model 5-week-old male athymic BALB/C nude mice were obtained from Experimental animal center of Fujian Medical University, and subsequently randomly divided into four groups (5 mice per group), including control, metformin, pcDNA-METTL3 and pcDNA-METTL3 + metformin. For the control or metformin group, to induce tumors, 5 × 105 H929 cells were suspended in 0.2 ml phosphate buffered saline and inoculated subcutaneously into the peritoneum of mice. Once the subcutaneous nodules grown to a rice grain size (required approximately a week), the subcutaneous xenograft model of MM in nude mice was successfully constructed. One week later, PBS or Metformin was diluted in drinking water (2 mg/ml) and administered orally throughout the indicated time periods. For the pcDNA-METTL3 group and pcDNA-METTL3 + metformin group, firstly, we transfected pcDNA-METTL3 into H929 cells to overexpress METTL3, and then 5 × 105 H929 cells were suspended in 0.2 ml phosphate-buffered saline and inoculated subcutaneously into the peritoneum of mice. One week later, PBS or Metformin was diluted in drinking water (2 mg/ml) and administered orally throughout the indicated time periods. All nude mice were closely monitored for tumor growth, skin condition, and behavior daily and any tumor ulceration or irritation was noted. Tumor length and width were calculated with vernier calipers every 7 days. After 35 days, the mice were humanely sacrificed, and the subcutaneous tumors were excised and removed.
RNF32 divergent transcript (RNF32-DT)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [562]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
In-vivo Model Before subcutaneous injection, A549 cells were seeded into T-75 flask (Corning, USA) and transfected with vectors (control vector, LINC01006 overexpression and METTL3 overexpression, 10 μg respectively) or siRNA pools (LINC01006 and METTL3, 100 nM respectively) by Lipofectamine 2000 (Invitrogen, USA) based on the provided protocol when cell confluence reached 80%. After 48 h, counted 1x107 transfected A549 cells and suspended in 100 ul PBS. The suspended cells were injected into the same side armpit of mice.
Sal-like protein 4 (SALL4)
 Target Gene 
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [563]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
In-vitro Model
 SCC-9 Tongue squamous cell carcinoma Homo sapiens CVCL_1685
SCC-15 Tongue squamous cell carcinoma Homo sapiens CVCL_1681
CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
Semaphorin-3F (SEMA3F)
 Target Gene 
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [564]
Responsed Disease Prostate cancer [ICD-11: 2C82]
In-vitro Model
 RWPE-1 Normal Homo sapiens CVCL_3791
DU145 Prostate carcinoma Homo sapiens CVCL_0105
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
22Rv1 Prostate carcinoma Homo sapiens CVCL_1045
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
LNCaP C4-2B Prostate carcinoma Homo sapiens CVCL_4784
VCaP Prostate carcinoma Homo sapiens CVCL_2235
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model All the animal studies and protocols followed the institutional guidelines of the First Affiliated Hospital, School of Medicine, Zhejiang University.
Serine/threonine-protein kinase B-raf (BRAF)
 Target Gene 
Atherosclerosis [ICD-11: BD40]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [565]
Responsed Disease Atherosclerosis [ICD-11: BD40.Z]
Target Regulation Up regulation
In-vitro Model
 RAW 264.7 Mouse leukemia Mus musculus CVCL_0493
HEK293T Normal Homo sapiens CVCL_0063
Serine/threonine-protein kinase LATS1 (LATS1)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [566]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Down regulation
In-vitro Model
 SK-BR-3 Breast adenocarcinoma Homo sapiens CVCL_0033
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
T-47D Invasive breast carcinoma Homo sapiens CVCL_0553
BT-474 Invasive breast carcinoma Homo sapiens CVCL_0179
MDA-MB-468 Breast adenocarcinoma Homo sapiens CVCL_0419
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model All animal experiments were approved by the Institutional Animal Care and Use Committee of Southern Medical University. Breast cancer cells (5 × 106) were implanted into the subcutaneous axilla of the forelimb of 3-4-week-old BALB/c nude mice. Seven days after transplantation, the diameter of the tumors was measured, and the tumors were removed after three weeks.
Serine/threonine-protein kinase Nek2 (NEK2)
 Target Gene 
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [567]
Responsed Disease Cervical cancer [ICD-11: 2C77]
In-vitro Model
 HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Serine/threonine-protein kinase Nek6 (NEK6)
 Target Gene 
Traumatic brain injury induced by controlled cortical impact injury [ICD-11: NA07]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [568]
Responsed Disease Traumatic brain injury induced by controlled cortical impact injury [ICD-11: NA07]
Responsed Drug Rapamycin Approved
 Drug Info 
In-vitro Model
 SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
Serine/threonine-protein kinase Nek7 (NEK7)
 Target Gene 
Intracerebral hemorrhage [ICD-11: 8B00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [569]
Responsed Disease Intracerebral hemorrhage [ICD-11: 8B00]
Target Regulation Down regulation
In-vitro Model
 HT22 Normal Mus musculus CVCL_0321
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [570]
Responsed Disease Osteoarthritis [ICD-11: FA05]
In-vivo Model Twenty male healthy C57BL/6J mice (10 weeks) were purchased from the National Rodent Laboratory Animal Resources Center (Shanghai, China). All mice were raised and treated in accordance with the procedures set by the Animal Resource Center of our School of Medicine. We referred to the experiment of Xu and Xu. 32 Fifteen mice were randomly selected for medial meniscus (DMM) resection to establish mice models of OA knee joint. Sham operation was performed on mice in sham group. Two weeks after DMM operation, 10 mice were randomly selected and divided into 2 groups. Mice in both groups were injected weekly with 5 μg sh-METTL3 or sh-NC (GenePharma). Six weeks after surgery, knee joint specimens were collected for analysis.
SET-binding protein (SETBP1)
 Target Gene 
Myelodysplastic neoplasms [ICD-11: 2A4Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [571]
Responsed Disease Myelodysplastic neoplasms [ICD-11: 2A4Z]
In-vivo Model In the first in vivo experiment focused on investigating the role of METTL14 in MDS cell proliferation in vivo, the MDS-L-luc cells were transduced with the Dox-inducible shMETTL14 (shMETTL14_Tet-on). After treatment with 2 μg/mL puromycin for a duration of 4 days, a total of 2.5 × 106 selected cells were injected via the tail vein into irradiated female NCG-M mice aged 8-10 weeks (GemPharmatech, China) to establish cell line-derived xenograft (CDX) models. On day 14 post transplantation, 20 mice were randomly assigned to two groups and treated with either Dox or vehicle. A total of 2 mg Dox was dissolved in water and administered by gastric lavage once a day. Five mice from each group underwent in vivo chemiluminescence imaging on day 14, 21, and 28 after receiving intraperitoneal injection of luciferin (Promega, USA). Their overall survival (OS) was also observed and documented. The remaining five mice from each group were utilized to assess the proportions of human CD45+cells in bone marrow and peripheral blood on day 28 through flow cytometry analysis.
SH3 domain-binding protein 5 (SH3BP5)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [572]
Responsed Disease Lung cancer [ICD-11: 2C25]
Target Regulation Up regulation
In-vitro Model
 NCI-H522 Lung adenocarcinoma Homo sapiens CVCL_1567
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
WI-38 Normal Homo sapiens CVCL_0579
IMR-90 Normal Homo sapiens CVCL_0347
Signal transducer and activator of transcription 5B (STAT5B)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [573]
Responsed Disease Breast cancer [ICD-11: 2C60]
In-vitro Model
 MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
HEK293 Normal Homo sapiens CVCL_0045
In-vivo Model The mice were randomly allocated to four groups, with the specific number of mice detailed in each experiment. Subsequently, cells were injected into the abdominal mammary glands of the mice (2 × 106 cells in 100 μL) and allowed to grow until tumor formation occurred within 16 days. The tumor volume at the time of sacrifice was calculated using the formula, Volume = 0.5 × [(largest diameter) × (smallest diameter)^2]. The study protocol was approved by the Animal Experiments Committee of Chosun University (CIACUC 2020-S0022).
SLC7A11 antisense RNA 1 (SLC7A11-AS1)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [574]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
SREBF2 antisense RNA 1 (SREBF2-AS1)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [575]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Sorafenib Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
SNU-398 Adult hepatocellular carcinoma Homo sapiens CVCL_0077
THLE-2 Normal Homo sapiens CVCL_3803
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Sterile alpha motif domain-containing protein 9-like (SAMD9L)
 Target Gene 
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [419]
Responsed Disease Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
Cell Process Transcription
Cell proliferation
Cell migration
Cell invasion
Tafazzin (TAFAZZIN)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [291]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
Taurine up-regulated 1 protein (TUG1)
 Target Gene 
Diabetic [ICD-11: 5A14]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [576]
Responsed Disease Diabetic [ICD-11: 5A14]
Target Regulation Up regulation
In-vitro Model
 GC-1 spg Normal Mus musculus CVCL_8872
In-vivo Model STZ-induced diabetic mice were further divided into three groups: STZ, STZ+pcDNA3.1, and STZ+METTL3. Animals in the STZ+METTL3 group were intravenously injected with pAd-METTL3 vectors (109 plaque forming unit per mouse), while those in the STZ+pcDNA3.1 group were injected with pAd-NC vectors (109 plaque forming unit per mouse). The STZ group was administered with phosphate-buffered saline following the same procedure. After another 4 weeks, all mice were euthanized. Their serum and testicular tissues were collected for further analysis.
Tenascin (TNC)
 Target Gene 
Acute myocardial infarction [ICD-11: BA41]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [577]
Responsed Disease Acute myocardial infarction [ICD-11: BA41]
Target Regulation Up regulation
In-vitro Model
 HL-1 Normal Mus musculus CVCL_0303
AC16 [Human hybrid cardiomyocyte] Normal Homo sapiens CVCL_4U18
In-vivo Model METTL3 and TNC overexpression model was achieved by in situ injection of overexpression AAV9 into the heart of C57/BL mice, and the injected virus titers were 1.8 × 1012 PFU/mL. The stable overexpression of METTL3 and overexpression of TNC could be obtained after 3 weeks. The overexpression AAV9 was purchased from Hanheng Biotechnology Co., Ltd. (Shanghai, China). The vector was HBAAV2/9-CMV-m-METTL3-3xflag-Null and HBAAV2/9-CMV-m-TNC-3xflag-Null.
Thyroid hormone receptor-associated protein 3 (THRAP3)
 Target Gene 
Multiple myeloma [ICD-11: 2A83]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [356]
Responsed Disease Multiple myeloma [ICD-11: 2A83.1]
Responsed Drug Metformin Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 NCI-H929 Plasma cell myeloma Homo sapiens CVCL_1600
MM1.S Plasma cell myeloma Homo sapiens CVCL_8792
In-vivo Model 5-week-old male athymic BALB/C nude mice were obtained from Experimental animal center of Fujian Medical University, and subsequently randomly divided into four groups (5 mice per group), including control, metformin, pcDNA-METTL3 and pcDNA-METTL3 + metformin. For the control or metformin group, to induce tumors, 5 × 105 H929 cells were suspended in 0.2 ml phosphate buffered saline and inoculated subcutaneously into the peritoneum of mice. Once the subcutaneous nodules grown to a rice grain size (required approximately a week), the subcutaneous xenograft model of MM in nude mice was successfully constructed. One week later, PBS or Metformin was diluted in drinking water (2 mg/ml) and administered orally throughout the indicated time periods. For the pcDNA-METTL3 group and pcDNA-METTL3 + metformin group, firstly, we transfected pcDNA-METTL3 into H929 cells to overexpress METTL3, and then 5 × 105 H929 cells were suspended in 0.2 ml phosphate-buffered saline and inoculated subcutaneously into the peritoneum of mice. One week later, PBS or Metformin was diluted in drinking water (2 mg/ml) and administered orally throughout the indicated time periods. All nude mice were closely monitored for tumor growth, skin condition, and behavior daily and any tumor ulceration or irritation was noted. Tumor length and width were calculated with vernier calipers every 7 days. After 35 days, the mice were humanely sacrificed, and the subcutaneous tumors were excised and removed.
Toll-like receptor 2 (TLR2)
 Target Gene 
Intervertebral disc degeneration [ICD-11: FA80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [578]
Responsed Disease Intervertebral disc degeneration [ICD-11: FA80]
In-vivo Model Rats were anesthetized with 40 mg/kg sodium pentobarbital. A 21G needle was used to puncture discs 7-8 (Co7-8) from the back through the skin of the tail. The length of the needle was predetermined to ensure a puncture depth of approximately 5 mm. After penetrating the annulus, the needle was rotated 360° and held for 30 seconds to injure the annulus. The sham group underwent the same procedure but without puncture injury to the caudal disc.
Transcription factor GATA-6 (GATA6)
 Target Gene 
Injury of other or unspecified intrathoracic organs [ICD-11: NB32]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [579]
Responsed Disease Injury of other or unspecified intrathoracic organs [ICD-11: NB32.3]
Target Regulation Down regulation
In-vitro Model
 BEAS-2B Normal Homo sapiens CVCL_0168
In-vivo Model To perform in vivo plasmid transfection, the researchers mixed the pcDNA3.1-EGFP-METTL3 plasmid with in vivo jetPEI (Polyplus-transfection; Illkirch) per the manufacturer's guidelines. They mixed 40 μg of plasmid nucleic acid in 5% glucose (25 μl) with 6.4 μl of jetPEI solution in 5% glucose (25 μl) to obtain a final nitrogen and phosphorus ratio of 8. The mixture was incubated at room temperature for 30 minutes to form stable complexes before tracheal intubation of mice.
Transcription factor SOX-6 (SOX6)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [580]
Responsed Disease Intrahepatic cholangiocarcinoma [ICD-11: 2C12.10]
Target Regulation Up regulation
Transcription factor SOX-9 (SOX9)
 Target Gene 
Rheumatoid arthritis [ICD-11: FA20]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [581]
Responsed Disease Rheumatoid arthritis [ICD-11: FA20]
Transcriptional enhancer factor TEF-1 (TEAD1)
 Target Gene 
Liver disease [ICD-11: DB9Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [582]
Responsed Disease Liver disease [ICD-11: DB9Z]
Target Regulation Up regulation
Transient receptor potential cation channel subfamily M member 7 (TRPM7)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [583]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation Up regulation
In-vitro Model
 NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
Calu-1 Lung squamous cell carcinoma Homo sapiens CVCL_0608
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
BEAS-2B Normal Homo sapiens CVCL_0168
In-vivo Model The BALB/c nude mice (male, 4-6 weeks) were provided via Vital River Laboratory Animal Technology (Beijing, China). For xenograft tumor growth assay, 15 mice were randomly classified into 3 groups (n = 5/group), including control, sh-NC or sh-DGUOK-AS1 group. In sh-NC or sh-DGUOK-AS1 group, mice were subcutaneously injected with SK-MES-1 cells (3 × 106) stably transfected with sh-NC or sh-DGUOK-AS1; Moreover, mice were subcutaneously injected with non-transfected SK-MES-1 cells (3 × 106) as control group. The tumors were monitored every 7 days, and size was calculated by (length × width2)/2. Mice were euthanized after 4 weeks, and the tumors were collected and weighed, followed via collection for further analyses. Ki67 and CD31 levels were measured through immunohistochemistry staining using Ki67 (ab15580, 1:2000 dilution, Abcam) or CD31 (ab18298, 1:3000 dilution, Abcam) according to the protocols. For pulmonary metastatic assay, 3 × 106 SK-MES-1 cells stably transfected with sh-NC or sh-DGUOK-AS1 or non-transfected SK-MES-1 cells were intravenously injected into mice. Mice were sacrificed after 8 weeks, and lung specimens were collected, followed by hematoxylin-eosin (HE) staining assay for metastatic lesions in lung tissues. All experiments were approved via the Animal Ethics Committee of The Second Hospital of Shandong University.
Transmembrane protein 127 (TMEM127)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [584]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Rapamycin Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
T-47D Invasive breast carcinoma Homo sapiens CVCL_0553
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model Approximately 1 × 106 viable MDA-MB-231 breast cancer cells were resuspended in 1:1 ratio in 50 μl medium and 50 μl matrigel (Corning, 354234) and injected orthotopically into the fourth mammary fat pad of each mouse. After injection, tumor size was measured twice a week using an electronic caliper. Tumor volumes were calculated with the formula: volume = (L × W2)/2, where L is the tumor length and W is the tumor width measured in millimeters.
Tribbles homolog 3 (TRIB3)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [585]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Tumor-associated calcium signal transducer 2 (TROP2)
 Target Gene 
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [586]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Ubiquitin carboxyl-terminal hydrolase 13 (USP13)
 Target Gene 
Gastrointestinal stromal tumor [ICD-11: 2B5B]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [587]
Responsed Disease Gastrointestinal stromal tumor [ICD-11: 2B5B]
Responsed Drug 3-Methyladenine Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
In-vivo Model 6 × 106 logarithmically growing GIST cells resuspended in 100 μL PBS were injected subcutaneously into the flank of 6-week-old female nude mice for tumor growth assays. The following treatments were initiated when the tumor volume reached approximately 300 mm3. (1) IM-sensitive GIST cell lines and IM-resistant GIST cell lines were used to establish a subcutaneous xenograft model of GIST (n = 6 mice/group). When the tumors grew to the required size, mice were treated with IM via drinking water; (2) GIST cells were pretreated with USP13 lentivirus or USP13 control lentivirus. In addition, IM-resistant GIST cells were pretreated with USP13 inhibitors or control. These lentivirus-transfected cells were implanted into subcutaneous mice tumors to construct the USP13 positive, USP13-negative, and control groups (n = 6 mice/group). When the transplanted tumor grew to the required volume, mice in each group were treated with IM via drinking water. (3) IM-resistant GIST cells-xenografted mice and control mice were treated with USP13 inhibitors or with USP13 inhibitors and autophagy inhibitors in combination therapy to assess reversal of IM resistance (n = 6 mice/group). Mice were treated with IM (45 mg/kg/day) and with or without 3-MA (15 mg/kg/day) via drinking water when the tumors grew to the required size. The USP13 inhibitor Spautin-1 was used at 20 mg/kg/day when required.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [587]
Responsed Disease Gastrointestinal stromal tumor [ICD-11: 2B5B]
Responsed Drug Spautin 1 Preclinical
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
In-vivo Model 6 × 106 logarithmically growing GIST cells resuspended in 100 μL PBS were injected subcutaneously into the flank of 6-week-old female nude mice for tumor growth assays. The following treatments were initiated when the tumor volume reached approximately 300 mm3. (1) IM-sensitive GIST cell lines and IM-resistant GIST cell lines were used to establish a subcutaneous xenograft model of GIST (n = 6 mice/group). When the tumors grew to the required size, mice were treated with IM via drinking water; (2) GIST cells were pretreated with USP13 lentivirus or USP13 control lentivirus. In addition, IM-resistant GIST cells were pretreated with USP13 inhibitors or control. These lentivirus-transfected cells were implanted into subcutaneous mice tumors to construct the USP13 positive, USP13-negative, and control groups (n = 6 mice/group). When the transplanted tumor grew to the required volume, mice in each group were treated with IM via drinking water. (3) IM-resistant GIST cells-xenografted mice and control mice were treated with USP13 inhibitors or with USP13 inhibitors and autophagy inhibitors in combination therapy to assess reversal of IM resistance (n = 6 mice/group). Mice were treated with IM (45 mg/kg/day) and with or without 3-MA (15 mg/kg/day) via drinking water when the tumors grew to the required size. The USP13 inhibitor Spautin-1 was used at 20 mg/kg/day when required.
Wnt family member 7B (WNT7B)
 Target Gene 
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [419]
Responsed Disease Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
Cell Process Transcription
Cell proliferation
Cell migration
Cell invasion
X-ray repair cross-complementing protein 5 (XRCC5)
 Target Gene 
Genotoxicity [ICD-11: XE2PA]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [286]
Responsed Disease Genotoxicity [ICD-11: XE2PA]
Target Regulation Up regulation
In-vitro Model
GC-2spd(ts)
 N.A. Mus musculus CVCL_6633
In-vivo Model Corn oil (control group), 1 mg/kg/day DEHP (low-dose: D1 group), 250 mg/kg/day DEHP (middle-dose: D250 group), and 500 mg/kg/day DEHP (high-dose: D500 group).
Zinc finger and BTB domain-containing protein 7C (ZBTB7C)
 Target Gene 
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [588]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Responsed Drug STM2457 Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 MNNG/HOS Cl #5 Osteosarcoma Homo sapiens CVCL_0439
MG-63 Osteosarcoma Homo sapiens CVCL_0426
L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
hFOB 1.19 Normal Homo sapiens CVCL_3708
In-vivo Model (1) ZBTB7C functional assay in vivo, 2 × 106 MNNG/HOS cells were stably transfected with lentivirus (vector control and si-ZBTB7C, n = 5), and then subcutaneously incubated in BALB/c nude mice; (2) STM2457 intervention. MNNG/HOS cells were implanted subcutaneously first. When tumors reached approximately 80-100 mm3, PBS or STM2457 (30 mg/kg (STM-30), 60 mg/kg (STM-60), n = 4) were administered every 2 days; (3) ZBTB7C effects of STM2457 assay. Mice were assigned to 4 groups (n = 5 per group). Two groups had MNNG/HOS cells stably transfected with lentiviral vectors (Ctrl) and 2 with lentivirus-mediated ZBTB7C overexpression (ZBTB7C-OE), and then mice were treated with control vehicle or STM2457 (60 mg/kg), respectively. The experiments went on for 22 days, and the xenografted tumors were measured, weighted, and characterized by H&E and IHC staining.
Zinc transporter ZIP9 (SLC39A9)
 Target Gene 
Periodontitis [ICD-11: DA0C]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [589]
Responsed Disease Periodontitis [ICD-11: DA0C]
Target Regulation Down regulation
Unspecific Target Gene
Viral infections [ICD-11: 1D9Y]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [591]
Responsed Disease Viral infections [ICD-11: 1D9Y]
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
Response Summary m6A is the most abundant internal modification described in eukaryotic mRNA and several viral RNA including human respiratory syncytial virus (HRSV) infection. METTL3/METTL14 m6A writer complex plays a negative role in HRSV infections protein synthesis and viral titers, while m6A erasers FTO and ALKBH5 had the opposite effect.
Herpes infection [ICD-11: 1F00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [592]
Responsed Disease Herpes infection [ICD-11: 1F00]
In-vitro Model
 HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
RD Embryonal rhabdomyosarcoma Homo sapiens CVCL_1649
Response Summary METTL3 knockdown suppressed the HSV-1 intermediate early and early genes (ICP0, ICP8 and UL23) and late genes (VP16, UL44, UL49 and ICP47). The components of m6A modification machinery, particularly m6A initiator METTL3 and reader YTHDF3, would be potential important targets for combating herpes virus type 1 (HSV-1) infections.
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [593]
Responsed Disease Glioma [ICD-11: 2A00.0]
Cell Process RNA editing
In-vitro Model
 GSC Glioma Epinephelus akaara CVCL_M752
MGG8 (The primary tumor)
Response Summary METTL3 plays a vital role in many steps of RNA processing and orchestrates successful execution of oncogenic pathways in Glioma.
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [595]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
In-vitro Model
 EoL-1 Chronic eosinophilic leukemia Homo sapiens CVCL_0258
HL-60 Adult acute myeloid leukemia Homo sapiens CVCL_0002
Kasumi-1 Myeloid leukemia with maturation Homo sapiens CVCL_0589
MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
In-vivo Model 6- to 10-week-old female Rosa26Cas9/+ mice were treated daily for two weeks with either vehicle or 50 mg kg-1 STM2457 (STORM). Four weeks after treatment, bone marrow cells from these mice were freshly dissected (as mentioned above) and blocked with anti-mouse CD16/32 (BD Pharmigen, cat. no. 553142) and 10% mouse serum (Sigma).
Response Summary Inhibition of METTL3 by STM2457 targets key stem cell populations of acute myeloid leukaemia and reverses the AML phenotype, preventing or slowing the development of AML in re-transplantation experiments.
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [596]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
In-vitro Model
 HOK Normal Hexagrammos otakii CVCL_YE19
HN-6 Tongue squamous cell carcinoma Homo sapiens CVCL_8129
HN-5 Squamous cell carcinoma of the oral cavity Homo sapiens CVCL_8128
HN-15 Squamous cell carcinoma of the oral cavity Homo sapiens CVCL_W297
Response Summary METTL3 and METTL14 are overexpressed in OSCC tissues and in the HN6 OSCC cell line that promotes cell proliferation. Overexpressed METTL3 or METTL14 is found to be an independent prognostic factor for short overall survival in patients with OSCC.
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [597]
Responsed Disease Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
KYSE-510 Esophageal squamous cell carcinoma Homo sapiens CVCL_1354
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [598]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
In-vitro Model
 SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
Response Summary The results revealed a negative functional regulation of the LINC01559/miR-106b-5p/PTEN axis in CRC progression and explored a new mechanism of METTL3-mediated m6A modification on LINC01559.
Pancreatic cancer [ICD-11: 2C10]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [599]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Responsed Drug Gemcitabine Approved
 Drug Info 
Pathway Response Adipocytokine signaling pathway hsa04920
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
HDE-CT cell line (A normal human pancreatic cell line)
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response Summary Lasso regression identified a six-m6A-regulator-signature prognostic model (KIAA1429, HNRNPC, METTL3, YTHDF1, IGF2BP2, and IGF2BP3). Gene set enrichment analysis revealed m6A regulators (KIAA1429, HNRNPC, and IGF2BP2) were related to multiple biological behaviors in pancreatic cancer, including adipocytokine signaling, the well vs. poorly differentiated tumor pathway, tumor metastasis pathway, epithelial mesenchymal transition pathway, gemcitabine resistance pathway, and stemness pathway.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [600]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Cell Process Mitogen-activated protein kinase cascades
Ubiquitin-dependent process
RNA splicing
In-vitro Model
 MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response Summary METTL3 was associated with mitogen-activated protein kinase cascades, ubiquitin-dependent process and RNA splicing and regulation of cellular process, suggesting functional roles and targets of METTL3. METTL3 is a potent target for enhancing therapeutic efficacy in patients with pancreatic cancer.
Liver cancer [ICD-11: 2C12]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [602]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Lenvatinib Approved
 Drug Info 
In-vitro Model
 Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model To increase the accuracy of the experimental results in vivo, we subcutaneously transplanted tumor tissues from HCC patients into BALB/c nude mice and then treated the tumor-bearing mice with lenvatinib to establish a Lenvatinib-resistant PDX mode.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [603]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Response Summary METTL3 and YTHDF1 expression were found to be correlated with an increased risk and were included in an m6A-related gene signature for predicting prognosis of hepatocellular carcinoma.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [291]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Cell Process RNA stability
RNA degradation (hsa03018)
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
Response Summary MIR33A can attenuate NSCLC cells proliferation via targeting to the 3'UTR of METTL3 mRNA.
Melanoma [ICD-11: 2C30]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [606]
Responsed Disease Melanoma [ICD-11: 2C30]
Pathway Response PI3K-Akt signaling pathway hsa04151
Cell cycle hsa04110
Cell Process Cell cycle
Cell apoptosis
Cell colony formation
Cell migration
Cell invasion
Response Summary Hsa-miR-302a-3p targets METTL3 and plays tumour suppressive roles in the proliferation, apoptosis, invasion, and migration of melanoma cells.
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [607]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Cell Process Cell apoptosis
In-vitro Model
 CRL-11731D cell line (Human ovarian cancer cell)
TOV-112D Ovarian endometrioid adenocarcinoma Homo sapiens CVCL_3612
Response Summary METTL3 can regulate m6A methylation independently of METTL14 and WTAP in endometrioid epithelial ovarian cancer.
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [608]
Responsed Disease Cervical cancer [ICD-11: 2C77]
In-vitro Model
 HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Response Summary CD33+ MDSC expansion is linked to high levels of METTL3 and that METTL3 and CD33+ MDSCs are independent prognostic factors in CC.
Renal cell carcinoma [ICD-11: 2C90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [609]
Responsed Disease Renal cell carcinoma of kidney [ICD-11: 2C90.0]
Pathway Response mTOR signaling pathway hsa04150
Cell Process Adipogenesis
Response Summary It is plausible that VHL-HIF-METTL3/14 pathways are involved in the m6A regulation in clear cell renal cell carcinoma cells, and PI3K-mTOR as well as p53 signaling pathways are possible downstream targets of m6A in ccRCC.
Hematological disorders [ICD-11: 3C0Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [611]
Responsed Disease Hematological disorders [ICD-11: 3C0Z]
Response Summary This reviewed summarize and discuss recent findings regarding the biological functions and underlying mechanisms of m6A modification(i.e., the METTL3/METTL14/WTAP complex and other cofactor proteins) and the associated machinery in normal hematopoiesis and the initiation, progression, and drug response of acute myeloid leukemia (AML), a major subtype of leukemia usually associated with unfavorable prognosis.
Obesity [ICD-11: 5B81]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [612]
Responsed Disease Obesity [ICD-11: 5B81]
Cell Process Adipogenesis
In-vitro Model
 3T3F442A Normal Mus musculus CVCL_0122
3T3-L1 Normal Mus musculus CVCL_0123
COS (From the African green monkey cell line (CV-1).)
MEF (Mouse embryonic fibroblasts)
In-vivo Model Mice were anesthetized after 24 h of fasting, and 5 U of human insulin (Humalin R; Eli Lilly) was injected into the inferior vena cava. After 5 min, the liver and hind limb muscles were dissected and immediately frozen in liquid nitrogen.
Response Summary WTAP, coupled with METTL3 and METTL14, is increased and distributed in nucleus by the induction of adipogenesis dependently on RNA in vitro Knockdown of each of these three proteins leads to cell cycle arrest and impaired adipogenesis associated with suppression of cyclin A2 upregulation during MCE, whose knockdown also impairs adipogenesis.
Alzheimer disease [ICD-11: 8A20]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [613]
Responsed Disease Alzheimer disease [ICD-11: 8A20]
Cell Process Synaptic or neuron development and growth
Response Summary The alterations of m6A RNA methylation in alzheimer's disease and in C57BL/6 mice were investigated using high-throughput sequencing. The expression of the m6A methyltransferase METTL3 was elevated and that of the m6A demethylase FTO was decreased in AD mice.
Acute ischemic stroke [ICD-11: 8B11]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [616]
Responsed Disease Acute ischemic stroke [ICD-11: 8B11]
In-vivo Model 36 male C57BL/6J mice (20-22 g, 2-month-old) were purchased from SPF (Beijing) biotechnology co., Ltd (Beijing, China) and maintained in the specific pathogen-free (SPF) animal laboratory with a 12/12 h light/dark cycle with free access to food and water. The mice were randomly assigned into six groups (n = 6 per group): (1) sham-operated group (Sham), (2) MCAO 6 h, (3) MCAO 12 h, (4) MCAO 1 d, (5) MCAO 3 d, and (6) MCAO 7 d.
Cerebrovascular diseases [ICD-11: 8B22]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [617]
Responsed Disease Arteriovenous malformation of cerebral vessels [ICD-11: 8B22.40]
Pathway Response Notch signaling pathway hsa04330
In-vitro Model
 HUVEC-C Normal Homo sapiens CVCL_2959
Response Summary The expression level of METTL3 was reduced in the larger pathological tissues of cerebral arteriovenous malformation (AVM). Moreover, knockdown of METTL3 significantly affected angiogenesis of the human endothelial cells.
Muscular dystrophies [ICD-11: 8C70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [618]
Responsed Disease Muscular dystrophies [ICD-11: 8C70]
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
C2C12 Normal Mus musculus CVCL_0188
In-vivo Model For mouse muscle injury and regeneration experiment, tibialis anterior (TA) muscles of six-week-old male mice were injected with 25 uL of 10 uM cardiotoxin (CTX, Merck millipore, 217 503), then the C2C12 cells, which stably overexpressed METTL3 or GFP control, were injected to the injury site of mice on the following day. The regenerated muscles were collected at day 7 post-injection, frozen in liquid nitrogen for RNA and protein extraction.
Response Summary Muscle specific miRNAs are essential for skeletal muscle differentiation. METTL3 regulated the expressions of muscle specific miRNAs by multiple mechanisms.
Cortical development [ICD-11: 8E4Y]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [619]
Responsed Disease Cortical development [ICD-11: 8E4Y]
In-vivo Model Homologous recombination was used, cas9 mRNA, gRNA, and donor vector were microinjected into the fertilized eggs of C57BL/6J mice to obtain F0 generation mice.
Response Summary Knockout of Mettl3 leads to a more severe disruption of translational regulation of mRNAs than deletion of Fto and results in altered translation of crucial genes in cortical radial glial cells and intermediate progenitors. Uncover a profound role of Mettl3 in regulating translation of major mRNAs that control proper cortical development.
Disorders of the retina [ICD-11: 9B70-9C0Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [620]
Responsed Disease Disorders of the retina [ICD-11: 9B70-9C0Z]
Pathway Response Wnt signaling pathway hsa04310
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 ARPE-19 Normal Homo sapiens CVCL_0145
In-vivo Model The vitreous cavity of the right eye of each rat was injected either with ARPE-19 cells (1 × 105 per uL in PBS [pH 7.4]) overexpressing METTL3 or control vector cells or with an equal volume of PBS (pH 7.4).
Response Summary METTL3 is involved in the PVR process, and METTL3 overexpression inhibits the EMT of ARPE-19 cells in vitro and suppresses the PVR process in vivo.
Retinopathy [ICD-11: 9B71]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [621]
Responsed Disease Retinopathy [ICD-11: 9B71]
Cell Process Cell viability
Cell proliferation
Cell migration
In-vitro Model
 HUVEC-C Normal Homo sapiens CVCL_2959
In-vivo Model Mettl3flox/flox mice were crossed with the transgenic Cdh5-CreERT2 mice to generate the Mettl3-ecKO mice. Cdh5-Cre Mettl3flox/flox mice received an intragastric injection of 50 ul tamoxifen (1 mg/mL) at P1-P3 and P5 for Cre activation and Mettl3 knockout. After Mettl3 knockout, the mouse pups and their nursing mothers were exposed to 75% oxygen (hyperoxia) from P7 to P12 in an incubator chamber. Then, the pups were returned to normal oxygen conditions (normoxia).
Response Summary METTL3 knockout in vivo decreased avascular area and pathological neovascular tufts in an oxygen-induced retinopathy model and inhibited alkali burn-induced corneal neovascularization.
Presbycusis [ICD-11: AB54]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [622]
Responsed Disease Presbycusis [ICD-11: AB54]
Cardiomegaly [ICD-11: BC45]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [623]
Responsed Disease Cardiomegaly [ICD-11: BC45]
Responsed Drug A939572 Investigative
 Drug Info 
In-vivo Model Slack Laboratory Animal Co., Ltd. (Shanghai, China) supplied the six-week-old C57BL/6 male mice. Animals were reared at constant temperature (21 ± 1 °C) and maintained in a room with water and food during a 12 h dark/light cycle. After acclimatizing for a week, the animals were randomly assigned to two groups: model (TAC) and control (sham). In the TACgroup, the aortic arch of the mice was constricted using a 27 G needle and 6.0 sutures. The Sham group was operated in the same way as the TAC group without ligation of the aorta. All mice were housed for four weeks for further research.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [624]
Responsed Disease Cardiomegaly [ICD-11: BC45]
Cell Process Heart failure
In-vitro Model
 Neonatal rat ventricular cardiomyocytes (Primary myocyte cells)
In-vivo Model Mettl3 fl/fl mice were crossed with mice expressing cre recombinase under the control of the cardiac-specific Myh7 promoter (Beta-myosin heavy chain [Beta-MHC]) to obtain heart-restricted deletion of Mettl3 (METTL3-cKO; cKO).
Response Summary Inhibition of METTL3 completely abrogated the ability of cardiomyocytes to undergo hypertrophy when stimulated to grow, whereas increased expression of the m6A RNA methylase METTL3 was sufficient to promote cardiomyocyte hypertrophy both in vitro and in vivo.
Asthma [ICD-11: CA23]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [625]
Responsed Disease Allergic asthma [ICD-11: CA23.0]
In-vivo Model Six-week-old male BABL/c mice were purchased from Hunan SJA Laboratory Animal Co., Ltd. The mice were initially divided into four groups, each containing 6 mice: Control group, Control+S. boulardii group, Model group, and Model+S. boulardii group. With reference to the previous OVA method [27,28], the animal model of asthma was established. Mice in Control+S. boulardii and Model+S. boulardii groups were administered 300 μL/day of 1 × 107 CFU/d S. boulardiithrough oral gavage, starting from 6 days prior to the first OVA sensitization and continuing until day 21 [12,29]. The mice in Control and Control+S. boulardiigroups were injected with an equivalent volume of PBS. After the final OVA injection, the mice were challenged with 10 μL of 5 % OVA via intranasal inhalation for one week (day 15 to day 21), with 10 μL introduced into each nostril. The mice in Control and Control+S. boulardii groups were injected with an equivalent volume of PBS. Mice were sacrificed with pentobarbital sodium (150 mg/kg, intraperitoneal injection). On day 22, bronchoalveolar lavage fluid (BALF), intestinal tissue, and lung tissue were collected from all mice.
Liver disease [ICD-11: DB9Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [626]
Responsed Disease Liver disease [ICD-11: DB9Z]
Pathway Response PPAR signaling pathway hsa03320
Cell Process Fatty degeneration
In-vivo Model A total of 24 male mice were randomly allocated to LFD (low-fat diet), LFDR (low-fat diet + resveratrol), HFD (high-fat diet), and HFDR (high-fat diet + resveratrol) groups for 12 weeks (n = 6/group).
Response Summary The beneficial effect of resveratrol on lipid metabolism disorder under HFD is due to a decrease of m6A RNA methylation and an increase of PPARalpha mRNA, providing mechanistic insights into the function of resveratrol in alleviating the disturbance of lipid metabolism in mice. The resveratrol in HFD increased the transcript levels of methyltransferase like 3 (METTL3), alkB homolog 5 (ALKBH5), fat mass and obesity associated protein (FTO), and YTH domain family 2 (YTHDF2), whereas it decreased the level of YTH domain family 3 (YTHDF3) and m6A abundance in mice liver.
Rheumatoid arthritis [ICD-11: FA20]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [627]
Responsed Disease Rheumatoid arthritis [ICD-11: FA20]
Responsed Drug STM2457 Investigative
 Drug Info 
In-vivo Model DBA/1 mice were injected intradermally with 100 μg of bovine type II collagen (CII) emulsified in 50 μL of complete Freund's adjuvant at a 1:1 ratio (vol/vol) as primary immunization on day 0. On day 21, the mice were boosted with CII emulsified at a 1:1 ratio in incomplete Freund's adjuvant. The weight, arthritis score, and thickness of the paws were observed and recorded once every 3 days. Starting on day 21, the CIA mice were administered an equal volume of methotrexate (MTX, 1 mg/kg) and METTL3 inhibitor STM2457 (50 mg/kg), which were intraperitoneally injected with twice a week. All mice were sacrificed and specimens were harvested on day 63.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [628]
Responsed Disease Rheumatoid arthritis [ICD-11: FA20]
Target Regulation Up regulation
Pathway Response TNF signaling pathway hsa04668
Cell Process Inflammation in macrophages
In-vitro Model
 THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
Response Summary LPS could enhance the expression and biological activity of METTL3 in macrophages, while overexpression of METTL3 significantly attenuated the inflammatory response induced by LPS in macrophages.This study firstly demonstrates the critical role of METTL3 in RA, which provides novel insights into recognizing the pathogenesis of Rheumatoid Arthritis(RA) and a promising biomarker for RA.
Low bone mass disorder [ICD-11: FB83]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [629]
Responsed Disease Osteoporosis [ICD-11: FB83.1]
Pathway Response Wnt signaling pathway hsa04310
Cell Process Bone formation
In-vivo Model OP rats were fixed prone, the skin was prepared and the skull was disinfected, resulting in a full-thickness defect of 8mm. BCP incubated with OP-BMSCs was implanted in the skull defect area. After 8 weeks, skull specimens were taken after the rats were euthanized.
Response Summary Overexpression of Mettl3 could partially rescue the decreased bone formation ability of OP-BMSCs by the canonical Wnt signalling pathway. Therefore, Mettl3 can be a key targeted gene for bone generation and therapy of bone defects in OP patients.
Male infertility [ICD-11: GB04]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [630]
Responsed Disease Male infertility [ICD-11: GB04]
Responsed Drug Ethyl ester form of meclofenamic acid Approved
 Drug Info 
Cell Process Cell cycle
Cell proliferation
In-vitro Model
 GC-1 spg Normal Mus musculus CVCL_8872
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model Mouse GC-1 spg cells were treated with the ester form of meclofenamic acid (MA2) to inhibit the demethylase activity of FTO.
Response Summary METTL3, METTL14, ALKBH5 and YTHDC2 are involved in the regulation of spermatogenesis and oogenesis. MA2 affected CDKs expression through the m6A-dependent mRNA degradation pathway, and thus repressed spermatogonial proliferation. Additionally, mutation of the predicted m6A sites in the Cdk2-3'UTR could mitigated the degradation of CDK2 mRNA after MA2 treatment.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [631]
Responsed Disease Male infertility [ICD-11: GB04]
Cell Process SSC proliferation/differentiation
In-vitro Model
 Spermatogenic cells (Prepared from undifferentiated mouse spermatogonial cells)
In-vivo Model All mice described above were maintained on the C57BL/6J (B6) background. Mettl3- and Mettl14-floxed mice (Mettl3flox/flox and Mettl14flox/flox) were then bred with germ cell-specific expressed Cre mice including Vasa-Cre mouse line (Jackson Laboratory, Bar Harbor, Maine, USA) and Stra8-GFPCre mouse line for excising the loxP-flanked exon 4 and exon 2 to generate germ cell-specific Mettl3 and Mettl14KO mice, respectively. Germ cell-specific Mettl3 and Mettl14 double KO mice were obtained by crossing Mettl3flox/floxMettl14flox/flox with Mettl3flox/+Mettl14flox/+ or Mettl3flox/+Mettl14flox/flox carried germ cell-specific expressed Cre mice.
Response Summary Combined deletion of Mettl3 and Mettl14 in advanced germ cells with Stra8-GFPCre disrupts spermiogenesis, whereas mice with single deletion of either Mettl3 or Mettl14 in advanced germ cells show normal spermatogenesis.
Structural developmental anomalies of large intestine [ICD-11: LB16]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [632]
Responsed Disease Structural developmental anomalies of large intestine [ICD-11: LB16.1]
CNS anomalies syndrome [ICD-11: LD20]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [633]
Responsed Disease Pontocerebellar hypoplasia [ICD-11: LD20.01]
Cell Process Extended RNA half-lives and aberrant splicing
Cell apoptosis
In-vitro Model
 CGC (Conjunctival goblet cells)
Neural stem cell (NSC) lines (A group of ectodermal progenitor cells)
In-vivo Model All pups were genotyped and two Mettl3flox/+ founder mice were obtained.
Response Summary METTL3 depletion-induced loss of m6A modification causes extended RNA half-lives and aberrant splicing events, consequently leading to dysregulation of transcriptome-wide gene expression and premature CGC death.Mettl3 in mouse nervous system causes severe developmental defects in the brain.
Senescent cell [ICD-11: MG2A]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [634]
Responsed Disease Senescent cell [ICD-11: MG2A]
Target Regulation Up regulation
Pathway Response nonhomologous end joining NHEJ) pathwa
Inflammatory response [ICD-11: MG46]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [516]
Responsed Disease Inflammatory response [ICD-11: MG46]
In-vitro Model
 THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
HEK293T Normal Homo sapiens CVCL_0063
Injury of liver [ICD-11: NB91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [635]
Responsed Disease Liver injury [ICD-11: NB91.1]
Responsed Drug BHBA Investigative
 Drug Info 
Exposure to radiation [ICD-11: PH73]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [636]
Responsed Disease Exposure to radiation [ICD-11: PH73]
In-vitro Model
 MRC-5 Normal Homo sapiens CVCL_0440
Response Summary m6A RNA methylation has been defined and appears to affect DNA repair by modulation of translation.
COVID-19 [ICD-11: RA01]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [637]
Responsed Disease COVID-19 [ICD-11: RA01]
In-vitro Model
 Vero E6 (African green monkey kidney cell Vero E6 cells (ATCC CLR-1586))
MRC-5 Normal Homo sapiens CVCL_0440
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Response Summary Replication of SARS-CoV-2, the agent responsible for the COVID-19 pandemic, and a seasonal human Bete-coronavirus HCoV-OC43, can be suppressed by depletion of METTL3 or cytoplasmic m6A reader proteins YTHDF1 and YTHDF3 and by a highly specific small molecule METTL3 inhibitor.
ATP-binding cassette sub-family C member 9 (ABCC9)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: -1.97E+00
p-value: 5.10E-08
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 6.69E+00 GSE60213
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [14]
Responsed Disease Nasopharyngeal carcinoma ICD-11: 2B6B
 Disease Info 
Target Regulation Down regulation
Pathway Response ABC transporters hsa02010
Wnt signaling pathway hsa04310
Ubiquitin mediated proteolysis hsa04120
Cell Process Ubiquitination degradation
In-vitro Model CNE-1 Normal Homo sapiens CVCL_6888
CNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_6889
In-vivo Model A total of 2 × 106 cells was mixed with 0.2 ml PBS (pH 7.4) and 30% (v/v) Matrigel matrix (BD Biosciences).
Response Summary TRIM11 regulates nasopharyngeal carcinoma drug resistance by positively modulating the Daple/beta-catenin/ATP-binding cassette sub-family C member 9 (ABCC9) signaling pathway. TRIM11 enhanced the multidrug resistance in NPC by inhibiting apoptosis in vitro and promoting cisplatin (DDP) resistance in vivo. METTL3-mediated m6A modification caused the upregulation of TRIM11 via IGF2BP2 in NPC drug-resistant cells.
Autophagy protein 5 (ATG5)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line CT26 cell line Mus musculus
Treatment: METTL3 knockout CT26 cells
Control: CT26 cells
 GSE142589
Regulation
logFC: -9.09E-01
p-value: 4.91E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 8.30E+00 GSE60213
Sorafenib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [17]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
Target Regulation Up regulation
Pathway Response FoxO signaling pathway hsa04068
Autophagy hsa04140
Cell Process Cell autophagy
Response Summary METTL3 can sensitise hepatocellular carcinoma cells to sorafenib through stabilising forkhead box class O3 (FOXO3) in an m6A-dependent manner and translated by YTHDF1, thereby inhibiting the transcription of autophagy-related genes, including ATG3, Autophagy protein 5 (ATG5), ATG12, and ATG16L1.
Chloroquine [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as Autophagy protein 5 (ATG5), ATG7, LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Gefitinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as Autophagy protein 5 (ATG5), ATG7, LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Beta-Elemen [Phase 3]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as Autophagy protein 5 (ATG5), ATG7, LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [19]
Responsed Disease Testicular cancer ICD-11: 2C80
 Disease Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cellular Processes
Cellular Transport
Cellular catabolism
Cell autophagy
In-vitro Model Tcam-2/DDP (Cisplatin-resistant TCam-2 cell line)
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary m6A methyltransferase METTL3 regulates autophagy and sensitivity to cisplatin by targeting Autophagy protein 5 (ATG5) in seminoma. The use of autophagy inhibitors 3-MA could reverse the protective effect of METTL3 on TCam-2 cells.
3-Methyladenine [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [19]
Responsed Disease Testicular cancer ICD-11: 2C80
 Disease Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cellular Processes
Cellular Transport
Cellular catabolism
Cell autophagy
In-vitro Model Tcam-2/DDP (Cisplatin-resistant TCam-2 cell line)
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary m6A methyltransferase METTL3 regulates autophagy and sensitivity to cisplatin by targeting Autophagy protein 5 (ATG5) in seminoma. The use of autophagy inhibitors 3-MA could reverse the protective effect of METTL3 on TCam-2 cells.
Spautin 1 [Preclinical]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [270]
Responsed Disease Osteosarcoma ICD-11: 2B51
 Disease Info 
Target Regulation Up regulation
In-vivo Model For tumor growth assay, 2 × 106 OS cells in 100 μL medium were injected into the nude mice subcutaneously. For tumor metastasis assay, we injected medium containing 2 × 106 cells through the caudal vein. An IVIS200 imaging system (Caliper Life Science, USA) was used to image and assess the OS metastasis. For pharmacological inhibition of USP13, mice bearing xenografts were treated with Spautin-1 (40 mg/kg/day i.p.) or vehicle for 2 weeks.
Autophagy-related protein 16-1 (ATG16L1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line CT26 cell line Mus musculus
Treatment: METTL3 knockout CT26 cells
Control: CT26 cells
 GSE142589
Regulation
logFC: -8.44E-01
p-value: 3.07E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.03E+00 GSE60213
Sorafenib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [17]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
Target Regulation Up regulation
Pathway Response FoxO signaling pathway hsa04068
Autophagy hsa04140
Cell Process Cell autophagy
Response Summary METTL3 can sensitise hepatocellular carcinoma cells to sorafenib through stabilising forkhead box class O3 (FOXO3) in an m6A-dependent manner and translated by YTHDF1, thereby inhibiting the transcription of autophagy-related genes, including ATG3, ATG5, ATG7, ATG12, and Autophagy-related protein 16-1 (ATG16L1).
Broad substrate specificity ATP-binding cassette transporter ABCG2 (BCRP/ABCG2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -9.03E-01
p-value: 2.29E-02
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 4.88E+00 GSE60213
Doxil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [22]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Cell Process Cell growth and death
Cell apoptosis
In-vitro Model ADR-resistant MCF-7 (MCF-7/ADR) cells (Human breast cancer doxorubicin-resistant cell line)
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
In-vivo Model Cell suspensions (2 × 106 cells/mL) made with MCF-7/ADR cells stably expressing METTL3 and/or miR-221-3p inhibitor were subcutaneously implanted into each mouse. One week later, xenografted mice were injected with 0.1 mL ADR (25 mg/kg, intraperitoneal injection) twice a week.
Response Summary METTL3 promotes adriamycin resistance in MCF-7 breast cancer cells by accelerating pri-microRNA-221-3p maturation in a m6A-dependent manner. METTL3 knockdown was shown to reduce the expression of miR-221-3p by reducing pri-miR-221-3p m6A mRNA methylation, reducing the expression of MDR1 and Broad substrate specificity ATP-binding cassette transporter ABCG2 (BCRP/ABCG2), and inducing apoptosis. Identified the METTL3/miR-221-3p/HIPK2/Che-1 axis as a novel signaling event that will be responsible for resistance of BC cells to ADR.
Cellular tumor antigen p53 (TP53/p53)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: 1.12E+00
p-value: 1.48E-02
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.05E+00 GSE60213
Arsenite [Phase 2]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [27]
Responsed Disease Solid tumour/cancer ICD-11: 2A00-2F9Z
 Disease Info 
Target Regulation Up regulation
Pathway Response p53 signaling pathway hsa04115
In-vitro Model HaCaT Normal Homo sapiens CVCL_0038
Response Summary METTL3 significantly decreased m6A level, restoring Cellular tumor antigen p53 (TP53/p53) activation and inhibiting cellular transformation phenotypes in the arsenite-transformed cells. m6A downregulated the expression of the positive p53 regulator, PRDM2, through the YTHDF2-promoted decay of PRDM2 mRNAs. m6A upregulated the expression of the negative p53 regulator, YY1 and MDM2 through YTHDF1-stimulated translation of YY1 and MDM2 mRNA. This study further sheds light on the mechanisms of arsenic carcinogenesis via RNA epigenetics.
Apatinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [30]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
Target Regulation Up regulation
Pathway Response p53 signaling pathway hsa04115
Apoptosis hsa04210
Cell Process Cell apoptosis
In-vitro Model QGY-7701 Human papillomavirus-related endocervical adenocarcinoma Homo sapiens CVCL_6859
HHL-5 Normal Homo sapiens CVCL_S956
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model Nude mice (4-6 week-old) were administered sterile water and feed in a specific pathogen-free barrier. Using a 1-mL syringe, 1 × 107 HEPG2 cells were subcutaneously inoculated into the right axilla of nude mice to build the HCC xenograft model. When the tumor volume reached 50 mm3, the nude mice were randomly divided into 1 control (n = 4) and 3 treatment groups (n = 4 each). RG7112, apatinib, and RG7112 + apatinib were administered to the treatment groups and an equal volume of dimethyl sulfoxide to the control group by daily gavage for 14 d. The tumor length (L) and width (W) were measured on alternate days using vernier calipers. The following formula was used to calculate the tumor volume: volume (mm3) = 0.5 × L × W × W. At the end of the experiment, the nude mice were killed by CO2 overdose anesthesia. The tumors were dissected and weighed using a precision balance, and the tumor tissue was stored in liquid nitrogen for further analysis.
Response Summary Cellular tumor antigen p53 (TP53/p53) n6-methyladenosine (m6A) played a decisive role in regulating Hepatocellular carcinoma(HCC) sensitivity to chemotherapy via the p53 activator RG7112 and the vascular endothelial growth factor receptor inhibitor apatinib. p53 mRNA m6A modification blockage induced by S-adenosyl homocysteine or siRNA-mediated METTL3 inhibition enhanced HCC sensitivity to chemotherapy.
RG7112 [ Phase 1]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [30]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
Target Regulation Up regulation
Pathway Response p53 signaling pathway hsa04115
Apoptosis hsa04210
Cell Process Cell apoptosis
In-vitro Model QGY-7701 Human papillomavirus-related endocervical adenocarcinoma Homo sapiens CVCL_6859
HHL-5 Normal Homo sapiens CVCL_S956
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model Nude mice (4-6 week-old) were administered sterile water and feed in a specific pathogen-free barrier. Using a 1-mL syringe, 1 × 107 HEPG2 cells were subcutaneously inoculated into the right axilla of nude mice to build the HCC xenograft model. When the tumor volume reached 50 mm3, the nude mice were randomly divided into 1 control (n = 4) and 3 treatment groups (n = 4 each). RG7112, apatinib, and RG7112 + apatinib were administered to the treatment groups and an equal volume of dimethyl sulfoxide to the control group by daily gavage for 14 d. The tumor length (L) and width (W) were measured on alternate days using vernier calipers. The following formula was used to calculate the tumor volume: volume (mm3) = 0.5 × L × W × W. At the end of the experiment, the nude mice were killed by CO2 overdose anesthesia. The tumors were dissected and weighed using a precision balance, and the tumor tissue was stored in liquid nitrogen for further analysis.
Response Summary Cellular tumor antigen p53 (TP53/p53) n6-methyladenosine (m6A) played a decisive role in regulating Hepatocellular carcinoma(HCC) sensitivity to chemotherapy via the p53 activator RG7112 and the vascular endothelial growth factor receptor inhibitor apatinib. p53 mRNA m6A modification blockage induced by S-adenosyl homocysteine or siRNA-mediated METTL3 inhibition enhanced HCC sensitivity to chemotherapy.
Erianin [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [277]
Responsed Disease Renal cell carcinoma ICD-11: 2C90
 Disease Info 
Target Regulation Down regulation
Remimazolam [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [278]
Responsed Disease Acute ischemic stroke ICD-11: 8B11
 Disease Info 
Target Regulation Up regulation
In-vitro Model L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
eIF4E-binding protein 1 (4EBP1/EIF4EBP1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MOLM-13 cell line Homo sapiens
Treatment: shMETTL3 MOLM13 cells
Control: MOLM13 cells
 GSE98623
Regulation
logFC: 8.71E-01
p-value: 3.32E-08
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 9.71E+00 GSE60213
Rapamycin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [44]
Responsed Disease Retinoblastoma ICD-11: 2D02.2
 Disease Info 
Target Regulation Down regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
mTOR signaling pathway hsa04150
Cell Process Cell proliferation
Cell migration
Cell invasion
Cell apoptosis
In-vitro Model WERI-Rb-1 Retinoblastoma Homo sapiens CVCL_1792
Y-79 Retinoblastoma Homo sapiens CVCL_1893
In-vivo Model To establish a subcutaneous tumour model in nude mice, 2 × 107 Y79 cells (METTL3 knockdown group: shNC, shRNA1 and shRNA2; METTL3 up-regulated group: NC and METLL3) were resuspended in 1 mL of pre-cooled PBS, and 200 uL of the cell suspension was injected subcutaneously into the left side of the armpit to investigate tumour growth (4 × 106 per mouse).
Response Summary METTL3 promotes the progression of retinoblastoma through PI3K/AKT/mTOR pathways in vitro and in vivo. METTL3 has an impact on the PI3K-AKT-mTOR-P70S6K/eIF4E-binding protein 1 (4EBP1/EIF4EBP1) pathway. The cell proliferation results show that the stimulatory function of METTL3 is lost after rapamycin treatment.
Homeodomain-interacting protein kinase 2 (HIPK2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -1.67E+00
p-value: 2.62E-66
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.33E+00 GSE60213
Doxil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [22]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Cell Process Cell growth and death
Cell apoptosis
In-vitro Model ADR-resistant MCF-7 (MCF-7/ADR) cells (Human breast cancer doxorubicin-resistant cell line)
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
In-vivo Model Cell suspensions (2 × 106 cells/mL) made with MCF-7/ADR cells stably expressing METTL3 and/or miR-221-3p inhibitor were subcutaneously implanted into each mouse. One week later, xenografted mice were injected with 0.1 mL ADR (25 mg/kg, intraperitoneal injection) twice a week.
Response Summary METTL3 promotes adriamycin resistance in MCF-7 breast cancer cells by accelerating pri-microRNA-221-3p maturation in a m6A-dependent manner. METTL3 knockdown was shown to reduce the expression of miR-221-3p by reducing pri-miR-221-3p m6A mRNA methylation, reducing the expression of MDR1 and BCRP, and inducing apoptosis. Identified the METTL3/miR-221-3p/Homeodomain-interacting protein kinase 2 (HIPK2)/Che-1 axis as a novel signaling event that will be responsible for resistance of BC cells to ADR.
Verbascoside [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [299]
Responsed Disease Oral squamous cell carcinoma ICD-11: 2B6E.0
 Disease Info 
In-vitro Model SCC-9 Tongue squamous cell carcinoma Homo sapiens CVCL_1685
UM1 Tongue squamous cell carcinoma Homo sapiens CVCL_VH00
Kelch-like ECH-associated protein 1 (KEAP1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: -1.79E+00
p-value: 1.23E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.17E+00 GSE60213
Colistin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [65]
Responsed Disease Diseases of the urinary system ICD-11: GC2Z
 Disease Info 
Target Regulation Down regulation
Cell Process Oxidative stress
Cell apoptosis
In-vivo Model The 60 female Kunming mice were divided into two groups (n = 30): control group (injection of physiological saline through the caudal vein) and colistin group (injection of 15 mg/kg colistin, twice a day, with an eight-hour interval).
Response Summary m6A methylation was involved in oxidative stress-mediated apoptosis in the mechanism of colistin nephrotoxicity. METTL3-mediated m6A methylation modification is involved in colistin-induced nephrotoxicity through apoptosis mediated by Kelch-like ECH-associated protein 1 (KEAP1)/Nrf2 signaling pathway.
Methylated-DNA--protein-cysteine methyltransferase (MGMT)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: -1.79E+00
p-value: 2.16E-20
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 5.15E+00 GSE60213
Temozolomide [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [69]
Responsed Disease Glioblastoma ICD-11: 2A00.00
 Disease Info 
Target Regulation Down regulation
Pathway Response Nucleotide excision repair hsa03420
Cell Process DNA repair
In-vitro Model U251 (Fibroblasts or fibroblast like cells)
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
In-vivo Model Subcutaneously injected shMETTL3 or shNC-expressing U87-MG-TMZ cells into BALB/c NOD mice. After confirmation of GBM implantation, mice were treated with TMZ (66 mg/kg/d, 5 d per week, for 3 cycles).
Response Summary Two critical DNA repair genes (Methylated-DNA--protein-cysteine methyltransferase (MGMT) and APNG) were m6A-modified by METTL3, whereas inhibited by METTL3 silencing or DAA-mediated total methylation inhibition, which is crucial for METTL3-improved temozolomide resistance in glioblastoma cells.
Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B/LC3B-II)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 6.38E-01
p-value: 4.93E-09
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.34E+00 GSE60213
Chloroquine [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, ATG7, LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B/LC3B-II). beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Gefitinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, ATG7, LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B/LC3B-II). beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Beta-Elemen [Phase 3]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, ATG7, LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B/LC3B-II). beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Neurocalcin-delta (NCALD)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LNCaP cell line Homo sapiens
Treatment: shMETTL3 LNCaP cells
Control: shControl LNCaP cells
 GSE147884
Regulation
logFC: 1.15E+00
p-value: 3.16E-04
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 8.03E+00 GSE60213
Fluorouracil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [88]
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Target Regulation Down regulation
In-vitro Model HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
In-vivo Model A tumor-bearing model was established by subcutaneously injecting 100 ul HT29 cells (5×106) followed by an intravenous injection of CAFs-derived exosomes (50 ug/mouse every three days) into the tail vein of the mice. An intraperitoneal injection of 5-FU (50 mg/kg, every week) was administered on day 12.
Response Summary METTL3 dependent m6A methylation was upregulated in CRC to promote the processing of miR 181d 5p by DGCR8. This led to increased miR 181d 5p expression, which inhibited the 5 FU sensitivity of CRC cells by targeting Neurocalcin-delta (NCALD).
Phosphatidylinositol 3-kinase regulatory subunit beta (PI3K-p85/PIK3R2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 1.59E+00
p-value: 3.69E-27
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.42E+00 GSE60213
Rapamycin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [44]
Responsed Disease Retinoblastoma ICD-11: 2D02.2
 Disease Info 
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
mTOR signaling pathway hsa04150
Apoptosis hsa04210
Cell Process Cell proliferation
Cell migration
Cell invasion
Cell apoptosis
In-vitro Model WERI-Rb-1 Retinoblastoma Homo sapiens CVCL_1792
Y-79 Retinoblastoma Homo sapiens CVCL_1893
In-vivo Model To establish a subcutaneous tumour model in nude mice, 2 × 107 Y79 cells (METTL3 knockdown group: shNC, shRNA1 and shRNA2; METTL3 up-regulated group: NC and METLL3) were resuspended in 1 mL of pre-cooled PBS, and 200 uL of the cell suspension was injected subcutaneously into the left side of the armpit to investigate tumour growth (4 × 106 per mouse).
Response Summary METTL3 promotes the progression of retinoblastoma through Phosphatidylinositol 3-kinase regulatory subunit beta (PI3K-p85/PIK3R2)/AKT/mTOR pathways in vitro and in vivo. METTL3 has an impact on the PI3K-AKT-mTOR-P70S6K/4EBP1 pathway. The cell proliferation results show that the stimulatory function of METTL3 is lost after rapamycin treatment.
Pro-epidermal growth factor (EGF)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: 2.08E+00
p-value: 3.08E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 7.98E+00 GSE60213
Doxil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [98]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Pathway Response Homologous recombination hsa03440
Cell Process Homologous recombination repair
In-vitro Model MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model Cells were trypsinized and resuspended in DMEM at a consistence of 1 × 107 cells/ml. A total of 1 × 106 cells were injected into flank of mice. 27 days after injection, tumors were removed for paraffin-embedded sections.
Response Summary Knockdown of METTL3 sensitized these breast cancer cells to Adriamycin (ADR; also named as doxorubicin) treatment and increased accumulation of DNA damage. Mechanically, we demonstrated that inhibition of METTL3 impaired HR efficiency and increased ADR-induced DNA damage by regulating m6A modification of Pro-epidermal growth factor (EGF)/RAD51 axis. METTL3 promoted EGF expression through m6A modification, which further upregulated RAD51 expression, resulting in enhanced HR activity.
Ribosomal protein S6 kinase beta-1 (RPS6KB1/p70S6K)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line CT26 cell line Mus musculus
Treatment: METTL3 knockout CT26 cells
Control: CT26 cells
 GSE142589
Regulation
logFC: -6.86E-01
p-value: 2.67E-02
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.70E+00 GSE60213
Rapamycin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [44]
Responsed Disease Retinoblastoma ICD-11: 2D02.2
 Disease Info 
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
mTOR signaling pathway hsa04150
Cell Process Cell proliferation
Cell migration
Cell invasion
Cell apoptosis
In-vitro Model WERI-Rb-1 Retinoblastoma Homo sapiens CVCL_1792
Y-79 Retinoblastoma Homo sapiens CVCL_1893
In-vivo Model To establish a subcutaneous tumour model in nude mice, 2 × 107 Y79 cells (METTL3 knockdown group: shNC, shRNA1 and shRNA2; METTL3 up-regulated group: NC and METLL3) were resuspended in 1 mL of pre-cooled PBS, and 200 uL of the cell suspension was injected subcutaneously into the left side of the armpit to investigate tumour growth (4 × 106 per mouse).
Response Summary METTL3 promotes the progression of retinoblastoma through PI3K/AKT/mTOR pathways in vitro and in vivo. METTL3 has an impact on the PI3K-AKT-mTOR-Ribosomal protein S6 kinase beta-1 (RPS6KB1/p70S6K)/4EBP1 pathway. The cell proliferation results show that the stimulatory function of METTL3 is lost after rapamycin treatment.
Sequestosome-1 (SQSTM1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HUVEC cell line Homo sapiens
Treatment: shMETTL3 HUVEC cells
Control: shScramble HUVEC cells
 GSE157544
Regulation
logFC: -6.28E-01
p-value: 1.94E-05
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.03E+00 GSE60213
Chloroquine [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, ATG7, LC3B, and Sequestosome-1 (SQSTM1). beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Gefitinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, ATG7, LC3B, and Sequestosome-1 (SQSTM1). beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Beta-Elemen [Phase 3]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, ATG7, LC3B, and Sequestosome-1 (SQSTM1). beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Paclitaxel [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [331]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
In-vitro Model HEK293T Normal Homo sapiens CVCL_0063
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model The experimental mice were housed in an SPF-grade animal laboratory at a temperature of approximately 25 °C, a humidity range of 50%, and an average daylight duration of 12 h. BALB/C female mice at 5-6 weeks of age were taken and prepared for tumor-bearing. After the mice were sacrificed, their tissues were collected, weighed and immediately snap-frozen in liquid nitrogen.
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [331]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
In-vitro Model HEK293T Normal Homo sapiens CVCL_0063
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model The experimental mice were housed in an SPF-grade animal laboratory at a temperature of approximately 25 °C, a humidity range of 50%, and an average daylight duration of 12 h. BALB/C female mice at 5-6 weeks of age were taken and prepared for tumor-bearing. After the mice were sacrificed, their tissues were collected, weighed and immediately snap-frozen in liquid nitrogen.
Serine/threonine-protein kinase mTOR (MTOR)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3 knockout liver
Control: Wild type liver cells
 GSE198512
Regulation
logFC: 8.34E-01
p-value: 1.58E-02
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.47E+00 GSE60213
Rapamycin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [44]
Responsed Disease Retinoblastoma ICD-11: 2D02.2
 Disease Info 
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
mTOR signaling pathway hsa04150
Cell Process Cell proliferation
Cell migration
Cell invasion
Cell apoptosis
In-vitro Model WERI-Rb-1 Retinoblastoma Homo sapiens CVCL_1792
Y-79 Retinoblastoma Homo sapiens CVCL_1893
In-vivo Model To establish a subcutaneous tumour model in nude mice, 2 × 107 Y79 cells (METTL3 knockdown group: shNC, shRNA1 and shRNA2; METTL3 up-regulated group: NC and METLL3) were resuspended in 1 mL of pre-cooled PBS, and 200 uL of the cell suspension was injected subcutaneously into the left side of the armpit to investigate tumour growth (4 × 106 per mouse).
Response Summary METTL3 promotes the progression of retinoblastoma through PI3K/AKT/Serine/threonine-protein kinase mTOR (MTOR) pathways in vitro and in vivo. METTL3 has an impact on the PI3K-AKT-mTOR-P70S6K/4EBP1 pathway. The cell proliferation results show that the stimulatory function of METTL3 is lost after rapamycin treatment.
TNF receptor-associated factor 5 (TRAF5)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -7.59E-01
p-value: 1.50E-05
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.24E+00 GSE60213
Oxaliplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [113]
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Target Regulation Down regulation
In-vitro Model LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
In-vivo Model HCT-116 cells (3 × 105 cells in 200 uL of saline) were subcutaneously injected into the nude mice to establish xenograft tumors. After 10 days, 10 mg/kg OX or saline was intraperitoneally injected (n = 5 for each group). Si-METTL3 or si-TRAF5 (10 nmol/20 g body weight) was injected twice intratumorally before the start of OX treatment. The mice were examined every 2 days and sacrificed 4 weeks after the OX treatment.
Response Summary 2-polarized tumor-associated macrophages enabled the oxaliplatin resistance via the elevation of METTL3-mediated m6A modification in Colorectal Cancer cells. Furthermore, they found that TNF receptor-associated factor 5 (TRAF5) contributes to the METTL3-triggered OX resistance in CRC cells.
Transcription factor AP-2 gamma (TFAP2C)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Embryonic stem cells Mus musculus
Treatment: METTL3-/- mESCs
Control: Wild type ESCs
 GSE147849
Regulation
logFC: 1.20E+00
p-value: 4.47E-08
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 2.28E+00 GSE60213
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [115]
Responsed Disease Testicular cancer ICD-11: 2C80
 Disease Info 
Target Regulation Up regulation
Pathway Response Nucleotide excision repair hsa03420
Cell Process DNA repair
In-vitro Model TCam-2 Testicular seminoma Homo sapiens CVCL_T012
In-vivo Model Male mice were subcutaneously injected with tumour cells near the limbs to establish xenografts (1 × 106/mouse, 0.2 mL for each injection site; METTL3-overexpressing TCam-2/CDDP cells were inoculated once at the initial time and IGF2BP1-inhibited TCam-2/CDDP cells were inoculated every 3 days).
Response Summary METTL3 potentiates resistance to cisplatin through m6A modification of Transcription factor AP-2 gamma (TFAP2C) in seminoma. Enhanced stability of TFAP2C mRNA promoted seminoma cell survival under cisplatin treatment burden probably through up-regulation of DNA repair-related genes. IGF2BP1 binds to TFAP2C and enhances TFAP2C mRNA stability.
Transcription factor E2F1 (E2F1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: 8.59E-01
p-value: 2.73E-57
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.01E+00 GSE60213
Doxil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [116]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
In-vitro Model MCF7-DoxR (Adriamycin-resistant cell line MCF7-DoxR)
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
In-vivo Model Once the tumor volume increased to about 1 cm3, six groups of MCF7 bearing mice (n = 10 in each group) were injected with PBS (0.1 ml, caudal vein) and adriamycin (0.1 ml, 10 mg/kg), respectively. When the tumor reached 1.5 cm in any direction (defined as event-free survival analysis), 10 mice in each group were selected to measure the tumor size and weight on the 12th day after adriamycin injection.
Response Summary METTL3 can regulate the expression of MALAT1 through m6A, mediate the Transcription factor E2F1 (E2F1)/AGR2 axis, and promote the adriamycin resistance of breast cancer.
Transcriptional coactivator YAP1 (YAP1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LNCaP cell line Homo sapiens
Treatment: shMETTL3 LNCaP cells
Control: shControl LNCaP cells
 GSE147884
Regulation
logFC: 6.80E-01
p-value: 6.99E-58
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.22E+00 GSE60213
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [126]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response Hippo signaling pathway hsa04390
Cell Process Metabolic
In-vitro Model A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Calu-6 Lung adenocarcinoma Homo sapiens CVCL_0236
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
In-vivo Model Mice were injected with 5 × 106 lung cancer cells with stably expression of relevant plasmids and randomly divided into two groups (five mice per group) after the diameter of the xenografted tumors had reached approximately 5 mm in diameter. Xenografted mice were then administrated with PBS or DDP (3 mg/kg per day) for three times a week, and tumor volume were measured every second day.
Response Summary METTL3, YTHDF3, YTHDF1, and eIF3b directly promoted YAP translation through an interaction with the translation initiation machinery. METTL3 knockdown inhibits tumor growth and enhances sensitivity to DDP in vivo.m6A mRNA methylation initiated by METTL3 directly promotes YAP translation and increases YAP activity by regulating the MALAT1-miR-1914-3p-Transcriptional coactivator YAP1 (YAP1) axis to induce Non-small cell lung cancer drug resistance and metastasis.
Translocation protein SEC62 (SEC62)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line CT26 cell line Mus musculus
Treatment: METTL3 knockout CT26 cells
Control: CT26 cells
 GSE142589
Regulation
logFC: -8.61E-01
p-value: 1.21E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.99E+00 GSE60213
Fluorouracil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [128]
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Protein degradation
In-vitro Model DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model DLD-1 cells were subcutaneously implanted into 4-6 weeks old female nude mice. When tumors reached a size of about 50 mm3, the nude mice were randomly divided into 6 groups.
Response Summary Translocation protein SEC62 (SEC62) upregulated by the METTL3-mediated m6A modification promotes the stemness and chemoresistance of colorectal cancer by binding to beta-catenin and enhancing Wnt signalling. Depletion of Sec62 sensitized the CRC cells to 5-Fu or oxaliplatin treatment.
Oxaliplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [128]
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Protein degradation
In-vitro Model DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model DLD-1 cells were subcutaneously implanted into 4-6 weeks old female nude mice. When tumors reached a size of about 50 mm3, the nude mice were randomly divided into 6 groups.
Response Summary Translocation protein SEC62 (SEC62) upregulated by the METTL3-mediated m6A modification promotes the stemness and chemoresistance of colorectal cancer by binding to beta-catenin and enhancing Wnt signalling. Depletion of Sec62 sensitized the CRC cells to 5-Fu or oxaliplatin treatment.
Ubiquitin-like modifier-activating enzyme ATG7 (ATG7)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 6.17E-01
p-value: 3.67E-05
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 4.77E+00 GSE60213
Sorafenib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [17]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
Target Regulation Up regulation
Pathway Response FoxO signaling pathway hsa04068
Autophagy hsa04140
Cell Process Cell autophagy
Response Summary METTL3 can sensitise hepatocellular carcinoma cells to sorafenib through stabilising forkhead box class O3 (FOXO3) in an m6A-dependent manner and translated by YTHDF1, thereby inhibiting the transcription of autophagy-related genes, including ATG3, ATG5, Ubiquitin-like modifier-activating enzyme ATG7 (ATG7), ATG12, and ATG16L1.
Chloroquine [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, Ubiquitin-like modifier-activating enzyme ATG7 (ATG7), LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Gefitinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, Ubiquitin-like modifier-activating enzyme ATG7 (ATG7), LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Beta-Elemen [Phase 3]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [18]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagic lysosome acidification
In-vitro Model Gefitinib-resistant cell line HCC827GR (Gefitinib-resistant HCC827 cell line)
Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model NSCLC gefitinib-resistant cells (5 × 106 cells in 100 uL PBS) were injected subcutaneously into the lateral surface of the left abdomen of 6-week-old female BALB/c nude mice (at least five mice per group to ensure accuracy).
Response Summary METTL3 could positively regulate the autophagy by targeting the autophagy-related genes such as ATG5, Ubiquitin-like modifier-activating enzyme ATG7 (ATG7), LC3B, and SQSTM1. beta-elemene inhibited the autophagy flux by preventing autophagic lysosome acidification, resulting in increasing expression of SQSTM1 and LC3B-II. beta-elemene could reverse gefitinib resistance in non-small cell lung cancer cells by inhibiting cell autophagy process in a manner of chloroquine. METTL3-mediated autophagy in reversing gefitinib resistance of NSCLC cells by beta-elemene, which shed light on providing potential molecular-therapy target and clinical-treatment method in NSCLC patients with gefitinib resistance.
Ubiquitin-like protein ATG12 (ATG12)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Mouse testis Mus musculus
Treatment: Mettl3 knockout mouse testis
Control: Mouse testis
 GSE99771
Regulation
logFC: -2.94E+00
p-value: 6.14E-05
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.85E+00 GSE60213
Sorafenib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [17]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
Target Regulation Up regulation
Pathway Response FoxO signaling pathway hsa04068
Autophagy hsa04140
Cell Process Cell autophagy
Response Summary METTL3 can sensitise hepatocellular carcinoma cells to sorafenib through stabilising forkhead box class O3 (FOXO3) in an m6A-dependent manner and translated by YTHDF1, thereby inhibiting the transcription of autophagy-related genes, including ATG3, ATG5, ATG7, Ubiquitin-like protein ATG12 (ATG12), and ATG16L1.
LBX2 antisense RNA 1 (LBX2-AS1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -8.54E-01
p-value: 2.13E-07
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 6.38E+00 GSE60213
Fluorouracil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [138]
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Target Regulation Up regulation
In-vitro Model HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary The increased LBX2 antisense RNA 1 (LBX2-AS1) in CRC was mediated by METTL3-dependent m6A methylation. LBX2-AS1 serves as a therapeutic target and predictor of 5-FU benefit in colorectal cancer patients.
Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line DKO-1 cell line Homo sapiens
Treatment: METTL3 knockdown DKO-1 cell
Control: DKO-1 cell
 GSE182382
Regulation
logFC: 8.20E-01
p-value: 5.93E-03
More Results Click to View More RNA-seq Results
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.28E+00 GSE60213
Cisplatin [Approved]
In total 2 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [126]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response Hippo signaling pathway hsa04390
Cell Process Metabolic
In-vitro Model A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Calu-6 Lung adenocarcinoma Homo sapiens CVCL_0236
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
In-vivo Model Mice were injected with 5 × 106 lung cancer cells with stably expression of relevant plasmids and randomly divided into two groups (five mice per group) after the diameter of the xenografted tumors had reached approximately 5 mm in diameter. Xenografted mice were then administrated with PBS or DDP (3 mg/kg per day) for three times a week, and tumor volume were measured every second day.
Response Summary METTL3, YTHDF3, YTHDF1, and eIF3b directly promoted YAP translation through an interaction with the translation initiation machinery. METTL3 knockdown inhibits tumor growth and enhances sensitivity to DDP in vivo.m6A mRNA methylation initiated by METTL3 directly promotes YAP translation and increases YAP activity by regulating the Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)-miR-1914-3p-YAP axis to induce Non-small cell lung cancer drug resistance and metastasis.
Experiment 2 Reporting the m6A-centered Drug Response of This Target Gene [144]
Responsed Disease Thymic epithelial tumors ICD-11: 2C27.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response Cellular senescence hsa04218
Cell Process Cell viability and proliferation
In-vitro Model T1889 Thymic undifferentiated carcinoma Homo sapiens CVCL_D024
Response Summary This study highlighted METTL3 as a tumor promoter in Thymic tumors and c-MYC as a promising target to be exploited for the treatment of TET. High expression of c-MYC protein is enabled by lncRNA Metastasis associated lung adenocarcinoma transcript 1 (MALAT1), which is methylated and delocalized by METTL3. Silencing of METTL3 combined with cisplatin or c-MYC inhibitor induces cell death in TET cells. Blocking of c-MYC by using JQ1 inhibitor cooperates with METTL3 depletion in the inhibition of proliferation and induction of cell death.
JQ-1 [Phase 1]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [144]
Responsed Disease Thymic epithelial tumors ICD-11: 2C27.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response Cellular senescence hsa04218
Cell Process Cell viability and proliferation
In-vitro Model T1889 Thymic undifferentiated carcinoma Homo sapiens CVCL_D024
Response Summary This study highlighted METTL3 as a tumor promoter in Thymic tumors and c-MYC as a promising target to be exploited for the treatment of TET. High expression of c-MYC protein is enabled by lncRNA Metastasis associated lung adenocarcinoma transcript 1 (MALAT1), which is methylated and delocalized by METTL3. Silencing of METTL3 combined with cisplatin or c-MYC inhibitor induces cell death in TET cells. Blocking of c-MYC by using JQ1 inhibitor cooperates with METTL3 depletion in the inhibition of proliferation and induction of cell death.
Doxil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [116]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
In-vitro Model MCF7-DoxR (Adriamycin-resistant cell line MCF7-DoxR)
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
In-vivo Model Once the tumor volume increased to about 1 cm3, six groups of MCF7 bearing mice (n = 10 in each group) were injected with PBS (0.1 ml, caudal vein) and adriamycin (0.1 ml, 10 mg/kg), respectively. When the tumor reached 1.5 cm in any direction (defined as event-free survival analysis), 10 mice in each group were selected to measure the tumor size and weight on the 12th day after adriamycin injection.
Response Summary METTL3 can regulate the expression of Metastasis associated lung adenocarcinoma transcript 1 (MALAT1) through m6A, mediate the E2F1/AGR2 axis, and promote the adriamycin resistance of breast cancer.
Artenimol [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [145]
Responsed Disease Chronic kidney disease ICD-11: GB61
 Disease Info 
Cell Process Epithelial-mesenchymal transition
In-vitro Model HK-2 [Human kidney] Normal Homo sapiens CVCL_0302
HK2 Normal Acipenser baerii CVCL_YE28
In-vivo Model For the unilateral ureteral obstruction (UUO) model, male C57BL/6J mice at 8 weeks of age (20-22 g body weight) were first anaesthetized with pentobarbital sodium (50 mg/kg) via intraperitoneal injection. Then, the left ureter was ligated using 3-0 silk and a left lateral incision.
Response Summary Renal fibrosis is a key factor in chronic kidney disease (CKD). Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)/miR-145/FAK pathway was involved in the effect of dihydroartemisinin (DHA) on TGF-beta1-induced renal fibrosis in vitro and in vivo.
Simvastatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [367]
Target Regulation Up regulation
In-vivo Model Healthy adult ICR male (aged: 8 weeks old; weighing: 40- 70 g) and female mice (aged: 8 weeks old; weighing: 40-60 g) were obtained from Hunan SJA Laboratory Animal Co., Ltd. (Hunan, China). These mice were housed in the SPF laboratory at 25°C and 55% humidity under a 12-h light/dark cycle, with ad libitum access to food and water for acclimatization.
Adenylate kinase 4, mitochondrial (AK4)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -5.87E-01
p-value: 2.40E-51
More Results Click to View More RNA-seq Results
Tamoxifen [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [152]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Cell Process Mitochondrial apoptosis
In-vitro Model MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF7-TamR Invasive breast carcinoma Homo sapiens CVCL_EG55
Response Summary Adenylate kinase 4 modulates the resistance of breast cancer cells to tamoxifen through an m6A-based epitranscriptomic mechanism. Genetic depletion of METTL3 in TamR MCF-7 cells led to a diminished Adenylate kinase 4, mitochondrial (AK4) protein level and attenuated resistance to tamoxifen.
Anterior gradient protein 2 homolog (AGR2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -7.71E-01
p-value: 1.08E-130
More Results Click to View More RNA-seq Results
Doxil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [116]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
In-vitro Model MCF7-DoxR (Adriamycin-resistant cell line MCF7-DoxR)
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
In-vivo Model Once the tumor volume increased to about 1 cm3, six groups of MCF7 bearing mice (n = 10 in each group) were injected with PBS (0.1 ml, caudal vein) and adriamycin (0.1 ml, 10 mg/kg), respectively. When the tumor reached 1.5 cm in any direction (defined as event-free survival analysis), 10 mice in each group were selected to measure the tumor size and weight on the 12th day after adriamycin injection.
Response Summary METTL3 can regulate the expression of MALAT1 through m6A, mediate the E2F1/Anterior gradient protein 2 homolog (AGR2) axis, and promote the adriamycin resistance of breast cancer.
ATP-dependent translocase ABCB1 (ABCB1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -1.24E+00
p-value: 2.14E-202
More Results Click to View More RNA-seq Results
Doxil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [22]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Cell Process Cell growth and death
Cell apoptosis
In-vitro Model ADR-resistant MCF-7 (MCF-7/ADR) cells (Human breast cancer doxorubicin-resistant cell line)
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
In-vivo Model Cell suspensions (2 × 106 cells/mL) made with MCF-7/ADR cells stably expressing METTL3 and/or miR-221-3p inhibitor were subcutaneously implanted into each mouse. One week later, xenografted mice were injected with 0.1 mL ADR (25 mg/kg, intraperitoneal injection) twice a week.
Response Summary METTL3 promotes adriamycin resistance in MCF-7 breast cancer cells by accelerating pri-microRNA-221-3p maturation in a m6A-dependent manner. METTL3 knockdown was shown to reduce the expression of miR-221-3p by reducing pri-miR-221-3p m6A mRNA methylation, reducing the expression of ATP-dependent translocase ABCB1 (ABCB1) and BCRP, and inducing apoptosis. Identified the METTL3/miR-221-3p/HIPK2/Che-1 axis as a novel signaling event that will be responsible for resistance of BC cells to ADR.
DNA repair protein RAD51 homolog 1 (RAD51)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HeLa cell line Homo sapiens
Treatment: METTL3 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: 2.32E+00
p-value: 1.62E-02
More Results Click to View More RNA-seq Results
Doxil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [98]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Pathway Response Homologous recombination hsa03440
Cell Process Homologous recombination repair
In-vitro Model MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model Cells were trypsinized and resuspended in DMEM at a consistence of 1 × 107 cells/ml. A total of 1 × 106 cells were injected into flank of mice. 27 days after injection, tumors were removed for paraffin-embedded sections.
Response Summary Knockdown of METTL3 sensitized these breast cancer cells to Adriamycin (ADR; also named as doxorubicin) treatment and increased accumulation of DNA damage. Mechanically, we demonstrated that inhibition of METTL3 impaired HR efficiency and increased ADR-induced DNA damage by regulating m6A modification of EGF/RAD51 axis. METTL3 promoted EGF expression through m6A modification, which further upregulated DNA repair protein RAD51 homolog 1 (RAD51) expression, resulting in enhanced HR activity.
DNA-3-methyladenine glycosylase (ANPG/MPG)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Caco-2 cell line Homo sapiens
Treatment: shMETTL3 Caco-2 cells
Control: shNTC Caco-2 cells
 GSE167075
Regulation
logFC: -6.00E-01
p-value: 3.04E-08
More Results Click to View More RNA-seq Results
Temozolomide [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [69]
Responsed Disease Glioblastoma ICD-11: 2A00.00
 Disease Info 
Target Regulation Down regulation
Pathway Response Nucleotide excision repair hsa03420
Cell Process DNA repair
In-vitro Model U251 (Fibroblasts or fibroblast like cells)
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
In-vivo Model Subcutaneously injected shMETTL3 or shNC-expressing U87-MG-TMZ cells into BALB/c NOD mice. After confirmation of GBM implantation, mice were treated with TMZ (66 mg/kg/d, 5 d per week, for 3 cycles).
Response Summary Two critical DNA repair genes (MGMT and DNA-3-methyladenine glycosylase (ANPG/MPG)) were m6A-modified by METTL3, whereas inhibited by METTL3 silencing or DAA-mediated total methylation inhibition, which is crucial for METTL3-improved temozolomide resistance in glioblastoma cells.
Epidermal growth factor receptor (EGFR)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line ARPE-19 cell line Homo sapiens
Treatment: shMETTL3 ARPE-19 cells
Control: shControl ARPE-19 cells
 GSE202017
Regulation
logFC: -6.74E-01
p-value: 1.53E-03
More Results Click to View More RNA-seq Results
PLX4032 [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [164]
Responsed Disease Melanoma ICD-11: 2C30
 Disease Info 
Target Regulation Up regulation
Pathway Response EGFR tyrosine kinase inhibitor resistance hsa01521
Cell Process Cell apoptosis
In-vitro Model A375-R Amelanotic melanoma Homo sapiens CVCL_6234
Response Summary METTL3 increased the m6A modification of Epidermal growth factor receptor (EGFR) mRNA in A375R cells, which promoted its translation efficiency. Inhibiting METTL3 function to restore PLX4032 sensitivity in patients with melanoma.
Lenvatinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [290]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
Target Regulation Up regulation
In-vitro Model Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model Tumor cells derived xenograft (MHCC97H cells) from subcutaneous mouse model were cut into 1 mm3 pieces and implanted into the left lobe of the livers of six-week-old male NCG mice. Once the tumors were established and reached approximately 100 mm3, mice were randomly assigned to daily treatment with vehicle, lenvatinib (4 mg/kg, oral gavage), STM2457 (50 mg/kg, intraperitoneal injection) or a drug combination in which each compound was administered at the same dose and duration as the single agent.
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [290]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
Target Regulation Up regulation
In-vitro Model MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Forkhead box protein O3 (FOXO3)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: 8.00E-01
p-value: 1.28E-68
More Results Click to View More RNA-seq Results
Sorafenib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [167]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
Target Regulation Down regulation
Pathway Response FoxO signaling pathway hsa04068
Cell Process Cell Transport
Cell catabolism
Cell autophagy
In-vitro Model HEK293T Normal Homo sapiens CVCL_0063
Hepa 1-6 Hepatocellular carcinoma of the mouse Mus musculus CVCL_0327
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HUVEC-C Normal Homo sapiens CVCL_2959
WRL 68 Endocervical adenocarcinoma Homo sapiens CVCL_0581
In-vivo Model For the drug-resistant subcutaneous tumor models, drug administration was adopted when the tumors reached about 50 mm3 in size, at which point mice were randomized for treatment with DMSO(intraperitoneally) or sorafenib (50 mg/kg/every 2 days, intraperitoneally). For the patient-derived tumor xenograft model, drug administration began 4 weeks after tumors reached about 100 mm3 in size with sorafenib (50 mg/kg/every 3 days, intraperitoneally) or siCtrl/siMETTL3 intratumor injection.
Response Summary METTL3 and Forkhead box protein O3 (FOXO3) levels are tightly correlated in hepatocellular carcinoma patients. In mouse xenograft models, METTL3 depletion significantly enhances sorafenib resistance of HCC by abolishing the identified METTL3-mediated FOXO3 mRNA stabilization, and overexpression of FOXO3 restores m6 A-dependent sorafenib sensitivity.
Hepatocyte growth factor receptor (c-Met/MET)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: 6.42E-01
p-value: 3.45E-17
More Results Click to View More RNA-seq Results
Crizotinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [173]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response EGFR tyrosine kinase inhibitor resistance hsa01521
In-vitro Model HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
NCI-H661 Lung large cell carcinoma Homo sapiens CVCL_1577
NCI-H596 Lung adenosquamous carcinoma Homo sapiens CVCL_1571
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
NCI-H358 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1559
NCI-H292 Lung mucoepidermoid carcinoma Homo sapiens CVCL_0455
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H1650 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1483
NCI-H1395 Lung adenocarcinoma Homo sapiens CVCL_1467
EBC-1 Lung squamous cell carcinoma Homo sapiens CVCL_2891
Calu-3 Lung adenocarcinoma Homo sapiens CVCL_0609
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
In-vivo Model HCC827 (3×106) cells suspended in 100 uL of PBS were injected into the left inguen of female Balb/c nude mice (body weight 18-20 g; age 6 weeks; Beijing Huafukang Bioscience Co., Inc.). When the tumor volumes reached 50-100 mm3 on the 10th posttransplantation day, the mice were randomized into four groups (10 mice per group) and were intragastrically administered vehicle (normal saline), crizotinib (25 mg/kg body weight), chidamide (5 mg/kg), or the combination of the two drugs daily for 21 days. The tumor volumes and body weights of the mice were measured every 3 days.
Response Summary Chidamide could decrease Hepatocyte growth factor receptor (c-Met/MET) expression by inhibiting mRNA N6-methyladenosine (m6A) modification through the downregulation of METTL3 and WTAP expression, subsequently increasing the crizotinib sensitivity of NSCLC cells in a c-MET-/HGF-dependent manner.
Gefitinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [174]
Responsed Disease Lung cancer ICD-11: 2C25
 Disease Info 
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
In-vitro Model PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
NCI-H3255 Lung adenocarcinoma Homo sapiens CVCL_6831
Response Summary METTL3 combines with Hepatocyte growth factor receptor (c-Met/MET) and causes the PI3K/AKT signalling pathway to be manipulated, which affects the sensitivity of lung cancer cells to gefitinib. METTL3 knockdown promotes apoptosis and inhibits proliferation of lung cancer cells.
Meltrin-beta (ADAM19)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line HUVEC cell line Homo sapiens
Treatment: shMETTL3 HUVEC cells
Control: shScramble HUVEC cells
 GSE157544
Regulation
logFC: -7.06E-01
p-value: 4.35E-03
More Results Click to View More RNA-seq Results
Ethyl ester form of meclofenamic acid [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [194]
Responsed Disease Glioblastoma ICD-11: 2A00.00
 Disease Info 
Target Regulation Down regulation
Cell Process Cells growth
Cells self-renewal
Tumorigenesis
MicroRNAs in cancer (hsa05206)
In-vitro Model GSC Glioma Epinephelus akaara CVCL_M752
In-vivo Model 2 × 105 dissociated cells in 2 uL PBS were injected into the following site (anteroposterior [AP] +0.6 mm, mediolateral [ML] +1.6 mm, and dorsoventricular [DV] 2.6 mm) with a rate of 1 uL/min.
Response Summary Knockdown of METTL3 or METTL14 induced changes in mRNA m6A enrichment and altered mRNA expression of genes (e.g., Meltrin-beta (ADAM19)) with critical biological functions in GSCs. Treatment with MA2, a chemical inhibitor of FTO, dramatically suppressed GSC-induced tumorigenesis and prolonged lifespan in GSC-grafted animals.
Neurogenic locus notch homolog protein 2 (NOTCH2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line mouse embryonic stem cells Mus musculus
Treatment: METTL3-/- ESCs
Control: Wild type ESCs
 GSE145309
Regulation
logFC: 1.84E+00
p-value: 2.61E-238
More Results Click to View More RNA-seq Results
Melittin [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [201]
Responsed Disease Bladder cancer ICD-11: 2C94
 Disease Info 
Target Regulation Down regulation
Cell Process miRNA maturation
Cell apoptosis
In-vitro Model T24 Bladder carcinoma Homo sapiens CVCL_0554
SV-HUC-1 Normal Homo sapiens CVCL_3798
EJ (Human bladder cancer cells)
BIU-87 Human bladder cancer cells Homo sapiens CVCL_6881
In-vivo Model For melittin treatment study, 4-week-old female BALB/c nude mice were subcutaneously injected with 1 × 107 T24 or BIU87 cells.
Response Summary METTL3 acts as a fate determinant that controls the sensitivity of bladder cancer cells to melittin treatment. Moreover, METTL3/miR-146a-5p/NUMB/Neurogenic locus notch homolog protein 2 (NOTCH2) axis plays an oncogenic role in bladder cancer pathogenesis and could be a potential therapeutic target for recurrent bladder cancer treatment.
Nuclear factor erythroid 2-related factor 2 (NFE2L2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line LX2 cell line Homo sapiens
Treatment: shMETTL3 LX2 cells
Control: shLuc LX2 cells
 GSE207909
Regulation
logFC: -1.10E+00
p-value: 4.72E-06
More Results Click to View More RNA-seq Results
Colistin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [65]
Responsed Disease Diseases of the urinary system ICD-11: GC2Z
 Disease Info 
Target Regulation Up regulation
Cell Process Oxidative stress
Cell apoptosis
In-vivo Model The 60 female Kunming mice were divided into two groups (n = 30): control group (injection of physiological saline through the caudal vein) and colistin group (injection of 15 mg/kg colistin, twice a day, with an eight-hour interval).
Response Summary m6A methylation was involved in oxidative stress-mediated apoptosis in the mechanism of colistin nephrotoxicity. METTL3-mediated m6A methylation modification is involved in colistin-induced nephrotoxicity through apoptosis mediated by Keap1/Nuclear factor erythroid 2-related factor 2 (NFE2L2) signaling pathway.
Nucleobindin-1 (NUCB1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line DKO-1 cell line Homo sapiens
Treatment: METTL3 knockdown DKO-1 cell
Control: DKO-1 cell
 GSE182382
Regulation
logFC: -7.45E-01
p-value: 2.41E-03
More Results Click to View More RNA-seq Results
Gemcitabine [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [204]
Responsed Disease Pancreatic ductal adenocarcinoma ICD-11: 2C10.0
 Disease Info 
Target Regulation Down regulation
Pathway Response Autophagy hsa04140
Cell Process Cell proliferation
Cell autophagy
In-vitro Model SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
HEK293T Normal Homo sapiens CVCL_0063
CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
AsPC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
In-vivo Model 5 × 106 SW1990 cells expressing NUCB1 (oeNUCB1) or control vector (oeNC) were injected subcutaneously.
Response Summary METTL3-mediated m6A modification on Nucleobindin-1 (NUCB1) 5'UTR via the reader YTHDF2 as a mechanism for NUCB1 downregulation in PDAC. This study revealed crucial functions of NUCB1 in suppressing proliferation and enhancing the effects of gemcitabine in pancreatic cancer cells.
Poly [ADP-ribose] polymerase 1 (PARP1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MOLM-13 cell line Homo sapiens
Treatment: shMETTL3 MOLM13 cells
Control: MOLM13 cells
 GSE98623
Regulation
logFC: 1.69E+00
p-value: 1.05E-54
More Results Click to View More RNA-seq Results
Oxaliplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [208]
Responsed Disease Gastric cancer ICD-11: 2B72
 Disease Info 
Target Regulation Up regulation
Pathway Response Nucleotide excision repair hsa03420
Signaling pathways regulating pluripotency of stem cells hsa04550
Cell Process RNA stability
Excision repair
In-vitro Model SNU-719 Gastric tubular adenocarcinoma Homo sapiens CVCL_5086
MKN74 Gastric tubular adenocarcinoma Homo sapiens CVCL_2791
HEK293T Normal Homo sapiens CVCL_0063
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
In-vivo Model 100,000 pLKO and PARP1-sh1 (PT1 and PT2) cells were mixed with matrix gel and inoculate into BALB/C nude mice, respectively. After 25 days, 6 organoid transplanted tumor mice were treated with oxaliplatin (Sellekchem, s1224) twice a week for 4 weeks at a dose of 5 mg/kg.
Response Summary m6A methyltransferase METTL3 facilitates oxaliplatin resistance in CD133+ gastric cancer stem cells by Promoting Poly [ADP-ribose] polymerase 1 (PARP1) mRNA stability which increases base excision repair pathway activity. METTTL3 enhances the stability of PARP1 by recruiting YTHDF1 to target the 3'-untranslated Region (3'-UTR) of PARP1 mRNA.
PR domain zinc finger protein 2 (PRDM2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Pancreatic islets Mus musculus
Treatment: Mettl3 knockout mice
Control: Mettl3 flox/flox mice
 GSE155612
Regulation
logFC: 1.05E+00
p-value: 2.68E-04
More Results Click to View More RNA-seq Results
Arsenite [Phase 2]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [27]
Responsed Disease Solid tumour/cancer ICD-11: 2A00-2F9Z
 Disease Info 
Target Regulation Up regulation
Pathway Response p53 signaling pathway hsa04115
In-vitro Model HaCaT Normal Homo sapiens CVCL_0038
Response Summary METTL3 significantly decreased m6A level, restoring p53 activation and inhibiting cellular transformation phenotypes in the arsenite-transformed cells. m6A downregulated the expression of the positive p53 regulator, PR domain zinc finger protein 2 (PRDM2), through the YTHDF2-promoted decay of PRDM2 mRNAs. m6A upregulated the expression of the negative p53 regulator, YY1 and MDM2 through YTHDF1-stimulated translation of YY1 and MDM2 mRNA. This study further sheds light on the mechanisms of arsenic carcinogenesis via RNA epigenetics.
Protein AATF (AATF/CHE1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3 knockout liver
Control: Wild type liver cells
 GSE198513
Regulation
logFC: -6.23E-01
p-value: 2.02E-10
More Results Click to View More RNA-seq Results
Doxil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [22]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Cell Process Cell growth and death
Cell apoptosis
In-vitro Model ADR-resistant MCF-7 (MCF-7/ADR) cells (Human breast cancer doxorubicin-resistant cell line)
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
In-vivo Model Cell suspensions (2 × 106 cells/mL) made with MCF-7/ADR cells stably expressing METTL3 and/or miR-221-3p inhibitor were subcutaneously implanted into each mouse. One week later, xenografted mice were injected with 0.1 mL ADR (25 mg/kg, intraperitoneal injection) twice a week.
Response Summary METTL3 promotes adriamycin resistance in MCF-7 breast cancer cells by accelerating pri-microRNA-221-3p maturation in a m6A-dependent manner. METTL3 knockdown was shown to reduce the expression of miR-221-3p by reducing pri-miR-221-3p m6A mRNA methylation, reducing the expression of MDR1 and BCRP, and inducing apoptosis. Identified the METTL3/miR-221-3p/HIPK2/Protein AATF (AATF/CHE1) axis as a novel signaling event that will be responsible for resistance of BC cells to ADR.
Protein numb homolog (NUMB)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line MDA-MB-231 Homo sapiens
Treatment: METTL3 knockdown MDA-MB-231 cells
Control: MDA-MB-231 cells
 GSE70061
Regulation
logFC: 9.75E-01
p-value: 1.24E-03
More Results Click to View More RNA-seq Results
Melittin [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [201]
Responsed Disease Bladder cancer ICD-11: 2C94
 Disease Info 
Target Regulation Down regulation
Cell Process miRNA maturation
Cell apoptosis
In-vitro Model T24 Bladder carcinoma Homo sapiens CVCL_0554
SV-HUC-1 Normal Homo sapiens CVCL_3798
EJ (Human bladder cancer cells)
BIU-87 Human bladder cancer cells Homo sapiens CVCL_6881
In-vivo Model For melittin treatment study, 4-week-old female BALB/c nude mice were subcutaneously injected with 1 × 107 T24 or BIU87 cells.
Response Summary METTL3 acts as a fate determinant that controls the sensitivity of bladder cancer cells to melittin treatment. Moreover, METTL3/miR-146a-5p/Protein numb homolog (NUMB)/NOTCH2 axis plays an oncogenic role in bladder cancer pathogenesis and could be a potential therapeutic target for recurrent bladder cancer treatment.
RAC-alpha serine/threonine-protein kinase (AKT1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3 knockout liver
Control: Wild type liver cells
 GSE198512
Regulation
logFC: 1.27E+00
p-value: 1.77E-02
More Results Click to View More RNA-seq Results
Rapamycin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [44]
Responsed Disease Retinoblastoma ICD-11: 2D02.2
 Disease Info 
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
mTOR signaling pathway hsa04150
Apoptosis hsa04210
Cell Process Cell proliferation
Cell migration
Cell invasion
Cell apoptosis
In-vitro Model WERI-Rb-1 Retinoblastoma Homo sapiens CVCL_1792
Y-79 Retinoblastoma Homo sapiens CVCL_1893
In-vivo Model To establish a subcutaneous tumour model in nude mice, 2 × 107 Y79 cells (METTL3 knockdown group: shNC, shRNA1 and shRNA2; METTL3 up-regulated group: NC and METLL3) were resuspended in 1 mL of pre-cooled PBS, and 200 uL of the cell suspension was injected subcutaneously into the left side of the armpit to investigate tumour growth (4 × 106 per mouse).
Response Summary METTL3 promotes the progression of retinoblastoma through PI3K/RAC-alpha serine/threonine-protein kinase (AKT1)/mTOR pathways in vitro and in vivo. METTL3 has an impact on the PI3K-AKT-mTOR-P70S6K/4EBP1 pathway. The cell proliferation results show that the stimulatory function of METTL3 is lost after rapamycin treatment.
Rho GTPase activating protein 5 (ARHGAP5)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Pancreatic islets Mus musculus
Treatment: Mettl3 knockout mice
Control: Mettl3 flox/flox mice
 GSE155612
Regulation
logFC: 9.85E-01
p-value: 6.23E-05
More Results Click to View More RNA-seq Results
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [215]
Responsed Disease Gastric cancer ICD-11: 2B72
 Disease Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cellular Processes
Transport and catabolism
In-vitro Model BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
Response Summary ARHGAP5-AS1 also stabilized ARHGAP5 mRNA in the cytoplasm by recruiting METTL3 to stimulate m6A modification of Rho GTPase activating protein 5 (ARHGAP5) mRNA. As a result, ARHGAP5 was upregulated to promote chemoresistance and its upregulation was also associated with poor prognosis in gastric cancer. downregulation of ARHGAP5-AS1 in resistant cells evidently reversed the resistance to chemotherapeutic drugs including cisplatin (DDP), ADM, and 5-FU.
Fluorouracil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [215]
Responsed Disease Gastric cancer ICD-11: 2B72
 Disease Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cellular processes
Cellular transport
Cellular catabolism
In-vitro Model BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
Response Summary ARHGAP5-AS1 also stabilized ARHGAP5 mRNA in the cytoplasm by recruiting METTL3 to stimulate m6A modification of Rho GTPase activating protein 5 (ARHGAP5) mRNA. As a result, ARHGAP5 was upregulated to promote chemoresistance and its upregulation was also associated with poor prognosis in gastric cancer. downregulation of ARHGAP5-AS1 in resistant cells evidently reversed the resistance to chemotherapeutic drugs including cisplatin (DDP), ADM, and 5-FU.
Adriamycin [Phase 3]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [215]
Responsed Disease Gastric cancer ICD-11: 2B72
 Disease Info 
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cellular processes
Cellular transport
Cellular catabolism
In-vitro Model BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
Response Summary ARHGAP5-AS1 also stabilized ARHGAP5 mRNA in the cytoplasm by recruiting METTL3 to stimulate m6A modification of Rho GTPase activating protein 5 (ARHGAP5) mRNA. As a result, ARHGAP5 was upregulated to promote chemoresistance and its upregulation was also associated with poor prognosis in gastric cancer. downregulation of ARHGAP5-AS1 in resistant cells evidently reversed the resistance to chemotherapeutic drugs including cisplatin (DDP), ADM, and 5-FU.
Ubiquitin-like-conjugating enzyme ATG3 (ATG3)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by METTL3
Cell Line Liver Mus musculus
Treatment: Mettl3-deficient liver
Control: Wild type liver cells
 GSE197800
Regulation
logFC: -1.62E+00
p-value: 2.55E-18
More Results Click to View More RNA-seq Results
Sorafenib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [17]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
Target Regulation Up regulation
Pathway Response FoxO signaling pathway hsa04068
Autophagy hsa04140
Cell Process Cell autophagy
Response Summary METTL3 can sensitise hepatocellular carcinoma cells to sorafenib through stabilising forkhead box class O3 (FOXO3) in an m6A-dependent manner and translated by YTHDF1, thereby inhibiting the transcription of autophagy-related genes, including Ubiquitin-like-conjugating enzyme ATG3 (ATG3), ATG5, ATG7, ATG12, and ATG16L1.
Multidrug resistance-associated protein 1 (MRP1/ABCC1)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.47E+00 GSE60213
Imatinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [252]
Responsed Disease Gastrointestinal stromal tumour ICD-11: 2B5B
 Disease Info 
Target Regulation Up regulation
In-vitro Model GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
In-vivo Model For tumor growth assay, 4 × 106 logarithmically growing GIST cells were transfected with T1S-vector, T1S-METTL3, 882S-vector, or 882S-METTL3 constructs, and subcutaneously injected in 100 ul of PBS into the flank of female nude mice(4-week-old). Mice were then randomly divided into 8 groups (n = 5 in each group): (1) injected with T1S-vector-harboring cells, and treated with imatinib (600 mg/l in drinking water); (2) injected with T1S-vector-harboring cells, and treated with imatinib (600 mg/l in drinking water) and MRP1 inhibitor (100 mg/l in drinking water); (3) injected with T1S-METTL3-harboring cells, and treated with imatinib (600 mg/l in drinking water); (4) injected with T1S-METTL3-harboring cells, and treated with imatinib (600 mg/l in drinking water) and MRP1 inhibitor (100 mg/l in drinking water); (5) injected with 882S-vector-harboring cells and treated with imatinib (600 mg/l in drinking water); (6) injected with 882S-vector-harboring cells, and treated with imatinib (600 mg/l in drinking water) and MRP1 inhibitor (100 mg/l in drinking water); (7) injected with 882S-METTL3-harboring cells, and treated with imatinib (600 mg/l in drinking water); and (8) injected with 882S-METTL3-harboring cells, and treated with imatinib (600 mg/l in drinking water) and MRP1 inhibitor (100 mg/l in drinking water).
Response Summary METTL3, and the YTHDF1/eEF-1 complex mediate the translation of Multidrug resistance-associated protein 1 (MRP1/ABCC1) mRNA in an m6A-dependent manner to regulate the intracellular concentration of imatinib and drug resistance of gastrointestinal stromal tumor (GIST).
Long intergenic non-protein coding RNA 1273 (LINC01273)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 7.26E+00 GSE60213
Sorafenib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [256]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
Target Regulation Down regulation
In-vitro Model SMMC-7721 Endocervical adenocarcinoma Homo sapiens CVCL_0534
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Response Summary Long intergenic non-protein coding RNA 1273 (LINC01273) was modified with m6A, METTL3 increased LINC01273 m6A modification, followed by LINC01273 decay in the presence of YTHDF2, a m6A 'reader'. And LINC01273 plays a key role in sorafenib resistant HCC cells.
NIFK antisense RNA 1 (NIFK-AS1)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 7.43E+00 GSE60213
Sorafenib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [258]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
Target Regulation Up regulation
In-vitro Model Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
THLE-3 Normal Homo sapiens CVCL_3804
In-vivo Model For the PDX model, fresh patient HCC tissues were cut into fragments with a volume of 3 × 3 mm3 and then implanted subcutaneously into the flanks of nude mice. The mice were given sorafenib (30 mg/kg) or vehicle orally twice a week for 24 days. This procedure was approved by the Ethics Committee of Jinling Hospital.
Response Summary Identified the lncRNA NIFK antisense RNA 1 (NIFK-AS1) as being highly expressed in hepatocellular carcinoma tissues and cells, promotes disease progression and sorafenib resistance, and showed this up-regulation resulted from METTL3-dependent m6A methylation.
Small nucleolar RNA host gene 3 (SNHG3)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and METTL3
Cell Line MDA-MB-231 Homo sapiens
Regulation logFC: 1.17E+00 GSE60213
Pt [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [259]
Responsed Disease Esophageal cancer ICD-11: 2B70
 Disease Info 
Target Regulation Up regulation
Cell Process Cellular Processes
Cell growth and death
Cell apoptosis
In-vitro Model Eca-9706 (Esophageal carcinoma cell line)
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
In-vivo Model Used 1 × 106 SNHG3 knocked down KY-SE150 cells and NC lentivirus to inject into the right flank of mice to generate xenografts.
Response Summary Platinum can increase the overall m6A level of esophageal cancer. Small nucleolar RNA host gene 3 (SNHG3)/miR-186-5p, induced by platinum, was involved in regulating m6A level by targeting METTL3. miR-186-5p binds to the 3'UTR of METTL3 to inhibit its expression. Our manuscript has provided clues that regulating m6A level was a novel way to enhance the platinum efficacy.
Apoptosis regulator Bcl-2 (BCL2)
 Target Gene 
Celastrol [Preclinical]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [267]
Responsed Disease Pancreatic cancer ICD-11: 2C10
 Disease Info 
Target Regulation Up regulation
In-vitro Model PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
AsPC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
In-vivo Model AsPC-1 cells suspended in 100 μl of PBS (2 × 106 cells/100 μl) were injected subcutaneously into the lateral flank of the mice, which were randomly divided into solvent group (n = 6), 1.0 mg/kg of celastrol group (n = 6) and 3.0 mg/kg of celastrol group (n = 6). The administration of celastrol was performed by intraperitoneal injection into tumor-bearing mice every 2 day after 10 day inoculation. The tumor sizes were monitored with calipers every 5 days, and the tumor volume was calculated with the formula: Volume (mm3) = 1/2 × length × width2.
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [268]
Responsed Disease Spinal cord injury ICD-11: ND51.2
 Disease Info 
Target Regulation Down regulation
In-vitro Model PC12 Rat adrenal gland pheochromocytoma Rattus norvegicus CVCL_0481
In-vivo Model Rats were anesthetized with intraperitoneal injection of 1% sodium pentobarbital (20 mg/kg). For constructing a rat spinal cord hemisection model, the spinal colon was marked on the T9 spinous process and the skin was incised until exposing the T9-10 spinous process. The spinal cord was completely exposed by biting the vertebral plate with biting forceps. The spinal cord was cut on one side with ophthalmic scissors centered on the central canal of the spinal cord.
E3 ubiquitin-protein ligase TRIM11 (TRIM11)
 Target Gene 
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [14]
Responsed Disease Nasopharyngeal carcinoma ICD-11: 2B6B
 Disease Info 
Target Regulation Down regulation
Pathway Response ABC transporters hsa02010
Wnt signaling pathway hsa04310
Ubiquitin mediated proteolysis hsa04120
Cell Process Ubiquitination degradation
In-vitro Model CNE-1 Normal Homo sapiens CVCL_6888
CNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_6889
In-vivo Model A total of 2 × 106 cells was mixed with 0.2 ml PBS (pH 7.4) and 30% (v/v) Matrigel matrix (BD Biosciences).
Response Summary TRIM11 regulates nasopharyngeal carcinoma drug resistance by positively modulating the Daple/beta-catenin/E3 ubiquitin-protein ligase TRIM11 (TRIM11) signaling pathway. TRIM11 enhanced the multidrug resistance in NPC by inhibiting apoptosis in vitro and promoting cisplatin (DDP) resistance in vivo. METTL3-mediated m6A modification caused the upregulation of TRIM11 via IGF2BP2 in NPC drug-resistant cells.
Histone-lysine N-methyltransferase EZH2 (EZH2)
 Target Gene 
Temozolomide [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [298]
Responsed Disease Glioblastoma ICD-11: 2A00.00
 Disease Info 
Pathway Response RNA degradation hsa03018
Cell Process mRNA decay
In-vitro Model U251 (Fibroblasts or fibroblast like cells)
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
In-vivo Model Used to inject 10 uL of the U87 MG-TMZ_R-luc cell suspension in the striatum at a depth of 3 mm from the dural surface. One week after the injection of the tumor cells, 40 mg/kg/day of TMZ in saline was administered for over 2 weeks by intraperitoneal injection.
Response Summary Uncover the fundamental mechanisms underlying the interplay of m6 A RNA modification and histone modification in Temozolomide resistance and emphasize the therapeutic potential of targeting the SOX4/EZH2/METTL3 axis in the treatment of TMZ-resistant glioblastoma.
Lactate dehydrogenase A (LDHA)
 Target Gene 
MICROCYSTIN-LR [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [306]
Responsed Disease Male infertility ICD-11: GB04
 Disease Info 
Target Regulation Up regulation
In-vitro Model
TM4
 N.A. Mus musculus CVCL_4327
Mothers against decapentaplegic homolog 3 (SMAD3)
 Target Gene 
Lenvatinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [309]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
In-vitro Model Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
In-vivo Model When the tumors in the CDX and PDX mice grew to about 80-150 mm3, forty tumor-bearing mice were randomly divided into four groups (ten mice in each group) according to the size of the transplanted tumor and the principle of consistency between groups. The four groups were: as follows: solvent control group, Len (3 mg kg-1) administration group, Res (0.375 mg kg-1) administration group, and Len (3 mg kg-1) plus Res (0.375 mg kg-1) administration group. The administration mode of all groups was intragastric and the volume was 0.2 ml/20 g. Mouse body weight and xenograft tumor volume were measured every other day. Tumor volume was measured weekly and calculated as V = (length × width2)/2. Three weeks after the onset of treatment, the tumors were excised and weighed. After the experiment, the heart, liver, spleen, lung and kidney tissues of the mice were completely removed and weighed. Then the organ index was calculated as organ index = weight of each organ/body weight × 100 %.
Reserpine [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [309]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
In-vitro Model Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
In-vivo Model When the tumors in the CDX and PDX mice grew to about 80-150 mm3, forty tumor-bearing mice were randomly divided into four groups (ten mice in each group) according to the size of the transplanted tumor and the principle of consistency between groups. The four groups were: as follows: solvent control group, Len (3 mg kg-1) administration group, Res (0.375 mg kg-1) administration group, and Len (3 mg kg-1) plus Res (0.375 mg kg-1) administration group. The administration mode of all groups was intragastric and the volume was 0.2 ml/20 g. Mouse body weight and xenograft tumor volume were measured every other day. Tumor volume was measured weekly and calculated as V = (length × width2)/2. Three weeks after the onset of treatment, the tumors were excised and weighed. After the experiment, the heart, liver, spleen, lung and kidney tissues of the mice were completely removed and weighed. Then the organ index was calculated as organ index = weight of each organ/body weight × 100 %.
NACHT, LRR and PYD domains-containing protein 3 (NLRP3)
 Target Gene 
Gefitinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [316]
Responsed Disease Lung cancer ICD-11: 2C25
 Disease Info 
In-vitro Model PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
SPC-A1 Endocervical adenocarcinoma Homo sapiens CVCL_6955
PC-9/GR2 Lung adenocarcinoma Homo sapiens CVCL_DI29
HCC827/GR
 N.A. Homo sapiens CVCL_E7R9
In-vivo Model To establish xenograft models, five-week-old male mice were orthotopically injected with the same number of the PC9/GR cells. Tumours had developed after 4 days, at which time the xenografted mice were randomly divided into the following two experimental groups (each group with 6 mice): (1) the control group and (2) the gefitinib group.
RAD51-associated protein 1 (RAD51AP1)
 Target Gene 
Fluorouracil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [327]
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Target Regulation Up regulation
In-vitro Model HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
Response Summary METTL3 augmented 5 FU induced DNA damage and overcame 5 FU resistance in HCT 8R cells, which could be mimicked by inhibition of RAD51-associated protein 1 (RAD51AP1). The present study revealed that the METTL3/RAD51AP1 axis plays an important role in the acquisition of 5 FU resistance in CRC.
Serum response factor (SRF)
 Target Gene 
Tislelizumab [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [333]
Responsed Disease Glioblastoma ICD-11: 2A00.00
 Disease Info 
In-vitro Model U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
Staphylococcal nuclease domain-containing protein 1 (SND1)
 Target Gene 
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [336]
Responsed Disease Nasal-type natural killer/T-cell lymphoma ICD-11: XH3400
 Disease Info 
Target Regulation Up regulation
In-vitro Model NK-92 Natural killer cell lymphoblastic leukemia/lymphoma Homo sapiens CVCL_2142
YTS Lymphoblastic leukemia/lymphoma Homo sapiens CVCL_D324
SNT-8 Nasal type extranodal NK/T-cell lymphoma Homo sapiens CVCL_A677
SNK-6 Nasal type extranodal NK/T-cell lymphoma Homo sapiens CVCL_A673
In-vivo Model A total of 32 nude mice were randomly divided into four groups with eight mice in each group. Nude mice were subcutaneously injected with 2 × 106 cells (suspended in 100 μl of PBS) transfected with NC shRNA or SND1 shRNA into the back flank of mice. In DDP administration group, DDP (3 mg/kg per week for 2 weeks) was intraperitoneally injected into mice every 3 days. The control group received 200 μl of 0.1% DMSO. The tumor volume was measured every week for a total of 4 weeks. The mice were sacrificed after 4 weeks, then the tumors were harvested for weight measurement and other analysis. The tumor volume (mm3) was estimated with the formula (0.5 × length × width2).
Superoxide dismutase [Mn], mitochondrial (SOD2)
 Target Gene 
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [339]
Target Regulation Up regulation
In-vitro Model HaCaT Normal Homo sapiens CVCL_0038
Suppressor of cytokine signaling 3 (SOCS3)
 Target Gene 
Colivelin [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [341]
Responsed Disease Liver cancer ICD-11: 2C12
 Disease Info 
Cycloleucine [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [344]
Responsed Disease Chronic obstructive pulmonary disease ICD-11: CA22
 Disease Info 
Target Regulation Down regulation
Arsenite [Phase 2]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [345]
Responsed Disease Human skin lesions ICD-11: ME60
 Disease Info 
Target Regulation Down regulation
Pathway Response JAK-STAT signaling pathway hsa04630
In-vitro Model HaCaT Normal Homo sapiens CVCL_0038
Thioredoxin (TXN/SASP)
 Target Gene 
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [339]
Target Regulation Up regulation
In-vitro Model HaCaT Normal Homo sapiens CVCL_0038
Transcription factor SOX-2 (SOX2)
 Target Gene 
LPS [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [350]
Responsed Disease Cognitive disorders ICD-11: 6E0Z
 Disease Info 
Target Regulation Up regulation
In-vitro Model SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
Transferrin receptor protein 1 (TFRC)
 Target Gene 
Doxil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [353]
In-vitro Model NRCMs (Primary neonatal rat cardiomyocytes (NRCMs)NRCMs were prepared from the hearts of 2- to 3-day-old SD rats according to the following protocol)
HL-1 Normal Mus musculus CVCL_0303
In-vivo Model Eight-week-old male and female mice were given DOX (5 mg/kg, Cat No. D1515, Sigma-Aldrich) or saline once weekly for 4 weeks via intraperitoneal injection [29]. For experiments with STM2457 (Cat No. SML3360, Sigma-Aldrich), WT mice received STM2457 (50 mg/kg dissolved in 10% DMSO and 90% saline, i. p.) once daily . Cardiac function was evaluated using echocardiography 1 week following the final DOX. Then, heart tissues were collected after echocardiography assessment for biochemical assays.
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [353]
In-vitro Model NRCMs (Primary neonatal rat cardiomyocytes (NRCMs)NRCMs were prepared from the hearts of 2- to 3-day-old SD rats according to the following protocol)
HL-1 Normal Mus musculus CVCL_0303
In-vivo Model Eight-week-old male and female mice were given DOX (5 mg/kg, Cat No. D1515, Sigma-Aldrich) or saline once weekly for 4 weeks via intraperitoneal injection [29]. For experiments with STM2457 (Cat No. SML3360, Sigma-Aldrich), WT mice received STM2457 (50 mg/kg dissolved in 10% DMSO and 90% saline, i. p.) once daily . Cardiac function was evaluated using echocardiography 1 week following the final DOX. Then, heart tissues were collected after echocardiography assessment for biochemical assays.
Ubiquitin carboxyl-terminal hydrolase 4 (USP4)
 Target Gene 
Metformin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [356]
Responsed Disease Multiple myeloma ICD-11: 2A83.1
 Disease Info 
Target Regulation Up regulation
In-vitro Model NCI-H929 Plasma cell myeloma Homo sapiens CVCL_1600
MM1.S Plasma cell myeloma Homo sapiens CVCL_8792
In-vivo Model 5-week-old male athymic BALB/C nude mice were obtained from Experimental animal center of Fujian Medical University, and subsequently randomly divided into four groups (5 mice per group), including control, metformin, pcDNA-METTL3 and pcDNA-METTL3 + metformin. For the control or metformin group, to induce tumors, 5 × 105 H929 cells were suspended in 0.2 ml phosphate buffered saline and inoculated subcutaneously into the peritoneum of mice. Once the subcutaneous nodules grown to a rice grain size (required approximately a week), the subcutaneous xenograft model of MM in nude mice was successfully constructed. One week later, PBS or Metformin was diluted in drinking water (2 mg/ml) and administered orally throughout the indicated time periods. For the pcDNA-METTL3 group and pcDNA-METTL3 + metformin group, firstly, we transfected pcDNA-METTL3 into H929 cells to overexpress METTL3, and then 5 × 105 H929 cells were suspended in 0.2 ml phosphate-buffered saline and inoculated subcutaneously into the peritoneum of mice. One week later, PBS or Metformin was diluted in drinking water (2 mg/ml) and administered orally throughout the indicated time periods. All nude mice were closely monitored for tumor growth, skin condition, and behavior daily and any tumor ulceration or irritation was noted. Tumor length and width were calculated with vernier calipers every 7 days. After 35 days, the mice were humanely sacrificed, and the subcutaneous tumors were excised and removed.
DBH antisense RNA 1 (Lnc_DBH-AS1)
 Target Gene 
Gemcitabine [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [359]
Responsed Disease Pancreatic cancer ICD-11: 2C10
 Disease Info 
In-vitro Model MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
HPDE Normal Homo sapiens CVCL_4376
CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
Canpan-2 (Pancreatic cancer cell line)
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
AsPC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
Response Summary DBH antisense RNA 1 (Lnc_DBH-AS1) expression in pancreatic cancer(PC) was found to be linked to the METTL3-dependent m6A methylation of the lncRNA. MechanisticallyDBH-AS1 was able to increase PC cell sensitivity to gemcitabine by sequestering miR-3163 and thus upregulating USP44 in these tumor cells.
KCNQ1 opposite strand/antisense transcript 1 (KCNQ1OT1)
 Target Gene 
Doxil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [362]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
In-vitro Model MCF-10A Normal Homo sapiens CVCL_0598
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
microRNA let-7b (MIRLET7B)
 Target Gene 
Osimertinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [384]
Responsed Disease Lung cancer ICD-11: 2C25
 Disease Info 
Pathway Response Notch signaling pathway hsa04330
In-vitro Model NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
H1975OR (Osimertinib resistant H1975 cells)
HCC827OR (Osimertinib resistant HCC827 cells)
Response Summary The participation of Metformin decreased the bindings of DNMT3a/b to the METTL3 promoter with the help of the readers of NKAP and HNRNPA2B1.the mediation of m6A formation on pri-Let-7b processing increased the mature microRNA let-7b (MIRLET7B), whose key role is to suppress the Notch signaling and to re-captivate the Osimertinib treatment.The findings open up future drug development, targeting this pathway for lung cancer patients.
hsa-miR-146a-5p
 Target Gene 
Melittin [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [201]
Responsed Disease Bladder cancer ICD-11: 2C94
 Disease Info 
Target Regulation Up regulation
Cell Process miRNA maturation
Cell apoptosis
In-vitro Model T24 Bladder carcinoma Homo sapiens CVCL_0554
SV-HUC-1 Normal Homo sapiens CVCL_3798
EJ (Human bladder cancer cells)
BIU-87 Human bladder cancer cells Homo sapiens CVCL_6881
In-vivo Model For melittin treatment study, 4-week-old female BALB/c nude mice were subcutaneously injected with 1 × 107 T24 or BIU87 cells.
Response Summary METTL3 acts as a fate determinant that controls the sensitivity of bladder cancer cells to melittin treatment. Moreover, METTL3/hsa-miR-146a-5p/NUMB/NOTCH2 axis plays an oncogenic role in bladder cancer pathogenesis and could be a potential therapeutic target for recurrent bladder cancer treatment.
hsa-miR-181d-5p
 Target Gene 
Fluorouracil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [88]
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Target Regulation Up regulation
In-vitro Model HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
In-vivo Model A tumor-bearing model was established by subcutaneously injecting 100 ul HT29 cells (5×106) followed by an intravenous injection of CAFs-derived exosomes (50 ug/mouse every three days) into the tail vein of the mice. An intraperitoneal injection of 5-FU (50 mg/kg, every week) was administered on day 12.
Response Summary METTL3 dependent m6A methylation was upregulated in CRC to promote the processing of miR 181d 5p by DGCR8. This led to increased hsa-miR-181d-5p expression, which inhibited the 5 FU sensitivity of CRC cells by targeting NCALD.
hsa-miR-186-5p
 Target Gene 
Pt [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [259]
Responsed Disease Esophageal cancer ICD-11: 2B70
 Disease Info 
Target Regulation Up regulation
Cell Process Cellular Processes
Cell growth and death
Cell apoptosis
In-vitro Model Eca-9706 (Esophageal carcinoma cell line)
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
In-vivo Model Used 1 × 106 SNHG3 knocked down KY-SE150 cells and NC lentivirus to inject into the right flank of mice to generate xenografts.
Response Summary Platinum can increase the overall m6A level of esophageal cancer. SNHG3/hsa-miR-186-5p, induced by platinum, was involved in regulating m6A level by targeting METTL3. miR-186-5p binds to the 3'UTR of METTL3 to inhibit its expression. Our manuscript has provided clues that regulating m6A level was a novel way to enhance the platinum efficacy.
hsa-miR-1914-3p
 Target Gene 
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [126]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
Pathway Response Hippo signaling pathway hsa04390
Cell Process Metabolic
In-vitro Model A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Calu-6 Lung adenocarcinoma Homo sapiens CVCL_0236
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
In-vivo Model Mice were injected with 5 × 106 lung cancer cells with stably expression of relevant plasmids and randomly divided into two groups (five mice per group) after the diameter of the xenografted tumors had reached approximately 5 mm in diameter. Xenografted mice were then administrated with PBS or DDP (3 mg/kg per day) for three times a week, and tumor volume were measured every second day.
Response Summary METTL3, YTHDF3, YTHDF1, and eIF3b directly promoted YAP translation through an interaction with the translation initiation machinery. METTL3 knockdown inhibits tumor growth and enhances sensitivity to DDP in vivo.m6A mRNA methylation initiated by METTL3 directly promotes YAP translation and increases YAP activity by regulating the MALAT1-hsa-miR-1914-3p-YAP axis to induce Non-small cell lung cancer drug resistance and metastasis.
hsa-miR-221-3p
 Target Gene 
Doxil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [22]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Cell Process Cell growth and death
Cell apoptosis
In-vitro Model ADR-resistant MCF-7 (MCF-7/ADR) cells (Human breast cancer doxorubicin-resistant cell line)
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
In-vivo Model Cell suspensions (2 × 106 cells/mL) made with MCF-7/ADR cells stably expressing METTL3 and/or miR-221-3p inhibitor were subcutaneously implanted into each mouse. One week later, xenografted mice were injected with 0.1 mL ADR (25 mg/kg, intraperitoneal injection) twice a week.
Response Summary METTL3 promotes adriamycin resistance in MCF-7 breast cancer cells by accelerating hsa-miR-221-3p maturation in a m6A-dependent manner. METTL3 knockdown was shown to reduce the expression of miR-221-3p by reducing pri-miR-221-3p m6A mRNA methylation, reducing the expression of MDR1 and BCRP, and inducing apoptosis. Identified the METTL3/miR-221-3p/HIPK2/Che-1 axis as a novel signaling event that will be responsible for resistance of BC cells to ADR.
hsa_circ_0008399 (Circ_RBM3)
 Target Gene 
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [402]
Responsed Disease Bladder cancer ICD-11: 2C94
 Disease Info 
Target Regulation Up regulation
Pathway Response Protein export hsa03060
Cell Process Eukaryotic translation
Cell apoptosis
In-vitro Model 5637 Bladder carcinoma Homo sapiens CVCL_0126
RT-4 Bladder carcinoma Homo sapiens CVCL_0036
UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
In-vivo Model Chose 4-week-old female BALB/c nude mice for tumor xenograft experiments, which randomly were divided into four groups (n = 5 per group). Bladder cancer cells (3 × 106) were subcutaneously injected into the right axilla of the nude mice.
Response Summary Circ0008399 bound WTAP to promote formation of the WTAP/METTL3/METTL14 m6A methyltransferase complex, reduce cisplatin sensitivity in bladder cancer, implicating the potential therapeutic value of targeting this axis.
2,4-dienoyl-CoA reductase [ (DECR1)
 Target Gene 
Sorafenib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [408]
Responsed Disease Liver cancer ICD-11: 2C12
 Disease Info 
Target Regulation Down regulation
In-vitro Model Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
SNU-449 Adult hepatocellular carcinoma Homo sapiens CVCL_0454
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
MIHA
 N.A. Homo sapiens CVCL_SA11
In-vivo Model For subcutaneous HCC mice xenograft model, the cell suspension was injected into the right flank of the mice (n = 5 per group).
Aryl hydrocarbon receptor (AHR)
 Target Gene 
Tislelizumab [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [333]
Responsed Disease Glioblastoma ICD-11: 2A00.00
 Disease Info 
In-vitro Model U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
Baculoviral IAP repeat-containing protein 5 (BIRC5)
 Target Gene 
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [420]
Responsed Disease Ovarian cancer ICD-11: 2C73
 Disease Info 
Target Regulation Up regulation
In-vitro Model SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
A2780 Ovarian endometrioid adenocarcinoma Homo sapiens CVCL_0134
In-vivo Model Four weeks old female BALB/c nude mice were purchased from SJA Laboratory Animal Co, Ltd (Changsha, China), and acclimated in a specific pathogen free environment for 1 week. SKOV3/DDP cells treated with shBIRC5, or shBIRC5 combined with pcDNA-IGF2BP1 plasmid (IGF2BP1) or corresponding negative control were suspended in 100 μL McCoy's 5A medium and implanted subcutaneously into the left frank of mice in 1 × 107 cells/mice. After 7 days incubation, three groups of mice received 10 mg/kg cisplatin respectively, sacrificing and tumor collecting after 30 days.
Calcium-binding and coiled-coil domain-containing protein 1 (CALCOCO1)
 Target Gene 
Paclitaxel [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [331]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
In-vitro Model HEK293T Normal Homo sapiens CVCL_0063
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model The experimental mice were housed in an SPF-grade animal laboratory at a temperature of approximately 25 °C, a humidity range of 50%, and an average daylight duration of 12 h. BALB/C female mice at 5-6 weeks of age were taken and prepared for tumor-bearing. After the mice were sacrificed, their tissues were collected, weighed and immediately snap-frozen in liquid nitrogen.
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [331]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
In-vitro Model HEK293T Normal Homo sapiens CVCL_0063
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model The experimental mice were housed in an SPF-grade animal laboratory at a temperature of approximately 25 °C, a humidity range of 50%, and an average daylight duration of 12 h. BALB/C female mice at 5-6 weeks of age were taken and prepared for tumor-bearing. After the mice were sacrificed, their tissues were collected, weighed and immediately snap-frozen in liquid nitrogen.
Catalase (CAT)
 Target Gene 
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [339]
Target Regulation Up regulation
In-vitro Model HaCaT Normal Homo sapiens CVCL_0038
CD70 antigen (CD70)
 Target Gene 
JNJ-74494550 [Phase 2]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [427]
Responsed Disease Papillary thyroid cancer ICD-11: 2D10.1
 Disease Info 
Target Regulation Down regulation
In-vitro Model Nthy-ori 3-1 Normal Homo sapiens CVCL_2659
B-CPAP Thyroid gland carcinoma Homo sapiens CVCL_0153
K1 Thyroid gland papillary carcinoma Homo sapiens CVCL_2537
C-643 Thyroid gland anaplastic carcinoma Homo sapiens CVCL_5969
BHT-101 Thyroid gland anaplastic carcinoma Homo sapiens CVCL_1085
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
In-vivo Model NCG mice (female, 4-5 weeks old, purchased from Jiangsu GemPharmatech) were acclimated for 1 week and were selected randomly to subcutaneously (s.c.) injected with 100 μl suspensions of 1 × 106 thyroid cancer cell lines. All mice were housed in animal facility under specific pathogen-free conditions. After 7 day, 5 × 106 huPBMCs were intravenously (i.v.) inoculated into mice. Mice were treated intravenously with anti-PD-1 mAb (nivolumab, 200 μg per injection), Combination (nivolumab + anti-CD70 mAb cusatuzumab, 200 μg per injection each), or PBS once a week. The treatment with M2-TAMs EVs or PBS continued in mice at 2ug EVs per injection at the tumor site twice a week [24]. The body weight of mice and the length (mm) and width (mm) of tumors were monitored every 3 or 4 days. Tumor volume (mm3) was calculated as Length × Width2 × 1/2. Tumor growth analyses were limited to 3 to 4 weeks because following this period mice started to show signs of xenograft-versus-host disease (xGVHD). Therefore, after 14 days or 21 days of PBMCs implantation, the mice were euthanized.
Circ_ASK1
 Target Gene 
Gefitinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [433]
Responsed Disease Lung adenocarcinoma ICD-11: 2C25.0
 Disease Info 
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model SPC-A1 Endocervical adenocarcinoma Homo sapiens CVCL_6955
SK-LU-1 Lung adenocarcinoma Homo sapiens CVCL_0629
NCI-H1993 Lung adenocarcinoma Homo sapiens CVCL_1512
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H1650 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1483
HEK293T Normal Homo sapiens CVCL_0063
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
BEAS-2B Normal Homo sapiens CVCL_0168
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
16HBE14o- Normal Homo sapiens CVCL_0112
In-vivo Model Established a xenograft model in BALB/c nude mice by inoculating HCC827-GR cells transfected with the constructs for circASK1 silencing, ASK1-272a.a overexpression and ASK1-272a.a overexpression/circASK1 knockdown.
Response Summary Increased YTHDF2-mediated endoribonucleolytic cleavage of m6A-modified Circ_ASK1 accounts for its downregulation in gefitinib-resistant cells. Either METTL3 silencing or YTHDF2 silencing suppressed the decay of circASK1 in HCC827-GR cells. This study provides a novel therapeutic target to overcome gefitinib resistance in LUAD patients.
Claspin (CLSPN)
 Target Gene 
Celastrol [Preclinical]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [267]
Responsed Disease Pancreatic cancer ICD-11: 2C10
 Disease Info 
Target Regulation Up regulation
In-vitro Model PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
AsPC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
In-vivo Model AsPC-1 cells suspended in 100 μl of PBS (2 × 106 cells/100 μl) were injected subcutaneously into the lateral flank of the mice, which were randomly divided into solvent group (n = 6), 1.0 mg/kg of celastrol group (n = 6) and 3.0 mg/kg of celastrol group (n = 6). The administration of celastrol was performed by intraperitoneal injection into tumor-bearing mice every 2 day after 10 day inoculation. The tumor sizes were monitored with calipers every 5 days, and the tumor volume was calculated with the formula: Volume (mm3) = 1/2 × length × width2.
Complement C1q subcomponent subunit A (C1QA)
 Target Gene 
Rituximab [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [445]
Responsed Disease Diffuse large B-cell lymphomas ICD-11: 2A81
 Disease Info 
Target Regulation Down regulation
In-vivo Model Approximately 2 × 106 Farage/R or Farage/S cells stably transfected with shNC, shC1qA or shMETTL3 were subcutaneously injected into the left flank of each mouse. When the tumor volume reached ~100 mm3, each mouse received an intraperitoneal injection of Rituximab (20 mg/kg) every 4 days for a total of 5 injections. The diameter of each tumor was examined every 4 days using a caliper, and tumor volume was calculated as follows: (length × width2)/2. At 28 days after xenograft, the mice were sacrificed and the tumors were weighed and collected.
Cytochrome P450 2B6 (CYP2B6)
 Target Gene 
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [451]
Responsed Disease Insulin resistance ICD-11: 5A44
 Disease Info 
Target Regulation Up regulation
In-vitro Model Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model C57/BL6 male mice (eight per group) were randomly divided into four groups: basal CD group, HFD + 0.9% NaCl injection group, HFD + DMSO injection group, and HFD + STM2457 (Catalog No. 2499663-01-1, Selleck Chemicals, Houston, Texas) injection group. When the mean body weight of mice in HFD group was statistically different from that of mice in the control group [(mean body weight in HFD:mean body weight in CD)/mean body weight in CD > 30%], the treatment was started once a day for one or two weeks. STM2457 was administered at a dose of 50 mg/kg and weighed prior to each injection. DMSO or saline was also administered at an equal volume. Body weight was recorded every day. Injection of STM2457 was conducted daily and totally for one or two weeks.
D-3-phosphoglycerate dehydrogenase (PHGDH)
 Target Gene 
Lenvatinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
HepG3 Hepatoblastoma Homo sapiens CVCL_Y479
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/3 days off treatment regimen was applied.
Sorafenib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/2 days off treatment regimen was applied.
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/4 days off treatment regimen was applied.
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (RPN2)
 Target Gene 
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [456]
Responsed Disease Bladder cancer ICD-11: 2C94
 Disease Info 
Pathway Response PI3K-Akt signaling pathway hsa04151
mTOR signaling pathway hsa04150
In-vitro Model 5637 Bladder carcinoma Homo sapiens CVCL_0126
T24 Bladder carcinoma Homo sapiens CVCL_0554
UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
Ena/VASP-like protein (EVL)
 Target Gene 
Isoforsythiaside [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [460]
Responsed Disease Macroscopic changes of size of the kidney ICD-11: MF54.0
 Disease Info 
Target Regulation Up regulation
In-vitro Model HEK293 Normal Homo sapiens CVCL_0045
HK-2 [Human kidney] Normal Homo sapiens CVCL_0302
In-vivo Model For the unilateral ureteral obstruction (UUO)-induced ON model, mice were subjected to permanent ureteral ligation of the left kidney ureter under aseptic and anaesthetic conditions, whereas sham-operated mice merely lacked ligation under equivalent conditions. The mice were sacrificed under anaesthesia at 3, 7 and 14 days postoperatively. For the ischemia/reperfusion (I/R)-induced renal fibrosis model, mice were recovered with blood supply after 42 min of bilateral renal artery clamping under both aseptic and anaesthetic conditions. These mice were sacrificed under anaesthesia at 7 and 14 days postoperatively. For drug treatment, isoforsythiaside was injected intraperitoneally at concentrations of 10, 25 and 50 mg/kg per day when the model was established. Similarly, the sham-operated group received an equivalent volume of saline intraperitoneally as a control. The harvested kidneys have been primarily used for morphological and histopathological observations and molecular biology studies.
Ferroptosis suppressor protein 1 (AIFM2)
 Target Gene 
iFSP1 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [463]
Responsed Disease Glioma ICD-11: 2A00.0
 Disease Info 
Target Regulation Up regulation
In-vitro Model U-251MG Astrocytoma Homo sapiens CVCL_0021
In-vivo Model Briefly, the mice were anesthetized and placed in a stereotactic frame. A burr hole was drilled into the skull (1.0 mm posterior and 3.0 mm lateral to the bregma). A 50 μL microinjector was used to inject 10 μL of 1 × 106 U251 cells suspended in the serum-free DMEM. The injection was performed slowly within 10 min and stayed for 10 min. After that, mice in cages and a cat were placed in the same room for fear stress induction .
FGD5 antisense RNA 1 (FGD5-AS1)
 Target Gene 
Paclitaxel [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [465]
Responsed Disease Endometrial cancer ICD-11: 2C76
 Disease Info 
Target Regulation Up regulation
In-vitro Model Ishikawa Endometrial adenocarcinoma Homo sapiens CVCL_2529
HHUA Endometrial adenocarcinoma Homo sapiens CVCL_3866
Fos-related antigen 2 (FOSL2)
 Target Gene 
Short-chain fatty acid-butyric acid [Phase 4]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [467]
Responsed Disease Polycystic ovary syndrome ICD-11: 5A80.1
 Disease Info 
Target Regulation Up regulation
In-vitro Model KGN Ovarian granulosa cell tumor Homo sapiens CVCL_0375
In-vivo Model Specific-pathogen-free (SPF) grade C57/B6 mice (6-8 weeks old) were purchased from Weitong Lihua Co. (Beijing, China). The mice were housed at constant temperature and humidity, and 12 h light/dark cycle a day and provided with adequate food and water.
Glutathione peroxidase 1 (GPX1)
 Target Gene 
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [339]
Target Regulation Up regulation
In-vitro Model HaCaT Normal Homo sapiens CVCL_0038
Guanine nucleotide-binding protein G (GNAO1)
 Target Gene 
Temozolomide [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [472]
Responsed Disease Glioma ICD-11: 2A00.0
 Disease Info 
hsa-mir-19a
 Target Gene 
Everolimus [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [490]
Responsed Disease Gastric cancer ICD-11: 2B72
 Disease Info 
Target Regulation Up regulation
hsa-mir-19b-1
 Target Gene 
Everolimus [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [490]
Responsed Disease Gastric cancer ICD-11: 2B72
 Disease Info 
Target Regulation Up regulation
hsa-miR-27a-3p
 Target Gene 
Propranolol [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [491]
Responsed Disease Infantile hemangioma ICD-11: 2E81
 Disease Info 
Oxymatrine [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [491]
Responsed Disease Infantile hemangioma ICD-11: 2E81
 Disease Info 
Hypoxia up-regulated protein 1 (HYOU1)
 Target Gene 
Doxil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [496]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
In-vitro Model MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
Inter-alpha-trypsin inhibitor heavy chain H1 (ITIH1)
 Target Gene 
LY2157299 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [499]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
In-vitro Model HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model HCC cells stably transfected with a firefly luciferase expression vector (1 × 106 cells 30 μL) were injected into the left liver lobe of 5-week-old male BALB/c nude mice. Luciferase bioluminescence in each mouse was measured at week 6 after injection. Mice in all the groups were sacrificed 8 weeks after injection. ii) For the lung metastasis model, we slowly injected HCC cells (1 × 106cells 100 μL) into 5-week-old male BALB/c nude mice via the tail vein. Six weeks after injection, luciferase bioluminescence was measured, and the mice were then sacrificed. iii) As described in the previous study, 6-8-week-old male wild-type C57BL/6J mice were used for hydrodynamic tail vein injection (HTVi). The pT3-EF1alpha-myr-AKT-HA (human), pT3-EF1alpha-N90-beta-catenin (human), and pT3-EF1alpha-ITIH1 (human) plasmids were constructed by using the pT3-EF1alpha vector. The pooled pT3 plasmids and the Sleeping Beauty transposon plasmid (pCMV-SB) were mixed at a ratio of 25:1 and 20 μg of each pT3 plasmid was used for each mouse.
Krueppel-like factor 9 (KLF9)
 Target Gene 
Methyl piperidine-3-carboxylate [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [507]
Responsed Disease Obesity ICD-11: 5B81
 Disease Info 
Target Regulation Up regulation
In-vitro Model 3T3-L1 Normal Mus musculus CVCL_0123
HEK293T Normal Homo sapiens CVCL_0063
AAV-293
 N.A. Homo sapiens CVCL_6871
In-vivo Model For compound treatment, mice were intraperitoneally injected with methyl piperidine-3-carboxylate (MP3C) (Shanghai Aladdin Biochemical Technology) at 2.5 mg/kg every 3 days for 2 weeks.
Long intergenic non-protein coding RNA 426 (LINC00426)
 Target Gene 
Bleomycin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [511]
Responsed Disease Cervical cancer ICD-11: 2C77
 Disease Info 
Target Regulation Up regulation
In-vitro Model HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
In-vivo Model HeLa cells were stably transfected with LINC00426 overexpression lentivirus. Subsequently, for subcutaneously implanted tumor model, mice were randomly divided into two groups, and cells (1 × 107/100 μl) mixed with the same volume of matrix gel were injected subcutaneously into the right abdomen of mice. One month later the mice were executed and the tumors were stripped and weighed, measured for volume, and used for further analysis. For tumor metastasis assay, mice were randomly grouped, and 5 × 105/100 μl HeLa cells transfected with NC and LINC00426 overexpression lentivirus were intravenously injected into the tail vein of BALB/c nude mice which were sacrificed after 1 month.
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [511]
Responsed Disease Cervical cancer ICD-11: 2C77
 Disease Info 
Target Regulation Up regulation
In-vitro Model HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
In-vivo Model HeLa cells were stably transfected with LINC00426 overexpression lentivirus. Subsequently, for subcutaneously implanted tumor model, mice were randomly divided into two groups, and cells (1 × 107/100 μl) mixed with the same volume of matrix gel were injected subcutaneously into the right abdomen of mice. One month later the mice were executed and the tumors were stripped and weighed, measured for volume, and used for further analysis. For tumor metastasis assay, mice were randomly grouped, and 5 × 105/100 μl HeLa cells transfected with NC and LINC00426 overexpression lentivirus were intravenously injected into the tail vein of BALB/c nude mice which were sacrificed after 1 month.
Imatinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [511]
Responsed Disease Cervical cancer ICD-11: 2C77
 Disease Info 
Target Regulation Up regulation
In-vitro Model HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
In-vivo Model HeLa cells were stably transfected with LINC00426 overexpression lentivirus. Subsequently, for subcutaneously implanted tumor model, mice were randomly divided into two groups, and cells (1 × 107/100 μl) mixed with the same volume of matrix gel were injected subcutaneously into the right abdomen of mice. One month later the mice were executed and the tumors were stripped and weighed, measured for volume, and used for further analysis. For tumor metastasis assay, mice were randomly grouped, and 5 × 105/100 μl HeLa cells transfected with NC and LINC00426 overexpression lentivirus were intravenously injected into the tail vein of BALB/c nude mice which were sacrificed after 1 month.
Long intergenic non-protein coding RNA 662 (LINC00662)
 Target Gene 
Docetaxel [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [513]
Responsed Disease Triple-negative breast cancer ICD-11: 2C6Z
 Disease Info 
Target Regulation Up regulation
In-vitro Model MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
Long-chain-fatty-acid--CoA ligase 4 (ACSL4)
 Target Gene 
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [515]
Responsed Disease Sepsis-associated lung injury ICD-11: NB30.4
 Disease Info 
Target Regulation Up regulation
In-vitro Model
MLE-12
 N.A. Mus musculus CVCL_3751
In-vivo Model To investigate the effect of lactate on sepsis-induced lung injury, sodium oxalate (0.75 g/kg body weight, Selleck, S6871) [18] or 2-DG (0.5 g/kg body weight, Selleck, S4701) [19] was injected intraperitoneally 3 h before CLP or sham operation to inhibit lactate production. To suppress METTL3 levels, mice were injected with STM2457 (30 mg/kg body weight, MedChemExpress, HY-134836) 12 h before CLP or sham surgery, with a supplemental injection of STM2457 before surgery.
m7GpppN-mRNA hydrolase (DCP2)
 Target Gene 
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [517]
Responsed Disease Small cell lung cancer ICD-11: 2C25.1
 Disease Info 
Target Regulation Down regulation
In-vitro Model
H-69
 N.A. Homo sapiens CVCL_8121
H69AR Lung small cell carcinoma Homo sapiens CVCL_3513
H446 Lung small cell carcinoma Homo sapiens CVCL_1562
HBE1
 N.A. Homo sapiens CVCL_0287
In-vivo Model SCLC cells were collected, and cell suspensions were prepared at a concentration of 1 × 106 cells per 100 μL PBS and injected subcutaneously into nude mice. When the tumour volume reached 60 mm3, mice were randomly divided into control and treatment groups with five mice in each group. The mice in the treatment group were treated regularly, and chemotherapy drugs (CDDP 3 mg/kg and VP16 2 mg/kg) were administered via intraperitoneal injection.
miR-17-92
 Target Gene 
Everolimus [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [490]
Responsed Disease Gastric cancer ICD-11: 2B72
 Disease Info 
Target Regulation Up regulation
Pathway Response mTOR signaling pathway hsa04150
PI3K-Akt signaling pathway hsa04151
Cell Process miRNA maturation
In-vitro Model MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
In-vivo Model For subcutaneous xenograft models, 0.1 mL of cell suspension containing 106 cells were injected subcutaneously into the right flank of mice (n = 6 for each group).
Response Summary In gastric cancer, m6A facilitated processing of pri-miR-17-92 into the miR-17-92 cluster through an m6A/DGCR8-dependent mechanism. METTL3-high tumors showed preferred sensitivity to an mTOR inhibitor, everolimus.
Mitogen-activated protein kinase 13 (MAPK13)
 Target Gene 
Rapamycin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [519]
Target Regulation Down regulation
In-vitro Model 621-101 Lung lymphangioleiomyomatosis Homo sapiens CVCL_S879
HEK293-EBNA
 N.A. Homo sapiens CVCL_6974
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
BT-549 Invasive breast carcinoma Homo sapiens CVCL_1092
UMB1949 Kidney angiomyolipoma Homo sapiens CVCL_C471
Neuronal acetylcholine receptor subunit alpha-4 (CHRNA4)
 Target Gene 
Bisphenol A [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [525]
Responsed Disease Cognitive disorders ICD-11: 6E0Z
 Disease Info 
Target Regulation Up regulation
In-vivo Model Rats were tested in the Morris Water Maze (MWM) after PND 60. The experimental device was a circular tank with a diameter of 120 cm and depth of 40 cm, containing water held at a constant 23 ± 1 °C. Rats were allowed to swim to a settled platform (a round, clear acrylic panel) for no more than 90 s with its top surface submerged 1.5 cm below the water level. Caramel was dissolved in water to ensuring that rats cannot directly observe the platform position. Rats were released from different positions in the water maze, and each rat performed four trials daily for five days. The escape latency was automatically recorded. On the sixth day, the rats were given a 90-s retention trial in which the platform was removed, and the mean speed, relative time in zone 2 and relative distance in zone 2 were recorded.
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [525]
Responsed Disease Cognitive disorders ICD-11: 6E0Z
 Disease Info 
Target Regulation Up regulation
In-vivo Model Rats were tested in the Morris Water Maze (MWM) after PND 60. The experimental device was a circular tank with a diameter of 120 cm and depth of 40 cm, containing water held at a constant 23 ± 1 °C. Rats were allowed to swim to a settled platform (a round, clear acrylic panel) for no more than 90 s with its top surface submerged 1.5 cm below the water level. Caramel was dissolved in water to ensuring that rats cannot directly observe the platform position. Rats were released from different positions in the water maze, and each rat performed four trials daily for five days. The escape latency was automatically recorded. On the sixth day, the rats were given a 90-s retention trial in which the platform was removed, and the mean speed, relative time in zone 2 and relative distance in zone 2 were recorded.
Nuclear factor of activated T-cells 5 (NFAT5)
 Target Gene 
Gemcitabine [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [528]
Responsed Disease Intrahepatic cholangiocarcinoma ICD-11: 2C12.10
 Disease Info 
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [528]
Responsed Disease Intrahepatic cholangiocarcinoma ICD-11: 2C12.10
 Disease Info 
Nuclear receptor subfamily 4 group A member 2 (NR4A2)
 Target Gene 
Celecoxib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [530]
Responsed Disease Esophageal Squamous Cell Carcinoma ICD-11: 2B70.1
 Disease Info 
In-vitro Model KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
Eca-109 Esophageal squamous cell carcinoma Homo sapiens CVCL_6898
KYSE-450 Esophageal squamous cell carcinoma Homo sapiens CVCL_1353
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
HET-1A Normal Homo sapiens CVCL_3702
HEK293T Normal Homo sapiens CVCL_0063
Oxidized low-density lipoprotein receptor 1 (OLR1)
 Target Gene 
Temozolomide [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [534]
Responsed Disease Glioma ICD-11: 2A00.0
 Disease Info 
Target Regulation Up regulation
In-vitro Model U-343MG Glioblastoma Homo sapiens CVCL_S471
U-251MG Astrocytoma Homo sapiens CVCL_0021
Paired box protein Pax-8 (PAX8)
 Target Gene 
Sodium iodide I 131 [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [535]
Responsed Disease Thyroid Cancer ICD-11: 2D10
 Disease Info 
Target Regulation Up regulation
In-vitro Model B-CPAP Thyroid gland carcinoma Homo sapiens CVCL_0153
KTC-1 Thyroid carcinoma Homo sapiens CVCL_6300
TPC-1 Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
K1 Thyroid gland papillary carcinoma Homo sapiens CVCL_2537
CAL-62 Thyroid gland anaplastic carcinoma Homo sapiens CVCL_1112
C-643 Thyroid gland anaplastic carcinoma Homo sapiens CVCL_5969
Nthy-ori 3-1 Normal Homo sapiens CVCL_2659
In-vivo Model A concentration of 1 × 107 CAL62 cells stably transfected with OE METTL3 or OE METTL3/shPAX8-transfected CAL-62 cells were injected subcutaneously into the dorsal flanks of the mice (five mice per group) to establish a xenograft model.
Phosphoserine aminotransferase (PSAT1)
 Target Gene 
Lenvatinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/6 days off treatment regimen was applied.
Sorafenib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/5 days off treatment regimen was applied.
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/7 days off treatment regimen was applied.
Phosphoserine phosphatase (PSPH)
 Target Gene 
Lenvatinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/9 days off treatment regimen was applied.
Sorafenib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/8 days off treatment regimen was applied.
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [452]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
In-vitro Model
MIHA
 N.A. Homo sapiens CVCL_SA11
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model For the subcutaneous injection model, 3 × 106 MHCC97L cells were washed with PBS thrice and resuspended in 100 μL 1:1 Matrixgel and DMEM-HG. HDTVi was performed as previously described.44 Plasmids were extracted using an EndoFree Plasmid extraction kit (QIAGEN). Plasmid sequence was confirmed using Sanger sequencing. A 2 mL mixture of 20 μg sgTp53 plasmids, 10 μg Myc overexpression plasmids, and 2 μg SB13 plasmids was dissolved in saline of 10% mice body weight and was tail-vein injected into C57BL/6 mice weighing at least 25 g. Plasmids were co-injected in the lateral tail vein to induce spontaneous HCC formation. Three weeks after HDTVi, mice were randomly subjected to vehicle or STM2457 treatment. STM2457 (DC chemicals) was dissolved in 20% (w/v) 2-hydroxyproply beta-cyclodextrin vehicle (Sigma, H107) and injected intraperitoneally. Sorafenib powder (Selleckchem) was dissolved in distilled water and administrated via oral gavage. A 5 days on/9 days off treatment regimen was applied.
Polyunsaturated fatty acid lipoxygenase ALOX12 (ALOX12)
 Target Gene 
Erianin [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [277]
Responsed Disease Renal cell carcinoma ICD-11: 2C90
 Disease Info 
Target Regulation Down regulation
Prostaglandin E2 receptor EP4 subtype (PTGER2)
 Target Gene 
Carboplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [546]
Responsed Disease Ovarian cancer ICD-11: 2C73
 Disease Info 
Target Regulation Up regulation
Pseudorabies Virus (PRV)
 Target Gene 
3-deazidenosine [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [552]
Responsed Disease Rabies ICD-11: 1C82
 Disease Info 
Target Regulation Up regulation
In-vitro Model
PK-15
 N.A. Sus scrofa CVCL_2160
Receptor-interacting serine/threonine-protein kinase 4 (RIPK4)
 Target Gene 
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [557]
Responsed Disease Malignant mixed epithelial mesenchymal tumour of ovary ICD-11: 2B5D.0
 Disease Info 
Target Regulation Up regulation
Pathway Response NF-kappa B signaling pathway hsa04064
In-vitro Model SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
A2780 Ovarian endometrioid adenocarcinoma Homo sapiens CVCL_0134
In-vivo Model Animals were purchased from Changzhou Cavens Laboratory Animal Company (Changzhou, China) and maintained under specific pathogen-free (SPF) conditions. All animal experiments were performed in accordance with the guidelines of the Laboratory Animal Health Committee of Jiangsu University. Approximately 1 × 107 cells were injected subcutaneously into the dorsal surface of female BALB/c nude mice (n = 5 for each group, 4 weeks old, 15 ± 2 g). When the xenograft volume reached approximately 60 mm3 (after 1 week), DDP was intraperitoneally injected three times per week for 3 weeks. On Day 28, the mice were sacrificed and the tumors were frozen at -80 °C for follow-up experiments.
RNA component of 7SK nuclear ribonucleoprotein (RN7SK)
 Target Gene 
Etoposide [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [560]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
BEL-7404 Endocervical adenocarcinoma Homo sapiens CVCL_6568
BEL-7402 Endocervical adenocarcinoma Homo sapiens CVCL_5492
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model For the generation of PDX mouse models, fresh LUSC specimens (2-3 mm3), which were from Shanghai Chest Hospital, were implanted into 4- to 6-week-old athymic nude mice (Jiesijie, Shanghai, China). After successful tumor growth was confirmed, the tumor tissues were passaged and implanted into the next generation of mice. The third to fifth generations of PDX-bearing mice were used for drug administration. When tumors reached approximately 200 mm3, mice were injected daily with DMSO (no. ST038, Beyotime Biotechnology, Shanghai, China) with or without MIT (no. S2485, 5 mg/kg, Selleck, Houston, TX) or HYD (no. S1896, 20 mg/kg, Selleck) (n = 5 mice/group). Tumor growth was monitored, and sizes were calculated by 0.5 × L × W2 (L indicating length and W indicating width). The mice were euthanized at day 28 after implantation. All animal experiments were approved by the institutional ethics committee of Shanghai Chest Hospital (approval number KS(Y)21381).
Hydroxyurea [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [560]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
BEL-7404 Endocervical adenocarcinoma Homo sapiens CVCL_6568
BEL-7402 Endocervical adenocarcinoma Homo sapiens CVCL_5492
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model For the generation of PDX mouse models, fresh LUSC specimens (2-3 mm3), which were from Shanghai Chest Hospital, were implanted into 4- to 6-week-old athymic nude mice (Jiesijie, Shanghai, China). After successful tumor growth was confirmed, the tumor tissues were passaged and implanted into the next generation of mice. The third to fifth generations of PDX-bearing mice were used for drug administration. When tumors reached approximately 200 mm3, mice were injected daily with DMSO (no. ST038, Beyotime Biotechnology, Shanghai, China) with or without MIT (no. S2485, 5 mg/kg, Selleck, Houston, TX) or HYD (no. S1896, 20 mg/kg, Selleck) (n = 5 mice/group). Tumor growth was monitored, and sizes were calculated by 0.5 × L × W2 (L indicating length and W indicating width). The mice were euthanized at day 28 after implantation. All animal experiments were approved by the institutional ethics committee of Shanghai Chest Hospital (approval number KS(Y)21381).
Mitoxantrone [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [560]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
BEL-7404 Endocervical adenocarcinoma Homo sapiens CVCL_6568
BEL-7402 Endocervical adenocarcinoma Homo sapiens CVCL_5492
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model For the generation of PDX mouse models, fresh LUSC specimens (2-3 mm3), which were from Shanghai Chest Hospital, were implanted into 4- to 6-week-old athymic nude mice (Jiesijie, Shanghai, China). After successful tumor growth was confirmed, the tumor tissues were passaged and implanted into the next generation of mice. The third to fifth generations of PDX-bearing mice were used for drug administration. When tumors reached approximately 200 mm3, mice were injected daily with DMSO (no. ST038, Beyotime Biotechnology, Shanghai, China) with or without MIT (no. S2485, 5 mg/kg, Selleck, Houston, TX) or HYD (no. S1896, 20 mg/kg, Selleck) (n = 5 mice/group). Tumor growth was monitored, and sizes were calculated by 0.5 × L × W2 (L indicating length and W indicating width). The mice were euthanized at day 28 after implantation. All animal experiments were approved by the institutional ethics committee of Shanghai Chest Hospital (approval number KS(Y)21381).
Oxaliplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [560]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
BEL-7404 Endocervical adenocarcinoma Homo sapiens CVCL_6568
BEL-7402 Endocervical adenocarcinoma Homo sapiens CVCL_5492
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model For the generation of PDX mouse models, fresh LUSC specimens (2-3 mm3), which were from Shanghai Chest Hospital, were implanted into 4- to 6-week-old athymic nude mice (Jiesijie, Shanghai, China). After successful tumor growth was confirmed, the tumor tissues were passaged and implanted into the next generation of mice. The third to fifth generations of PDX-bearing mice were used for drug administration. When tumors reached approximately 200 mm3, mice were injected daily with DMSO (no. ST038, Beyotime Biotechnology, Shanghai, China) with or without MIT (no. S2485, 5 mg/kg, Selleck, Houston, TX) or HYD (no. S1896, 20 mg/kg, Selleck) (n = 5 mice/group). Tumor growth was monitored, and sizes were calculated by 0.5 × L × W2 (L indicating length and W indicating width). The mice were euthanized at day 28 after implantation. All animal experiments were approved by the institutional ethics committee of Shanghai Chest Hospital (approval number KS(Y)21381).
Raltitrexed [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [560]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
BEL-7404 Endocervical adenocarcinoma Homo sapiens CVCL_6568
BEL-7402 Endocervical adenocarcinoma Homo sapiens CVCL_5492
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model For the generation of PDX mouse models, fresh LUSC specimens (2-3 mm3), which were from Shanghai Chest Hospital, were implanted into 4- to 6-week-old athymic nude mice (Jiesijie, Shanghai, China). After successful tumor growth was confirmed, the tumor tissues were passaged and implanted into the next generation of mice. The third to fifth generations of PDX-bearing mice were used for drug administration. When tumors reached approximately 200 mm3, mice were injected daily with DMSO (no. ST038, Beyotime Biotechnology, Shanghai, China) with or without MIT (no. S2485, 5 mg/kg, Selleck, Houston, TX) or HYD (no. S1896, 20 mg/kg, Selleck) (n = 5 mice/group). Tumor growth was monitored, and sizes were calculated by 0.5 × L × W2 (L indicating length and W indicating width). The mice were euthanized at day 28 after implantation. All animal experiments were approved by the institutional ethics committee of Shanghai Chest Hospital (approval number KS(Y)21381).
RNA-binding protein 25 (RBM25)
 Target Gene 
Metformin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [356]
Responsed Disease Multiple myeloma ICD-11: 2A83.1
 Disease Info 
Target Regulation Up regulation
In-vitro Model NCI-H929 Plasma cell myeloma Homo sapiens CVCL_1600
MM1.S Plasma cell myeloma Homo sapiens CVCL_8792
In-vivo Model 5-week-old male athymic BALB/C nude mice were obtained from Experimental animal center of Fujian Medical University, and subsequently randomly divided into four groups (5 mice per group), including control, metformin, pcDNA-METTL3 and pcDNA-METTL3 + metformin. For the control or metformin group, to induce tumors, 5 × 105 H929 cells were suspended in 0.2 ml phosphate buffered saline and inoculated subcutaneously into the peritoneum of mice. Once the subcutaneous nodules grown to a rice grain size (required approximately a week), the subcutaneous xenograft model of MM in nude mice was successfully constructed. One week later, PBS or Metformin was diluted in drinking water (2 mg/ml) and administered orally throughout the indicated time periods. For the pcDNA-METTL3 group and pcDNA-METTL3 + metformin group, firstly, we transfected pcDNA-METTL3 into H929 cells to overexpress METTL3, and then 5 × 105 H929 cells were suspended in 0.2 ml phosphate-buffered saline and inoculated subcutaneously into the peritoneum of mice. One week later, PBS or Metformin was diluted in drinking water (2 mg/ml) and administered orally throughout the indicated time periods. All nude mice were closely monitored for tumor growth, skin condition, and behavior daily and any tumor ulceration or irritation was noted. Tumor length and width were calculated with vernier calipers every 7 days. After 35 days, the mice were humanely sacrificed, and the subcutaneous tumors were excised and removed.
Serine/threonine-protein kinase Nek6 (NEK6)
 Target Gene 
Rapamycin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [568]
Responsed Disease Traumatic brain injury induced by controlled cortical impact injury ICD-11: NA07
 Disease Info 
In-vitro Model SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
SREBF2 antisense RNA 1 (SREBF2-AS1)
 Target Gene 
Sorafenib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [575]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
Target Regulation Up regulation
In-vitro Model Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
SNU-398 Adult hepatocellular carcinoma Homo sapiens CVCL_0077
THLE-2 Normal Homo sapiens CVCL_3803
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Superoxide dismutase 1 (SOD1)
 Target Gene 
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [339]
Target Regulation Up regulation
In-vitro Model HaCaT Normal Homo sapiens CVCL_0038
Thyroid hormone receptor-associated protein 3 (THRAP3)
 Target Gene 
Metformin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [356]
Responsed Disease Multiple myeloma ICD-11: 2A83.1
 Disease Info 
Target Regulation Up regulation
In-vitro Model NCI-H929 Plasma cell myeloma Homo sapiens CVCL_1600
MM1.S Plasma cell myeloma Homo sapiens CVCL_8792
In-vivo Model 5-week-old male athymic BALB/C nude mice were obtained from Experimental animal center of Fujian Medical University, and subsequently randomly divided into four groups (5 mice per group), including control, metformin, pcDNA-METTL3 and pcDNA-METTL3 + metformin. For the control or metformin group, to induce tumors, 5 × 105 H929 cells were suspended in 0.2 ml phosphate buffered saline and inoculated subcutaneously into the peritoneum of mice. Once the subcutaneous nodules grown to a rice grain size (required approximately a week), the subcutaneous xenograft model of MM in nude mice was successfully constructed. One week later, PBS or Metformin was diluted in drinking water (2 mg/ml) and administered orally throughout the indicated time periods. For the pcDNA-METTL3 group and pcDNA-METTL3 + metformin group, firstly, we transfected pcDNA-METTL3 into H929 cells to overexpress METTL3, and then 5 × 105 H929 cells were suspended in 0.2 ml phosphate-buffered saline and inoculated subcutaneously into the peritoneum of mice. One week later, PBS or Metformin was diluted in drinking water (2 mg/ml) and administered orally throughout the indicated time periods. All nude mice were closely monitored for tumor growth, skin condition, and behavior daily and any tumor ulceration or irritation was noted. Tumor length and width were calculated with vernier calipers every 7 days. After 35 days, the mice were humanely sacrificed, and the subcutaneous tumors were excised and removed.
Transmembrane protein 127 (TMEM127)
 Target Gene 
Rapamycin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [584]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
In-vitro Model MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
T-47D Invasive breast carcinoma Homo sapiens CVCL_0553
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model Approximately 1 × 106 viable MDA-MB-231 breast cancer cells were resuspended in 1:1 ratio in 50 μl medium and 50 μl matrigel (Corning, 354234) and injected orthotopically into the fourth mammary fat pad of each mouse. After injection, tumor size was measured twice a week using an electronic caliper. Tumor volumes were calculated with the formula: volume = (L × W2)/2, where L is the tumor length and W is the tumor width measured in millimeters.
Ubiquitin carboxyl-terminal hydrolase 13 (USP13)
 Target Gene 
3-Methyladenine [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [587]
Responsed Disease Gastrointestinal stromal tumor ICD-11: 2B5B
 Disease Info 
Target Regulation Up regulation
In-vitro Model GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
In-vivo Model 6 × 106 logarithmically growing GIST cells resuspended in 100 μL PBS were injected subcutaneously into the flank of 6-week-old female nude mice for tumor growth assays. The following treatments were initiated when the tumor volume reached approximately 300 mm3. (1) IM-sensitive GIST cell lines and IM-resistant GIST cell lines were used to establish a subcutaneous xenograft model of GIST (n = 6 mice/group). When the tumors grew to the required size, mice were treated with IM via drinking water; (2) GIST cells were pretreated with USP13 lentivirus or USP13 control lentivirus. In addition, IM-resistant GIST cells were pretreated with USP13 inhibitors or control. These lentivirus-transfected cells were implanted into subcutaneous mice tumors to construct the USP13 positive, USP13-negative, and control groups (n = 6 mice/group). When the transplanted tumor grew to the required volume, mice in each group were treated with IM via drinking water. (3) IM-resistant GIST cells-xenografted mice and control mice were treated with USP13 inhibitors or with USP13 inhibitors and autophagy inhibitors in combination therapy to assess reversal of IM resistance (n = 6 mice/group). Mice were treated with IM (45 mg/kg/day) and with or without 3-MA (15 mg/kg/day) via drinking water when the tumors grew to the required size. The USP13 inhibitor Spautin-1 was used at 20 mg/kg/day when required.
Spautin 1 [Preclinical]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [587]
Responsed Disease Gastrointestinal stromal tumor ICD-11: 2B5B
 Disease Info 
Target Regulation Up regulation
In-vitro Model GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
In-vivo Model 6 × 106 logarithmically growing GIST cells resuspended in 100 μL PBS were injected subcutaneously into the flank of 6-week-old female nude mice for tumor growth assays. The following treatments were initiated when the tumor volume reached approximately 300 mm3. (1) IM-sensitive GIST cell lines and IM-resistant GIST cell lines were used to establish a subcutaneous xenograft model of GIST (n = 6 mice/group). When the tumors grew to the required size, mice were treated with IM via drinking water; (2) GIST cells were pretreated with USP13 lentivirus or USP13 control lentivirus. In addition, IM-resistant GIST cells were pretreated with USP13 inhibitors or control. These lentivirus-transfected cells were implanted into subcutaneous mice tumors to construct the USP13 positive, USP13-negative, and control groups (n = 6 mice/group). When the transplanted tumor grew to the required volume, mice in each group were treated with IM via drinking water. (3) IM-resistant GIST cells-xenografted mice and control mice were treated with USP13 inhibitors or with USP13 inhibitors and autophagy inhibitors in combination therapy to assess reversal of IM resistance (n = 6 mice/group). Mice were treated with IM (45 mg/kg/day) and with or without 3-MA (15 mg/kg/day) via drinking water when the tumors grew to the required size. The USP13 inhibitor Spautin-1 was used at 20 mg/kg/day when required.
Zinc finger and BTB domain-containing protein 7C (ZBTB7C)
 Target Gene 
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [588]
Responsed Disease Osteosarcoma ICD-11: 2B51
 Disease Info 
Target Regulation Up regulation
In-vitro Model MNNG/HOS Cl #5 Osteosarcoma Homo sapiens CVCL_0439
MG-63 Osteosarcoma Homo sapiens CVCL_0426
L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
hFOB 1.19 Normal Homo sapiens CVCL_3708
In-vivo Model (1) ZBTB7C functional assay in vivo, 2 × 106 MNNG/HOS cells were stably transfected with lentivirus (vector control and si-ZBTB7C, n = 5), and then subcutaneously incubated in BALB/c nude mice; (2) STM2457 intervention. MNNG/HOS cells were implanted subcutaneously first. When tumors reached approximately 80-100 mm3, PBS or STM2457 (30 mg/kg (STM-30), 60 mg/kg (STM-60), n = 4) were administered every 2 days; (3) ZBTB7C effects of STM2457 assay. Mice were assigned to 4 groups (n = 5 per group). Two groups had MNNG/HOS cells stably transfected with lentiviral vectors (Ctrl) and 2 with lentivirus-mediated ZBTB7C overexpression (ZBTB7C-OE), and then mice were treated with control vehicle or STM2457 (60 mg/kg), respectively. The experiments went on for 22 days, and the xenografted tumors were measured, weighted, and characterized by H&E and IHC staining.
Unspecific Target Gene
Arsenite [Phase 2]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [590]
Cell Process Cell apoptosis
In-vitro Model HBE (Human bronchial epithelial cell line)
Response Summary m6A modification on RNA was significantly increased in arsenite-transformed cells and this modification was synergistically regulated by METTL3, METTL14, WTAP and FTO. Demonstrated the significant role of m6A in the prevention of tumor occurrence and progression induced by arsenite.
Gemcitabine [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [599]
Responsed Disease Pancreatic cancer ICD-11: 2C10
 Disease Info 
Pathway Response Adipocytokine signaling pathway hsa04920
Cell Process Epithelial-mesenchymal transition
In-vitro Model BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
HDE-CT cell line (A normal human pancreatic cell line)
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response Summary Lasso regression identified a six-m6A-regulator-signature prognostic model (KIAA1429, HNRNPC, METTL3, YTHDF1, IGF2BP2, and IGF2BP3). Gene set enrichment analysis revealed m6A regulators (KIAA1429, HNRNPC, and IGF2BP2) were related to multiple biological behaviors in pancreatic cancer, including adipocytokine signaling, the well vs. poorly differentiated tumor pathway, tumor metastasis pathway, epithelial mesenchymal transition pathway, gemcitabine resistance pathway, and stemness pathway.
Lenvatinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [602]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
In-vitro Model Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model To increase the accuracy of the experimental results in vivo, we subcutaneously transplanted tumor tissues from HCC patients into BALB/c nude mice and then treated the tumor-bearing mice with lenvatinib to establish a Lenvatinib-resistant PDX mode.
A939572 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [623]
Responsed Disease Cardiomegaly ICD-11: BC45
 Disease Info 
In-vivo Model Slack Laboratory Animal Co., Ltd. (Shanghai, China) supplied the six-week-old C57BL/6 male mice. Animals were reared at constant temperature (21 ± 1 °C) and maintained in a room with water and food during a 12 h dark/light cycle. After acclimatizing for a week, the animals were randomly assigned to two groups: model (TAC) and control (sham). In the TACgroup, the aortic arch of the mice was constricted using a 27 G needle and 6.0 sutures. The Sham group was operated in the same way as the TAC group without ligation of the aorta. All mice were housed for four weeks for further research.
STM2457 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [627]
Responsed Disease Rheumatoid arthritis ICD-11: FA20
 Disease Info 
In-vivo Model DBA/1 mice were injected intradermally with 100 μg of bovine type II collagen (CII) emulsified in 50 μL of complete Freund's adjuvant at a 1:1 ratio (vol/vol) as primary immunization on day 0. On day 21, the mice were boosted with CII emulsified at a 1:1 ratio in incomplete Freund's adjuvant. The weight, arthritis score, and thickness of the paws were observed and recorded once every 3 days. Starting on day 21, the CIA mice were administered an equal volume of methotrexate (MTX, 1 mg/kg) and METTL3 inhibitor STM2457 (50 mg/kg), which were intraperitoneally injected with twice a week. All mice were sacrificed and specimens were harvested on day 63.
Ethyl ester form of meclofenamic acid [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [630]
Responsed Disease Male infertility ICD-11: GB04
 Disease Info 
Cell Process Cell cycle
Cell proliferation
In-vitro Model GC-1 spg Normal Mus musculus CVCL_8872
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model Mouse GC-1 spg cells were treated with the ester form of meclofenamic acid (MA2) to inhibit the demethylase activity of FTO.
Response Summary METTL3, METTL14, ALKBH5 and YTHDC2 are involved in the regulation of spermatogenesis and oogenesis. MA2 affected CDKs expression through the m6A-dependent mRNA degradation pathway, and thus repressed spermatogonial proliferation. Additionally, mutation of the predicted m6A sites in the Cdk2-3'UTR could mitigated the degradation of CDK2 mRNA after MA2 treatment.
BHBA [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [635]
Responsed Disease Liver injury ICD-11: NB91.1
 Disease Info 
Click to View Potential Drug Response of This Regulator
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
RNA modification
m6A Target: Cyclin-dependent kinase inhibitor 1 (CDKN1A)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00001
 Crosstalk Info 
Epigenetic Regulator RNA cytosine C(5)-methyltransferase NSUN2 (NSUN2)
Regulated Target Cyclin-dependent kinase inhibitor 1 (CDKN1A)
Crosstalk relationship m5C → m6A
m6A Target: Tyrosine-protein kinase EIF2AK2 (eIF2AK2/p68)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00003
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Tyrosine-protein kinase EIF2AK2 (eIF2AK2/p68)
Crosstalk relationship m6A → A-to-I
Drug US9650366, 12
 Drug Info 
m6A Target: LIM domain-containing protein ajuba (AJUBA)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00004
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target LIM domain-containing protein ajuba (AJUBA)
Crosstalk relationship m6A → A-to-I
m6A Target: Small nuclear ribonucleoprotein Sm D3 (SNRPD3)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00005
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Small nuclear ribonucleoprotein Sm D3 (SNRPD3)
Crosstalk relationship m6A → A-to-I
m6A Target: DNA replication complex GINS protein SLD5 (GINS4)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00006
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target DNA replication complex GINS protein SLD5 (GINS4)
Crosstalk relationship m6A → A-to-I
m6A Target: Mitochondrial import inner membrane translocase subunit TIM50 (TIMM50)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00007
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Mitochondrial import inner membrane translocase subunit TIM50 (TIMM50)
Crosstalk relationship m6A → A-to-I
m6A Target: Protein-S-isoprenylcysteine O-methyltransferase (ICMT)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00008
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Protein-S-isoprenylcysteine O-methyltransferase (ICMT)
Crosstalk relationship m6A → A-to-I
m6A Target: Interleukin-17 receptor D (IL17RD)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00009
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Interleukin-17 receptor D (IL17RD)
Crosstalk relationship m6A → A-to-I
m6A Target: Gap junction gamma-1 protein (GJC1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00010
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Gap junction gamma-1 protein (GJC1)
Crosstalk relationship m6A → A-to-I
Drug Octanol
 Drug Info 
m6A Target: Methyltransferase-like protein 1 (METTL1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00011
 Crosstalk Info 
Epigenetic Regulator Methyltransferase-like protein 1 (METTL1)
Regulated Target Cyclin-dependent kinase 4 (CDK4)
Crosstalk relationship m6A → m7G
Disease Neck squamous cell carcinoma
 Disease Info 
Drug Palbociclib
 Drug Info 
m6A Target: hsa-miR-582-3p
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00012
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target NF-kappaB interacting lncRNA (NKILA)
Crosstalk relationship m5C → m6A
Disease Intrahepatic cholangiocarcinoma
 Disease Info 
Crosstalk ID: M6ACROT00013
 Crosstalk Info 
Epigenetic Regulator RNA cytosine C(5)-methyltransferase NSUN2 (NSUN2)
Regulated Target NF-kappaB interacting lncRNA (NKILA)
Crosstalk relationship m5C → m6A
Disease Intrahepatic cholangiocarcinoma
 Disease Info 
m6A Target: Collagen alpha-1 (COL1A1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00050
 Crosstalk Info 
Epigenetic Regulator Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 (ALKBH3)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship m1A → m6A
Disease Keloid
 Disease Info 
Crosstalk ID: M6ACROT00052
 Crosstalk Info 
Epigenetic Regulator YTH domain-containing family protein 2 (YTHDF2)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship m1A → m6A
Disease Keloid
 Disease Info 
m6A Target: Fibronectin (FN1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00051
 Crosstalk Info 
Epigenetic Regulator Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 (ALKBH3)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship m1A → m6A
Disease Keloid
 Disease Info 
Drug Ocriplasmin
 Drug Info 
Crosstalk ID: M6ACROT00053
 Crosstalk Info 
Epigenetic Regulator YTH domain-containing family protein 2 (YTHDF2)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship m1A → m6A
Disease Keloid
 Disease Info 
Drug Ocriplasmin
 Drug Info 
m6A Target: Interferon-inducible protein 4 (ADAR1)
 Target Gene 
In total 81 item(s) under this m6A target
Crosstalk ID: M6ACROT00063
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Cyclin-dependent kinase 2 (CDK2)
Crosstalk relationship m6A → A-to-I
Disease Brain cancer
 Disease Info 
Drug PHA848125
 Drug Info 
Crosstalk ID: M6ACROT00076
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target UPF1 RNA helicase and ATPase (UPF1)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00077
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Death associated protein 3 (DAP3)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00078
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Phosphatidylserine decarboxylase (PISD)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00079
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Thioredoxin reductase 2 (TXNRD2)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00080
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target BLCAP apoptosis inducing factor (BLCAP)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00087
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Tyrosine-protein kinase EIF2AK2 (eIF2AK2/p68)
Crosstalk relationship m6A → A-to-I
Drug US9650366, 12
 Drug Info 
Crosstalk ID: M6ACROT00088
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Eukaryotic translation initiation factor 2 subunit 1 (EIF2S1/eIF2-Alpha)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00091
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Antizyme inhibitor 1 (AZIN1)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00092
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Zinc finger protein GLI1 (GLI1)
Crosstalk relationship m6A → A-to-I
Drug PMID26666870-Compound-16
 Drug Info 
Crosstalk ID: M6ACROT00097
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Rho GTPase activating protein 26 (ARHGAP26)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00110
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Prune homolog 2 with BCH domain (PRUNE2)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00111
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target microRNA 222 (MIR222)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00112
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Aryl hydrocarbon receptor (AHR)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00113
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target microRNA 381 (MIR381)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00114
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Inhibitor of nuclear factor kappa-B kinase subunit beta (IKBKB)
Crosstalk relationship m6A → A-to-I
Drug Arsenic trioxide
 Drug Info 
Crosstalk ID: M6ACROT00115
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Actin, aortic smooth muscle (ACTA2)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00116
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Collagen alpha-1 (COL1A1)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00117
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Podocalyxin like (PODXL)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00120
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Cathepsin S (CTSS)
Crosstalk relationship m6A → A-to-I
Drug RG7625
 Drug Info 
Crosstalk ID: M6ACROT00123
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Dihydrofolate reductase (DHFR)
Crosstalk relationship m6A → A-to-I
Drug Trimethoprim
 Drug Info 
Crosstalk ID: M6ACROT00124
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Signal transducer and activator of transcription 3 (STAT3)
Crosstalk relationship m6A → A-to-I
Drug Acitretin
 Drug Info 
Crosstalk ID: M6ACROT00125
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Intercellular adhesion molecule 1 (ICAM1)
Crosstalk relationship m6A → A-to-I
Drug ISIS 1570
 Drug Info 
Crosstalk ID: M6ACROT00126
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Vascular cell adhesion protein 1 (VCAM1)
Crosstalk relationship m6A → A-to-I
Drug ISIS 3792
 Drug Info 
Crosstalk ID: M6ACROT00127
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target E3 ubiquitin-protein ligase Mdm2 (Mdm2)
Crosstalk relationship m6A → A-to-I
Drug RG7388
 Drug Info 
Crosstalk ID: M6ACROT00128
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target X-linked inhibitor of apoptosis (XIAP)
Crosstalk relationship m6A → A-to-I
Drug ASTX660
 Drug Info 
Crosstalk ID: M6ACROT00129
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target G1/S-specific cyclin-D1 (CCND1)
Crosstalk relationship m6A → A-to-I
Drug ABT-263
 Drug Info 
Crosstalk ID: M6ACROT00130
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target F11 receptor (F11R)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00131
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Protein tyrosine kinase 2 (PTK2)
Crosstalk relationship m6A → A-to-I
Drug VS-6063
 Drug Info 
Crosstalk ID: M6ACROT00132
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Thiol methyltransferase 1A (TMT1A)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00135
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Interferon induced with helicase C domain 1 (IFIH1)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00136
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target microRNA 21 (MIR21)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00137
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Pellino E3 ubiquitin protein ligase 1 (PELI1)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00138
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Protein sprouty homolog 2 (SPRY2)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00143
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Heterogeneous nuclear ribonucleoprotein L like (HNRNPLL)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00146
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Paired box protein Pax-6 (PAX6)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00149
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Cyclin dependent kinase 13 (CDK13)
Crosstalk relationship m6A → A-to-I
Drug THZ531
 Drug Info 
Crosstalk ID: M6ACROT00154
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target microRNA 26a-1 (MIR26A1)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00155
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Cellular tumor antigen p53 (TP53/p53)
Crosstalk relationship m6A → A-to-I
Drug Contusugene ladenovec
 Drug Info 
Crosstalk ID: M6ACROT00156
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Integrin subunit alpha 2 (ITGA2)
Crosstalk relationship m6A → A-to-I
Drug E7820
 Drug Info 
Crosstalk ID: M6ACROT00157
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target HIF1A antisense RNA 2 (HIF1A-AS2)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00158
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Cytochrome P450 2B6 (CYP2B6)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00159
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Cytochrome P450 2C8 (CYP2C8)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00160
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Cytochrome P450 family 3 subfamily A member 4 (CYP3A4)
Crosstalk relationship m6A → A-to-I
Drug Curcumin
 Drug Info 
Crosstalk ID: M6ACROT00161
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Hepatocyte nuclear factor 4 alpha (HNF4A)
Crosstalk relationship m6A → A-to-I
Drug BI6015
 Drug Info 
Crosstalk ID: M6ACROT00168
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target CXADR cell adhesion molecule (CXADR)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00171
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Endoribonuclease Dicer (DICER1)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00172
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target microRNA 155 (MIR155)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00173
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target microRNA 181a-1 (MIR181A1)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00174
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target hsa-mir-18a
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00175
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target microRNA 19a (MIR19A)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00176
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target microRNA 210 (MIR210)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00177
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target POU domain, class 5, transcription factor 1 (POU5F1)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00178
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Transcription factor SOX-2 (SOX2)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00179
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target G1/S-specific cyclin-D2 (CCND2)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00180
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Catenin beta-1 (CTNNB1/Beta-catenin)
Crosstalk relationship m6A → A-to-I
Drug Recombinant human endostatin
 Drug Info 
Crosstalk ID: M6ACROT00181
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Myc proto-oncogene protein (MYC)
Crosstalk relationship m6A → A-to-I
Drug AVI-5126
 Drug Info 
Crosstalk ID: M6ACROT00182
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Transcription factor 4 (TCF4)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00183
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target microRNA 149 (MIR149)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00186
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target microRNA 200b (MIR200B)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00187
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Interferon induced protein with tetratricopeptide repeats 3 (IFIT3)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00188
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Interferon regulatory factor 9 (IRF9)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00189
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target microRNA 302a (MIR302A)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00190
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target microRNA 302b (MIR302B)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00191
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target microRNA 302c (MIR302C)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00192
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Transcription factor ISGF-3 components p91/p84 (Stat1)
Crosstalk relationship m6A → A-to-I
Drug Peptide analog 8
 Drug Info 
Crosstalk ID: M6ACROT00193
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Mitogen-activated protein kinase 1 (MAPK/ERK2/MAPK1)
Crosstalk relationship m6A → A-to-I
Drug BVD-523
 Drug Info 
Crosstalk ID: M6ACROT00194
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target APCDD1L divergent transcript (APCDD1L-DT)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00195
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target H1-10 antisense RNA 1 (H1-10-AS1)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00196
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Long intergenic non-protein coding RNA 944 (LINC00944)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00197
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Long intergenic non-protein coding RNA 1003 (LINC01003)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00198
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Neurotrophic factor BDNF precursor form (BDNF)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00199
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target microRNA 432 (MIR432)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00200
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Nuclear receptor subfamily 1 group I member 2 (NR1I2)
Crosstalk relationship m6A → A-to-I
Drug Pregnenolone-16alpha-carbonitrile
 Drug Info 
Crosstalk ID: M6ACROT00203
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target G1/S-specific cyclin-E1 (CCNE1)
Crosstalk relationship m6A → A-to-I
Drug PD-0183812
 Drug Info 
Crosstalk ID: M6ACROT00204
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Cyclin-dependent kinase 2 (CDK2)
Crosstalk relationship m6A → A-to-I
Drug PHA848125
 Drug Info 
Crosstalk ID: M6ACROT00205
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Cyclin-dependent kinase 4 (CDK4)
Crosstalk relationship m6A → A-to-I
Drug Palbociclib
 Drug Info 
Crosstalk ID: M6ACROT00206
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Cyclin-dependent kinase 6 (CDK6)
Crosstalk relationship m6A → A-to-I
Drug Palbociclib
 Drug Info 
Crosstalk ID: M6ACROT00207
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Nuclear paraspeckle assembly transcript 1 (NEAT1)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00208
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target C-X3-C motif chemokine ligand 1 (CX3CL1)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00209
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target hsa_circ_0000418 (Circ_CCT2)
Crosstalk relationship m6A → A-to-I
m6A Target: Rho GTPase activating protein 5 (ARHGAP5)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00065
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship A-to-I → m6A
Disease Breast cancer
 Disease Info 
m6A Target: Transcription factor SOX-9 (SOX9)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00067
 Crosstalk Info 
Epigenetic Regulator 5-methylcytosine rRNA methyltransferase NSUN4 (NSUN4)
Regulated Target Transcription factor SOX-9 (SOX9)
Crosstalk relationship m5C → m6A
m6A Target: Cellular tumor antigen p53 (TP53/p53)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT00069
 Crosstalk Info 
Epigenetic Regulator tRNA (cytosine(72)-C(5))-methyltransferase NSUN6 (NSUN6)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship m5C → m6A
Disease Colon cancer
 Disease Info 
Drug Contusugene ladenovec
 Drug Info 
Crosstalk ID: M6ACROT00432
 Crosstalk Info 
Epigenetic Regulator Methyltransferase-like protein 1 (METTL1)
Regulated Target MicroRNA 125a (MIR125A)
Crosstalk relationship m7G → m6A
Crosstalk ID: M6ACROT00437
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 214 (MIR214)
Crosstalk relationship A-to-I → m6A
m6A Target: Suppressor of cytokine signaling 2 (SOCS2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00070
 Crosstalk Info 
Epigenetic Regulator tRNA (cytosine(72)-C(5))-methyltransferase NSUN6 (NSUN6)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship m5C → m6A
Disease Colon cancer
 Disease Info 
m6A Target: Cell division cycle-associated protein 7 (CDCA7)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00071
 Crosstalk Info 
Epigenetic Regulator tRNA (cytosine(72)-C(5))-methyltransferase NSUN6 (NSUN6)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship m5C → m6A
Disease Colon cancer
 Disease Info 
m6A Target: Double-stranded RNA-specific editase 1 (ADARB1)
 Target Gene 
In total 27 item(s) under this m6A target
Crosstalk ID: M6ACROT00081
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Filamin-A (FLNA)
Crosstalk relationship m6A → A-to-I
Drug PTI-125
 Drug Info 
Crosstalk ID: M6ACROT00083
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Glutamate ionotropic receptor AMPA type subunit 2 (GRIA2)
Crosstalk relationship m6A → A-to-I
Drug E-2007
 Drug Info 
Crosstalk ID: M6ACROT00085
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Cytoplasmic FMR1 interacting protein 2 (CYFIP2)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00089
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Cell division cycle 14B (CDC14B)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00093
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Zinc finger protein GLI1 (GLI1)
Crosstalk relationship m6A → A-to-I
Drug PMID26666870-Compound-16
 Drug Info 
Crosstalk ID: M6ACROT00095
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target microRNA 16-1 (MIR16-1)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00098
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target microRNA 122 (MIR122)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00100
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target microRNA 214 (MIR214)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00102
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Oligophrenin 1 (OPHN1)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00104
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target microRNA 21 (MIR21)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00106
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target microRNA 221 (MIR221)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00108
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target microRNA 222 (MIR222)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00118
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Podocalyxin like (PODXL)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00121
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Insulin-like growth factor-binding protein 7 (IGFBP7)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00133
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Thiol methyltransferase 1A (TMT1A)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00139
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Pellino E3 ubiquitin protein ligase 1 (PELI1)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00141
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Protein sprouty homolog 2 (SPRY2)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00144
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Heterogeneous nuclear ribonucleoprotein L like (HNRNPLL)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00147
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target microRNA 142 (MIR142)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00150
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Protein SON
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00152
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Glutamate ionotropic receptor kainate type subunit 2 (GRIK2)
Crosstalk relationship m6A → A-to-I
Drug 2,4-epi-neodysiherbaine
 Drug Info 
Crosstalk ID: M6ACROT00162
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Cytochrome P450 2B6 (CYP2B6)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00164
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Cytochrome P450 2C8 (CYP2C8)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00166
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Hepatocyte nuclear factor 4 alpha (HNF4A)
Crosstalk relationship m6A → A-to-I
Drug BI6015
 Drug Info 
Crosstalk ID: M6ACROT00169
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target CXADR cell adhesion molecule (CXADR)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00184
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Farnesyltransferase, CAAX box, subunit alpha (FNTA)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00201
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Nuclear receptor subfamily 1 group I member 2 (NR1I2)
Crosstalk relationship m6A → A-to-I
Drug Pregnenolone-16alpha-carbonitrile
 Drug Info 
m6A Target: Mutated in multiple advanced cancers 1 (PTEN)
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT00411
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 21 (MIR21)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00412
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 21 (MIR21)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00447
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 214 (MIR214)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00511
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target hsa-mir-18a
Crosstalk relationship A-to-I → m6A
m6A Target: X inactive specific transcript (XIST)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00421
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 21 (MIR21)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00422
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 21 (MIR21)
Crosstalk relationship m6A → A-to-I
m6A Target: Maternally expressed 3 (MEG3)
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT00429
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 21 (MIR21)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00430
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 21 (MIR21)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00481
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 155 (MIR155)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00515
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target hsa-mir-18a
Crosstalk relationship m6A → A-to-I
m6A Target: Epidermal growth factor receptor (EGFR)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00441
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 214 (MIR214)
Crosstalk relationship A-to-I → m6A
m6A Target: Macrophage colony-stimulating factor 1 (CSF1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00461
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 149 (MIR149)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00462
 Crosstalk Info 
Epigenetic Regulator Methyltransferase-like protein 1 (METTL1)
Regulated Target MicroRNA 149 (MIR149)
Crosstalk relationship m7G → m6A
m6A Target: Stromal cell-derived factor 1 (CXCL12)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00469
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 149 (MIR149)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00470
 Crosstalk Info 
Epigenetic Regulator Methyltransferase-like protein 1 (METTL1)
Regulated Target MicroRNA 149 (MIR149)
Crosstalk relationship m7G → m6A
m6A Target: Zinc finger protein SNAI1 (SNAI1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00486
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target hsa-mir-22
Crosstalk relationship m6Am → m6A
m6A Target: H19 imprinted maternally expressed transcript (H19)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00488
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target hsa-mir-22
Crosstalk relationship m6A → m6Am
Crosstalk ID: M6ACROT00531
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 19a (MIR19A)
Crosstalk relationship m6A → A-to-I
m6A Target: Glucose transporter type 1 (GLUT1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00491
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target hsa-mir-22
Crosstalk relationship m6Am → m6A
m6A Target: Cyclin-dependent kinase inhibitor 1B (CDKN1B/p27)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00499
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 222 (MIR222)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00500
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 222 (MIR222)
Crosstalk relationship A-to-I → m6A
m6A Target: Forkhead box protein O3 (FOXO3)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00521
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 221 (MIR221)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00556
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target Growth arrest specific 5 (GAS5)
Crosstalk relationship m5C → m6A
m6A Target: Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00524
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 142 (MIR142)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00528
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target MicroRNA 576 (MIR576)
Crosstalk relationship m6Am → m6A
m6A Target: Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00533
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 26a-1 (MIR26A1)
Crosstalk relationship m6A → A-to-I
m6A Target: Fascin (FSCN1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00540
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 200b (MIR200B)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00541
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target MicroRNA 200b (MIR200B)
Crosstalk relationship m5C → m6A
m6A Target: Transcription factor SOX-6 (SOX6)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00553
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 122 (MIR122)
Crosstalk relationship A-to-I → m6A
m6A Target: pri-miR-143
 Target Gene 
In total 5 item(s) under this m6A target
Crosstalk ID: M6ACROT00566
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Signal transducer and activator of transcription 3 (STAT3)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00569
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target Signal transducer and activator of transcription 3 (STAT3)
Crosstalk relationship m6A → m6Am
Crosstalk ID: M6ACROT00572
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00575
 Crosstalk Info 
Epigenetic Regulator H/ACA ribonucleoprotein complex subunit DKC1 (DKC1)
Regulated Target Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A)
Crosstalk relationship m6A → Pseudouridine
Crosstalk ID: M6ACROT00578
 Crosstalk Info 
Epigenetic Regulator RNA cytosine C(5)-methyltransferase NSUN2 (NSUN2)
Regulated Target H19 imprinted maternally expressed transcript (H19)
Crosstalk relationship m5C → m6A
m6A Target: hsa-miR-193b
 Target Gene 
In total 5 item(s) under this m6A target
Crosstalk ID: M6ACROT00584
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target G1/S-specific cyclin-D1 (CCND1)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00585
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target G1/S-specific cyclin-D1 (CCND1)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00586
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target G1/S-specific cyclin-D1 (CCND1)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00587
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target G1/S-specific cyclin-D1 (CCND1)
Crosstalk relationship m6A → m6Am
Crosstalk ID: M6ACROT00588
 Crosstalk Info 
Epigenetic Regulator Methyltransferase-like protein 1 (METTL1)
Regulated Target G1/S-specific cyclin-D1 (CCND1)
Crosstalk relationship m6A → m7G
m6A Target: microRNA 21 (MIR21)
 Target Gene 
In total 7 item(s) under this m6A target
Crosstalk ID: M6ACROT00590
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Protein sprouty homolog 2 (SPRY2)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00592
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Protein sprouty homolog 2 (SPRY2)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00594
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target Growth arrest specific 5 (GAS5)
Crosstalk relationship m5C → m6A
Crosstalk ID: M6ACROT00596
 Crosstalk Info 
Epigenetic Regulator Putative methyltransferase NSUN7 (NSUN7)
Regulated Target Phosphofructokinase, muscle (PFKM)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00598
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00600
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET2 (TET2)
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00602
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET3 (TET3)
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → m5C
m6A Target: hsa-mir-320a
 Target Gene 
In total 8 item(s) under this m6A target
Crosstalk ID: M6ACROT00603
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Catenin beta-1 (CTNNB1/Beta-catenin)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00604
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target Catenin beta-1 (CTNNB1/Beta-catenin)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00605
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target Catenin beta-1 (CTNNB1/Beta-catenin)
Crosstalk relationship m6A → m6Am
Crosstalk ID: M6ACROT00606
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target Homeobox protein NANOG (NANOG)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00607
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target Homeobox protein NANOG (NANOG)
Crosstalk relationship m6A → m6Am
Crosstalk ID: M6ACROT00608
 Crosstalk Info 
Epigenetic Regulator Methyltransferase-like protein 1 (METTL1)
Regulated Target Homeobox protein NANOG (NANOG)
Crosstalk relationship m6A → m7G
Crosstalk ID: M6ACROT00609
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target Transcription factor E2F1 (E2F1)
Crosstalk relationship m6A → m6Am
Crosstalk ID: M6ACROT00610
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Crosstalk relationship m6Am → m6A
m6A Target: microRNA 222 (MIR222)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT00636
 Crosstalk Info 
Epigenetic Regulator Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 (ALKBH3)
Regulated Target Cyclin-dependent kinase inhibitor 1B (CDKN1B/p27)
Crosstalk relationship m6A → m1A
Crosstalk ID: M6ACROT00637
 Crosstalk Info 
Epigenetic Regulator RNA cytosine C(5)-methyltransferase NSUN2 (NSUN2)
Regulated Target Cyclin-dependent kinase inhibitor 1B (CDKN1B/p27)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00638
 Crosstalk Info 
Epigenetic Regulator Methyltransferase-like protein 1 (METTL1)
Regulated Target Cyclin-dependent kinase inhibitor 1B (CDKN1B/p27)
Crosstalk relationship m6A → m7G
m6A Target: microRNA 25 (MIR25)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00639
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target Zinc finger protein SNAI1 (SNAI1)
Crosstalk relationship m6A → m5C
m6A Target: hsa-mir-18a
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT00640
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target Growth arrest specific 5 (GAS5)
Crosstalk relationship m5C → m6A
Crosstalk ID: M6ACROT00642
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00644
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET2 (TET2)
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00646
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET3 (TET3)
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → m5C
m6A Target: microRNA 221 (MIR221)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT00648
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target Growth arrest specific 5 (GAS5)
Crosstalk relationship m5C → m6A
Crosstalk ID: M6ACROT00649
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target NAD-dependent protein deacetylase sirtuin-1 (SIRT1)
Crosstalk relationship m6A → m6Am
Crosstalk ID: M6ACROT00650
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target Protein c-Fos (FOS)
Crosstalk relationship m6A → m6Am
m6A Target: microRNA 1246 (MIR1246)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00663
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target Glycogen synthase kinase-3 beta (GSK3Beta/GSK3B)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00664
 Crosstalk Info 
Epigenetic Regulator tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4 (WDR4)
Regulated Target Interleukin 6 (IL6)
Crosstalk relationship m6A → m7G
m6A Target: hsa-mir-20a
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT00665
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target Ribonucleotide reductase regulatory subunit M2 (RRM2)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00667
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target 72 kDa type IV collagenase (MMP2)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00669
 Crosstalk Info 
Epigenetic Regulator H/ACA ribonucleoprotein complex subunit DKC1 (DKC1)
Regulated Target 72 kDa type IV collagenase (MMP2)
Crosstalk relationship m6A → Pseudouridine
Crosstalk ID: M6ACROT00671
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Crosstalk relationship m6Am → m6A
m6A Target: hsa-mir-19a
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00674
 Crosstalk Info 
Epigenetic Regulator RNA cytosine C(5)-methyltransferase NSUN2 (NSUN2)
Regulated Target H19 imprinted maternally expressed transcript (H19)
Crosstalk relationship m5C → m6A
m6A Target: hsa-mir-19b-1
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00675
 Crosstalk Info 
Epigenetic Regulator RNA cytosine C(5)-methyltransferase NSUN2 (NSUN2)
Regulated Target H19 imprinted maternally expressed transcript (H19)
Crosstalk relationship m5C → m6A
Crosstalk ID: M6ACROT00676
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target NAD-dependent protein deacetylase sirtuin-1 (SIRT1)
Crosstalk relationship m6A → m6Am
m6A Target: microRNA-92a
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00679
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target Krueppel-like factor 4 (KLF4)
Crosstalk relationship m6A → m6Am
Crosstalk ID: M6ACROT00680
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target Integrin alpha-6 (ITGA6)
Crosstalk relationship m6A → m6Am
DNA modification
m6A Target: ANKRD13C divergent transcript (ANKRD13C-DT)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02007
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Long Terminal Repeat 7 (LTR7)
Crosstalk relationship m6A → DNA modification
m6A Target: DNA-binding protein SATB2 (SATB2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02008
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target DNA-binding protein SATB2 (SATB2)
Crosstalk relationship m6A → DNA modification
Disease Esophageal Squamous Cell Carcinoma
 Disease Info 
m6A Target: Methylcytosine dioxygenase TET1 (TET1)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT02010
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship m6A → DNA modification
Crosstalk ID: M6ACROT02012
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Crosstalk ID: M6ACROT02094
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Signal transducer and activator of transcription 3 (STAT3)
Crosstalk relationship m6A → DNA modification
Disease Inflammatory pain
 Disease Info 
m6A Target: Semaphorin-3F (SEMA3F)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02014
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Semaphorin-3F (SEMA3F)
Crosstalk relationship m6A → DNA modification
Disease Prostate cancer
 Disease Info 
Drug Docetaxel
 Drug Info 
m6A Target: microRNA 25 (MIR25)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02030
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
Crosstalk ID: M6ACROT02031
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
m6A Target: Insulin-like Growth Factor Binding Protein 7 Overlapping Transcript
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02040
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Insulin-like growth factor-binding protein 7 (IGFBP7)
Crosstalk relationship m6A → DNA modification
Disease Oosteoarthritis
 Disease Info 
Crosstalk ID: M6ACROT02041
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Insulin-like growth factor-binding protein 7 (IGFBP7)
Crosstalk relationship m6A → DNA modification
Disease Oosteoarthritis
 Disease Info 
m6A Target: Protein mono-ADP-ribosyltransferase PARP10 (PARP10)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02042
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Cardiomegaly
 Disease Info 
Drug Ang II
 Drug Info 
m6A Target: DNA (cytosine-5)-methyltransferase 1 (DNMT1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02043
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Forkhead box protein O3 (FOXO3)
Crosstalk relationship m6A → DNA modification
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT06013
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Eomesodermin homolog (EOMES)
Crosstalk relationship m6A → DNA modification
m6A Target: Neurogenic locus notch homolog protein 2 (NOTCH2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02044
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Neurogenic locus notch homolog protein 2 (NOTCH2)
Crosstalk relationship m6A → DNA modification
m6A Target: Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT02047
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Secreted frizzled-related protein 2 (SFRP2)
Crosstalk relationship m6A → DNA modification
Drug Simvastatin
 Drug Info 
Crosstalk ID: M6ACROT02048
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Secreted frizzled-related protein 2 (SFRP2)
Crosstalk relationship m6A → DNA modification
Drug Simvastatin
 Drug Info 
Crosstalk ID: M6ACROT02049
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Secreted frizzled-related protein 2 (SFRP2)
Crosstalk relationship m6A → DNA modification
Drug Simvastatin
 Drug Info 
m6A Target: microRNA let-7b (MIRLET7B)
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT02058
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02061
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02064
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
Crosstalk ID: M6ACROT02067
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
m6A Target: Cysteine methyltransferase DNMT3A (DNMT3A)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02076
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Alpha tubulin acetyltransferase 1 (ATAT1)
Crosstalk relationship m6A → DNA modification
Disease Alzheimer disease
 Disease Info 
Crosstalk ID: M6ACROT02106
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Crosstalk relationship m6A → DNA modification
Disease Gastric cancer
 Disease Info 
Drug Decitabine
 Drug Info 
m6A Target: Glucocorticoid receptor (NR3C1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02086
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Major depressive disorder
 Disease Info 
Crosstalk ID: M6ACROT02090
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Major depressive disorder
 Disease Info 
m6A Target: Cyclic AMP-responsive element-binding protein 1 (CREB1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02087
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Major depressive disorder
 Disease Info 
Crosstalk ID: M6ACROT02091
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Major depressive disorder
 Disease Info 
m6A Target: BDNF/NT-3 growth factors receptor (NTRK2)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02088
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Major depressive disorder
 Disease Info 
Crosstalk ID: M6ACROT02092
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Major depressive disorder
 Disease Info 
m6A Target: Neurotrophic factor BDNF precursor form (BDNF)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02089
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Major depressive disorder
 Disease Info 
Crosstalk ID: M6ACROT02093
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Major depressive disorder
 Disease Info 
m6A Target: SREBF2 antisense RNA 1 (SREBF2-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02098
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Sterol regulatory element binding transcription factor 2 (SREBF2)
Crosstalk relationship m6A → DNA modification
Disease Liver cancer
 Disease Info 
m6A Target: Phosphoenolpyruvate carboxykinase [GTP], mitochondrial (PCK2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02113
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET2 (TET2)
Regulated Target Phosphoenolpyruvate carboxykinase [GTP], mitochondrial (PCK2)
Crosstalk relationship DNA modification → m6A
Disease Hepatic inflammation
 Disease Info 
m6A Target: LIFR antisense RNA 1 (LIFR-AS1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02116
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
Crosstalk ID: M6ACROT02125
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
m6A Target: hsa-miR-380-3p
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02117
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
Crosstalk ID: M6ACROT02126
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
m6A Target: DBH antisense RNA 1 (Lnc_DBH-AS1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02118
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
Drug Gemcitabine
 Drug Info 
Crosstalk ID: M6ACROT02127
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
Drug Gemcitabine
 Drug Info 
m6A Target: DNA-binding protein inhibitor ID-2 (ID2)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02119
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
Crosstalk ID: M6ACROT02128
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
m6A Target: BRAF-activated non-protein coding RNA (BANCR)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02120
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
Crosstalk ID: M6ACROT02129
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
m6A Target: long intergenic non-protein coding RNA 662 (LINC00662)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02121
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
Crosstalk ID: M6ACROT02130
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
m6A Target: Claspin (CLSPN)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02122
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
Drug Celastrol
 Drug Info 
Crosstalk ID: M6ACROT02131
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
Drug Celastrol
 Drug Info 
m6A Target: Apoptosis regulator Bcl-2 (BCL2)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02123
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
Drug Celastrol
 Drug Info 
Crosstalk ID: M6ACROT02132
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
Drug Celastrol
 Drug Info 
m6A Target: Integrin beta-1 (ITGB1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02124
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
Crosstalk ID: M6ACROT02133
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Pancreatic cancer
 Disease Info 
m6A Target: PI3-kinase subunit alpha (PI3k/PIK3CA)
 Target Gene 
In total 8 item(s) under this m6A target
Crosstalk ID: M6ACROT02141
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02149
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02154
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02162
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02167
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
Crosstalk ID: M6ACROT02175
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
Crosstalk ID: M6ACROT02180
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
Crosstalk ID: M6ACROT02188
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
m6A Target: hsa-miR-143-3p
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT02142
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02155
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02168
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
Crosstalk ID: M6ACROT02181
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
m6A Target: Transcription factor JunB (JUNB)
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT02143
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02156
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02169
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
Crosstalk ID: M6ACROT02182
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
m6A Target: Histone-lysine N-methyltransferase EZH2 (EZH2)
 Target Gene 
In total 6 item(s) under this m6A target
Crosstalk ID: M6ACROT02145
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02158
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02171
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
Crosstalk ID: M6ACROT02184
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
Crosstalk ID: M6ACROT05854
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Simvastatin
 Drug Info 
Crosstalk ID: M6ACROT05856
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Simvastatin
 Drug Info 
m6A Target: Hepatocyte growth factor receptor (c-Met/MET)
 Target Gene 
In total 6 item(s) under this m6A target
Crosstalk ID: M6ACROT02146
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02159
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02172
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
Crosstalk ID: M6ACROT02185
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
Crosstalk ID: M6ACROT05855
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
Crosstalk ID: M6ACROT05857
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
m6A Target: Zinc finger and BTB domain-containing protein 4 (ZBTB4)
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT02147
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02160
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02173
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
Crosstalk ID: M6ACROT02186
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
m6A Target: Mutated in multiple advanced cancers 1 (PTEN)
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT02148
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02161
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02174
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
Crosstalk ID: M6ACROT02187
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
m6A Target: RAC-alpha serine/threonine-protein kinase (AKT1)
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT02150
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02163
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02176
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
Crosstalk ID: M6ACROT02189
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
m6A Target: Serine/threonine-protein kinase mTOR (MTOR)
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT02151
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02164
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02177
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
Crosstalk ID: M6ACROT02190
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
m6A Target: SVIL antisense RNA 1 (SVIL-AS1)
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT02152
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02165
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02178
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
Crosstalk ID: M6ACROT02191
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
m6A Target: SH3 domain-binding protein 5 (SH3BP5)
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT02153
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02166
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02179
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
Crosstalk ID: M6ACROT02192
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship DNA modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
m6A Target: Ribose-5-phosphate isomerase (RPIA)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT06003
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Ribose-5-phosphate isomerase (RPIA)
Crosstalk relationship m6A → DNA modification
Disease Esophageal Squamous Cell Carcinoma
 Disease Info 
m6A Target: Wnt family member 7B (WNT7B)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT06005
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Wnt family member 7B (WNT7B)
Crosstalk relationship m6A → DNA modification
Disease Esophageal Squamous Cell Carcinoma
 Disease Info 
m6A Target: B-cell lymphoma 6 protein (BCL6)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT06007
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target B-cell lymphoma 6 protein (BCL6)
Crosstalk relationship m6A → DNA modification
Disease Esophageal Squamous Cell Carcinoma
 Disease Info 
m6A Target: Protocadherin Fat 4 (FAT4)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT06009
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Protocadherin Fat 4 (FAT4)
Crosstalk relationship m6A → DNA modification
Disease Esophageal Squamous Cell Carcinoma
 Disease Info 
m6A Target: Sterile alpha motif domain-containing protein 9-like (SAMD9L)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT06011
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Sterile alpha motif domain-containing protein 9-like (SAMD9L)
Crosstalk relationship m6A → DNA modification
Disease Esophageal Squamous Cell Carcinoma
 Disease Info 
m6A Target: Insulin receptor (INSR)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT06015
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Insulin receptor (INSR)
Crosstalk relationship m6A → DNA modification
m6A Target: Mothers against decapentaplegic homolog 3 (SMAD3)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT06017
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Mothers against decapentaplegic homolog 3 (SMAD3)
Crosstalk relationship m6A → DNA modification
Histone modification
m6A Target: Histone-lysine N-methyltransferase EZH2 (EZH2)
 Target Gene 
In total 5 item(s) under this m6A target
Crosstalk ID: M6ACROT03013
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship m6A → Histone modification
Crosstalk ID: M6ACROT03038
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship m6A → Histone modification
Disease Brain cancer
 Disease Info 
Drug Temozolomide
 Drug Info 
Crosstalk ID: M6ACROT03039
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
Drug Temozolomide
 Drug Info 
Crosstalk ID: M6ACROT03381
 Crosstalk Info 
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Simvastatin*
 Drug Info 
Crosstalk ID: M6ACROT03394
 Crosstalk Info 
Regulated Target Histone H3 lysine 4 monomethylation (H3K4me1)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Simvastatin*
 Drug Info 
m6A Target: Lysine-specific demethylase 6B (KDM6B)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT03015
 Crosstalk Info 
Epigenetic Regulator Lysine-specific demethylase 6B (KDM6B)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship m6A → Histone modification
Disease Inflammatory response
 Disease Info 
Crosstalk ID: M6ACROT03239
 Crosstalk Info 
Epigenetic Regulator Lysine-specific demethylase 6B (KDM6B)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship m6A → Histone modification
Crosstalk ID: M6ACROT05996
 Crosstalk Info 
Epigenetic Regulator Lysine-specific demethylase 6B (KDM6B)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship m6A → Histone modification
Disease Inflammatory response
 Disease Info 
m6A Target: Interleukin-6 (IL-6)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03018
 Crosstalk Info 
Epigenetic Regulator Lysine-specific demethylase 6B (KDM6B)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Inflammatory response
 Disease Info 
m6A Target: Histone-lysine N-methyltransferase SETD1A (SETD1A)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03030
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase SETD1A (SETD1A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship m6A → Histone modification
m6A Target: Histone-lysine N-methyltransferase SETD1B (SETD1B)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03031
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase SETD1B (SETD1B)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship m6A → Histone modification
m6A Target: Histone-lysine N-methyltransferase 2D (KMT2D)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03032
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase 2D (KMT2D)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship m6A → Histone modification
m6A Target: Histone-lysine N-methyltransferase SETD2 (SETD2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03042
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase SETD2 (SETD2)
Regulated Target Histone H3 lysine 36 trimethylation (H3K36me3)
Crosstalk relationship m6A → Histone modification
Disease Lung cancer
 Disease Info 
m6A Target: Bone morphogenetic protein 2 (BMP2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03044
 Crosstalk Info 
Epigenetic Regulator Lactate dehydrogenase A (LDHA)
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Ossification of spinal ligaments
 Disease Info 
m6A Target: Long-chain-fatty-acid--CoA ligase 4 (ACSL4)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03058
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Sepsis-associated lung injury
 Disease Info 
Crosstalk ID: M6ACROT03059
 Crosstalk Info 
Epigenetic Regulator CREB-binding protein (CREBBP)
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Sepsis-associated lung injury
 Disease Info 
m6A Target: miR-503
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03071
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase 2A (KMT2A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Myocardial injury
 Disease Info 
Drug C646
 Drug Info 
m6A Target: Suppressor of cytokine signaling 2 (SOCS2)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03072
 Crosstalk Info 
Epigenetic Regulator Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C)
Regulated Target Histone H3 lysine 9 monomethylation (H3K9me1)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
Crosstalk ID: M6ACROT03659
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Acyl-CoA synthetase short-chain family member 3, mitochondrial (ACSS3)
 Target Gene 
In total 9 item(s) under this m6A target
Crosstalk ID: M6ACROT03077
 Crosstalk Info 
Regulated Target Histone H3 lysine 14 propionylation (H3K14pr)
Crosstalk relationship m6A → Histone modification
Disease Nonalcoholic fatty liver disease
 Disease Info 
Crosstalk ID: M6ACROT03078
 Crosstalk Info 
Regulated Target Histone H3 lysine 23 propionylation (H3k23pr)
Crosstalk relationship m6A → Histone modification
Disease Nonalcoholic fatty liver disease
 Disease Info 
Crosstalk ID: M6ACROT03481
 Crosstalk Info 
Epigenetic Regulator Lactate dehydrogenase A (LDHA)
Regulated Target Histone H3 lysine 18 lactylation (H3K18lac)
Crosstalk relationship Histone modification → m6A
Disease Nonalcoholic fatty liver disease
 Disease Info 
Crosstalk ID: M6ACROT05838
 Crosstalk Info 
Regulated Target Histone H3 lysine 14 propionylation (H3K14pr)
Crosstalk relationship m6A → Histone modification
Disease Nonalcoholic fatty liver disease
 Disease Info 
Crosstalk ID: M6ACROT05839
 Crosstalk Info 
Regulated Target Histone H3 lysine 14 propionylation (H3K14pr)
Crosstalk relationship m6A → Histone modification
Disease Nonalcoholic fatty liver disease
 Disease Info 
Crosstalk ID: M6ACROT05840
 Crosstalk Info 
Regulated Target Histone H3 lysine 14 propionylation (H3K14pr)
Crosstalk relationship m6A → Histone modification
Disease Nonalcoholic fatty liver disease
 Disease Info 
Crosstalk ID: M6ACROT05841
 Crosstalk Info 
Regulated Target Histone H3 lysine 23 propionylation (H3k23pr)
Crosstalk relationship m6A → Histone modification
Disease Nonalcoholic fatty liver disease
 Disease Info 
Crosstalk ID: M6ACROT05842
 Crosstalk Info 
Regulated Target Histone H3 lysine 23 propionylation (H3k23pr)
Crosstalk relationship m6A → Histone modification
Disease Nonalcoholic fatty liver disease
 Disease Info 
Crosstalk ID: M6ACROT05843
 Crosstalk Info 
Regulated Target Histone H3 lysine 23 propionylation (H3k23pr)
Crosstalk relationship m6A → Histone modification
Disease Nonalcoholic fatty liver disease
 Disease Info 
m6A Target: pri-rRNA
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03096
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase SUV39H1 (SUV39H1)
Regulated Target Histone H3 lysine 9 trimethylation (H3K9me3)
Crosstalk relationship m6A → Histone modification
Crosstalk ID: M6ACROT03097
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase SUV39H2 (SUV39H2)
Regulated Target Histone H3 lysine 9 trimethylation (H3K9me3)
Crosstalk relationship m6A → Histone modification
m6A Target: Myc proto-oncogene protein (MYC)
 Target Gene 
In total 6 item(s) under this m6A target
Crosstalk ID: M6ACROT03106
 Crosstalk Info 
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Esophageal Squamous Cell Carcinoma
 Disease Info 
Crosstalk ID: M6ACROT03550
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03595
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03648
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
Crosstalk ID: M6ACROT03651
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
Crosstalk ID: M6ACROT03660
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: NACHT, LRR and PYD domains-containing protein 3 (NLRP3)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03107
 Crosstalk Info 
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
Crosstalk ID: M6ACROT03109
 Crosstalk Info 
Regulated Target Histone H3 lysine 4 monomethylation (H3K4me1)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
m6A Target: Histone-lysine N-methyltransferase SETMAR (SETMAR)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT03111
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase SETMAR (SETMAR)
Regulated Target Histone H3 lysine 36 dimethylation (H3K36me2)
Crosstalk relationship m6A → Histone modification
Disease Thyroid Cancer
 Disease Info 
Crosstalk ID: M6ACROT03113
 Crosstalk Info 
Epigenetic Regulator Probable global transcription activator SNF2L2 (SMARCA2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship m6A → Histone modification
Disease Thyroid Cancer
 Disease Info 
Crosstalk ID: M6ACROT05848
 Crosstalk Info 
Epigenetic Regulator Probable global transcription activator SNF2L2 (SMARCA2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship m6A → Histone modification
Disease Thyroid Cancer
 Disease Info 
m6A Target: Stearoyl-CoA desaturase (SCD)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03134
 Crosstalk Info 
Epigenetic Regulator Lactate dehydrogenase A (LDHA)
Regulated Target Histone H3 lysine 18 lactylation (H3K18lac)
Crosstalk relationship Histone modification → m6A
Disease Nonalcoholic fatty liver disease
 Disease Info 
m6A Target: Nuclear paraspeckle assembly transcript 1 (NEAT1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03141
 Crosstalk Info 
Epigenetic Regulator Chromodomain-helicase-DNA-binding protein 4 (CHD4)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship m6A → Histone modification
m6A Target: Beclin-1 (BECN1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03143
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase KAT2A (KAT2A)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
m6A Target: Histone deacetylase 1 (HDAC1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03144
 Crosstalk Info 
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Crosstalk relationship m6A → Histone modification
m6A Target: Histone acetyltransferase KAT2A (KAT2A)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03147
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase KAT2A (KAT2A)
Crosstalk relationship m6A → Histone modification
Disease Non-small cell lung cancer
 Disease Info 
m6A Target: Protein deacetylase HDAC6 (HDAC6)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03148
 Crosstalk Info 
Epigenetic Regulator Protein deacetylase HDAC6 (HDAC6)
Regulated Target Histone acetylation
Crosstalk relationship m6A → Histone modification
m6A Target: Programmed cell death 1 ligand 1 (CD274/PD-L1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03149
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EHMT2 (EHMT2)
Regulated Target Histone H3 lysine 9 dimethylation (H3K9me2)
Crosstalk relationship Histone modification → m6A
Disease Inflammatory response
 Disease Info 
m6A Target: CX3C chemokine receptor 1 (CX3CR1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03150
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EHMT2 (EHMT2)
Regulated Target Histone H3 lysine 9 dimethylation (H3K9me2)
Crosstalk relationship Histone modification → m6A
Disease Inflammatory response
 Disease Info 
m6A Target: Caspase-1 (CASP1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03151
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EHMT2 (EHMT2)
Regulated Target Histone H3 lysine 9 dimethylation (H3K9me2)
Crosstalk relationship Histone modification → m6A
Disease Inflammatory response
 Disease Info 
m6A Target: Cysteine protease ATG4A (ATG4A)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03160
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase 2A (KMT2A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Intervertebral disc degeneration
 Disease Info 
m6A Target: Polycomb protein EED (EED)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03165
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship m6A → Histone modification
m6A Target: Thioredoxin domain-containing protein 5 (TXNDC5)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03169
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Crosstalk ID: M6ACROT03170
 Crosstalk Info 
Epigenetic Regulator WD repeat-containing protein 5 (WDR5)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
m6A Target: E3 ubiquitin-protein ligase CHIP (STUB1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03177
 Crosstalk Info 
Epigenetic Regulator Lysine-specific histone demethylase 1A (KDM1A)
Regulated Target Histone H3 lysine 9 trimethylation (H3K9me3)
Crosstalk relationship Histone modification → m6A
Disease Alzheimer disease
 Disease Info 
m6A Target: Methylcytosine dioxygenase TET1 (TET1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03182
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Crosstalk ID: M6ACROT03183
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
m6A Target: Histone deacetylase 9 (HDAC9)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03187
 Crosstalk Info 
Epigenetic Regulator Histone deacetylase 9 (HDAC9)
Regulated Target Histone H4 lysine 12 acetylation (H4K12ac)
Crosstalk relationship m6A → Histone modification
Disease Acute laryngitis or tracheitis
 Disease Info 
m6A Target: Histone-lysine N-methyltransferase SUV39H2 (SUV39H2)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03190
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase SUV39H2 (SUV39H2)
Regulated Target Histone H3 lysine 9 trimethylation (H3K9me3)
Crosstalk relationship m6A → Histone modification
Disease Gastric cancer
 Disease Info 
Drug Cisplatin
 Drug Info 
Crosstalk ID: M6ACROT03664
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Histone-lysine N-methyltransferase ASH1L (ASH1L)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03204
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase ASH1L (ASH1L)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship m6A → Histone modification
Disease Uveitis
 Disease Info 
Crosstalk ID: M6ACROT05851
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase ASH1L (ASH1L)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship m6A → Histone modification
Disease Uveitis
 Disease Info 
m6A Target: Histone-lysine N-methyltransferase NSD2 (NSD2)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03209
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase NSD2 (NSD2)
Regulated Target Histone H3 lysine 36 dimethylation (H3K36me2)
Crosstalk relationship m6A → Histone modification
Disease Diabetic nephropathy
 Disease Info 
Crosstalk ID: M6ACROT03211
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase NSD2 (NSD2)
Regulated Target Histone H3 lysine 36 trimethylation (H3K36me3)
Crosstalk relationship m6A → Histone modification
Disease Diabetic nephropathy
 Disease Info 
m6A Target: Spectrin beta, non-erythrocytic 2 (SPTBN2)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03222
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03223
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Lnc668
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03225
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 9 lactylation (H3K9la)
Crosstalk relationship Histone modification → m6A
Disease Pulmonary fibrosis
 Disease Info 
m6A Target: CUB domain-containing protein 1 (CDCP1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03228
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Pirin (PIR)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03233
 Crosstalk Info 
Epigenetic Regulator WD repeat-containing protein 5 (WDR5)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship m6A → Histone modification
Disease Melanoma of uvea
 Disease Info 
m6A Target: Chromobox protein homolog 8 (CBX8)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03249
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase 2B (KMT2B)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship m6A → Histone modification
Disease Colon cancer
 Disease Info 
m6A Target: NUTM2B antisense RNA 1 (NUTM2B-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03251
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase 2A (KMT2A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship m6A → Histone modification
Disease Liver cancer
 Disease Info 
m6A Target: Histone deacetylase 5 (HDAC5)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03253
 Crosstalk Info 
Epigenetic Regulator Histone deacetylase 5 (HDAC5)
Regulated Target Histone H3 lysine 9 acetylation (H3K9Ac)
Crosstalk relationship m6A → Histone modification
Disease Osteosarcoma
 Disease Info 
Crosstalk ID: M6ACROT03254
 Crosstalk Info 
Epigenetic Regulator Histone deacetylase 5 (HDAC5)
Regulated Target Histone H3 lysine 14 acetylation (H3K14ac)
Crosstalk relationship m6A → Histone modification
Disease Osteosarcoma
 Disease Info 
m6A Target: Transcription factor SOX-2 (SOX2)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT03293
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
Crosstalk ID: M6ACROT03542
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03587
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Serine/arginine-rich splicing factor 3 (SRSF3)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03294
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
m6A Target: Serine/arginine-rich splicing factor 6 (SRSF6)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03295
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
m6A Target: Serine/arginine-rich splicing factor 11 (SRSF11)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03296
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
m6A Target: Methylated-DNA--protein-cysteine methyltransferase (MGMT)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03297
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
Drug Temozolomide
 Drug Info 
Crosstalk ID: M6ACROT03301
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
m6A Target: DNA-3-methyladenine glycosylase (ANPG/MPG)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03298
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
Drug Temozolomide
 Drug Info 
Crosstalk ID: M6ACROT03302
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
m6A Target: Meltrin-beta (ADAM19)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03299
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
Drug Ethyl ester form of meclofenamic acid
 Drug Info 
m6A Target: Interferon-inducible protein 4 (ADAR1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03300
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
m6A Target: Optineurin (OPTN)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03303
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
m6A Target: Aryl hydrocarbon receptor (AHR)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03304
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
Drug Tislelizumab
 Drug Info 
m6A Target: Serum response factor (SRF)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03305
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
Drug Tislelizumab
 Drug Info 
m6A Target: X inactive specific transcript (XIST)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03306
 Crosstalk Info 
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Ossification of spinal ligaments
 Disease Info 
m6A Target: pri-miR-143
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03311
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase 2A (KMT2A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Acute myocardial infarction
 Disease Info 
m6A Target: Tenascin (TNC)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03312
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase 2A (KMT2A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Acute myocardial infarction
 Disease Info 
m6A Target: TNF receptor-associated factor 6 (TRAF6)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03313
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase 2A (KMT2A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Acute myocardial infarction
 Disease Info 
m6A Target: Dynamin-1-like protein (DRP1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03314
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase 2A (KMT2A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Acute myocardial infarction
 Disease Info 
m6A Target: Heat shock protein HSP 90-alpha (HSP90/HSP90AA1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03315
 Crosstalk Info 
Epigenetic Regulator Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C)
Regulated Target Histone H3 lysine 9 monomethylation (H3K9me1)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
m6A Target: Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03316
 Crosstalk Info 
Epigenetic Regulator Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C)
Regulated Target Histone H3 lysine 9 monomethylation (H3K9me1)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
m6A Target: Circ_DLC1
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03317
 Crosstalk Info 
Epigenetic Regulator Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C)
Regulated Target Histone H3 lysine 9 monomethylation (H3K9me1)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
m6A Target: hsa-miR-671-5p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03318
 Crosstalk Info 
Epigenetic Regulator Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C)
Regulated Target Histone H3 lysine 9 monomethylation (H3K9me1)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
m6A Target: Beta-catenin-interacting protein 1 (CTNNBIP1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03319
 Crosstalk Info 
Epigenetic Regulator Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C)
Regulated Target Histone H3 lysine 9 monomethylation (H3K9me1)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
m6A Target: UBX domain-containing protein 1 (UBXN1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03320
 Crosstalk Info 
Epigenetic Regulator Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C)
Regulated Target Histone H3 lysine 9 monomethylation (H3K9me1)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
m6A Target: Nuclear factor NF-kappa-B p105 subunit (NF-Kappa-B/NFKB1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03321
 Crosstalk Info 
Epigenetic Regulator Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C)
Regulated Target Histone H3 lysine 9 monomethylation (H3K9me1)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
m6A Target: HOXA transcript antisense RNA, myeloid-specific 1 (HOTAIRM1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03322
 Crosstalk Info 
Epigenetic Regulator Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C)
Regulated Target Histone H3 lysine 9 monomethylation (H3K9me1)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
m6A Target: Circ_EPHB4
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03323
 Crosstalk Info 
Epigenetic Regulator Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C)
Regulated Target Histone H3 lysine 9 monomethylation (H3K9me1)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
m6A Target: Ferroptosis suppressor protein 1 (AIFM2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03324
 Crosstalk Info 
Epigenetic Regulator Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C)
Regulated Target Histone H3 lysine 9 monomethylation (H3K9me1)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
Drug iFSP1
 Drug Info 
m6A Target: Oxidized low-density lipoprotein receptor 1 (OLR1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03325
 Crosstalk Info 
Epigenetic Regulator Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C)
Regulated Target Histone H3 lysine 9 monomethylation (H3K9me1)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
Drug Temozolomide
 Drug Info 
m6A Target: Guanine nucleotide-binding protein G (GNAO1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03326
 Crosstalk Info 
Epigenetic Regulator Probable JmjC domain-containing histone demethylation protein 2C (JMJD1C)
Regulated Target Histone H3 lysine 9 monomethylation (H3K9me1)
Crosstalk relationship Histone modification → m6A
Disease Brain cancer
 Disease Info 
Drug Temozolomide
 Drug Info 
m6A Target: L-glutamine amidohydrolase (GLS2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03371
 Crosstalk Info 
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Esophageal Squamous Cell Carcinoma
 Disease Info 
m6A Target: Cyclin-dependent kinase inhibitor 1 (CDKN1A)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03372
 Crosstalk Info 
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Esophageal Squamous Cell Carcinoma
 Disease Info 
m6A Target: Neurogenic locus notch homolog protein 1 (NOTCH1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03373
 Crosstalk Info 
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Esophageal Squamous Cell Carcinoma
 Disease Info 
m6A Target: Microprocessor complex subunit DGCR8 (DGCR8)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03374
 Crosstalk Info 
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Esophageal Squamous Cell Carcinoma
 Disease Info 
m6A Target: hsa-miR-320b
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03375
 Crosstalk Info 
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Esophageal Squamous Cell Carcinoma
 Disease Info 
m6A Target: Nuclear receptor subfamily 4 group A member 2 (NR4A2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03376
 Crosstalk Info 
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Esophageal Squamous Cell Carcinoma
 Disease Info 
Drug celecoxib
 Drug Info 
m6A Target: PI3-kinase subunit alpha (PI3k/PIK3CA)
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT03377
 Crosstalk Info 
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
Crosstalk ID: M6ACROT03385
 Crosstalk Info 
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
Crosstalk ID: M6ACROT03390
 Crosstalk Info 
Regulated Target Histone H3 lysine 4 monomethylation (H3K4me1)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
Crosstalk ID: M6ACROT03398
 Crosstalk Info 
Regulated Target Histone H3 lysine 4 monomethylation (H3K4me1)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
m6A Target: hsa-miR-143-3p
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03378
 Crosstalk Info 
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
Crosstalk ID: M6ACROT03391
 Crosstalk Info 
Regulated Target Histone H3 lysine 4 monomethylation (H3K4me1)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
m6A Target: Transcription factor JunB (JUNB)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03379
 Crosstalk Info 
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
Crosstalk ID: M6ACROT03392
 Crosstalk Info 
Regulated Target Histone H3 lysine 4 monomethylation (H3K4me1)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
m6A Target: microRNA let-7b (MIRLET7B)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03380
 Crosstalk Info 
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
Crosstalk ID: M6ACROT03393
 Crosstalk Info 
Regulated Target Histone H3 lysine 4 monomethylation (H3K4me1)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
m6A Target: Hepatocyte growth factor receptor (c-Met/MET)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03382
 Crosstalk Info 
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
Crosstalk ID: M6ACROT03395
 Crosstalk Info 
Regulated Target Histone H3 lysine 4 monomethylation (H3K4me1)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
m6A Target: Zinc finger and BTB domain-containing protein 4 (ZBTB4)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03383
 Crosstalk Info 
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
Crosstalk ID: M6ACROT03396
 Crosstalk Info 
Regulated Target Histone H3 lysine 4 monomethylation (H3K4me1)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
m6A Target: Mutated in multiple advanced cancers 1 (PTEN)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03384
 Crosstalk Info 
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
Crosstalk ID: M6ACROT03397
 Crosstalk Info 
Regulated Target Histone H3 lysine 4 monomethylation (H3K4me1)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
m6A Target: RAC-alpha serine/threonine-protein kinase (AKT1)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT03386
 Crosstalk Info 
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
Crosstalk ID: M6ACROT03399
 Crosstalk Info 
Regulated Target Histone H3 lysine 4 monomethylation (H3K4me1)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
Crosstalk ID: M6ACROT03637
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Serine/threonine-protein kinase mTOR (MTOR)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03387
 Crosstalk Info 
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
Crosstalk ID: M6ACROT03400
 Crosstalk Info 
Regulated Target Histone H3 lysine 4 monomethylation (H3K4me1)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
m6A Target: SVIL antisense RNA 1 (SVIL-AS1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03388
 Crosstalk Info 
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
Crosstalk ID: M6ACROT03401
 Crosstalk Info 
Regulated Target Histone H3 lysine 4 monomethylation (H3K4me1)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
m6A Target: SH3 domain-binding protein 5 (SH3BP5)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03389
 Crosstalk Info 
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
Crosstalk ID: M6ACROT03402
 Crosstalk Info 
Regulated Target Histone H3 lysine 4 monomethylation (H3K4me1)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
m6A Target: Protein SON
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03491
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EHMT2 (EHMT2)
Regulated Target Histone H3 lysine 9 dimethylation (H3K9me2)
Crosstalk relationship Histone modification → m6A
Disease Inflammatory response
 Disease Info 
m6A Target: Protein-tyrosine kinase 2-beta (PYK2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03492
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EHMT2 (EHMT2)
Regulated Target Histone H3 lysine 9 dimethylation (H3K9me2)
Crosstalk relationship Histone modification → m6A
Disease Inflammatory response
 Disease Info 
m6A Target: Toll-like receptor 2 (TLR2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03503
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase 2A (KMT2A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Intervertebral disc degeneration
 Disease Info 
m6A Target: ZNFX1 antisense RNA 1 (ZFAS1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03504
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Crosstalk ID: M6ACROT03517
 Crosstalk Info 
Epigenetic Regulator WD repeat-containing protein 5 (WDR5)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
m6A Target: FOXD2 adjacent opposite strand RNA 1 (FOXD2-AS1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03505
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Crosstalk ID: M6ACROT03518
 Crosstalk Info 
Epigenetic Regulator WD repeat-containing protein 5 (WDR5)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
m6A Target: Apoptotic chromatin condensation inducer in the nucleus (ACIN1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03506
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Crosstalk ID: M6ACROT03519
 Crosstalk Info 
Epigenetic Regulator WD repeat-containing protein 5 (WDR5)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
m6A Target: Hexokinase-2 (HK2)
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT03507
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Crosstalk ID: M6ACROT03520
 Crosstalk Info 
Epigenetic Regulator WD repeat-containing protein 5 (WDR5)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Crosstalk ID: M6ACROT03548
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03593
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: hsa-miR-193b
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03508
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Crosstalk ID: M6ACROT03521
 Crosstalk Info 
Epigenetic Regulator WD repeat-containing protein 5 (WDR5)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
m6A Target: G1/S-specific cyclin-D1 (CCND1)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT03509
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Crosstalk ID: M6ACROT03522
 Crosstalk Info 
Epigenetic Regulator WD repeat-containing protein 5 (WDR5)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Crosstalk ID: M6ACROT03639
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Aspartate--tRNA ligase, cytoplasmic (DARS)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03510
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Crosstalk ID: M6ACROT03523
 Crosstalk Info 
Epigenetic Regulator WD repeat-containing protein 5 (WDR5)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
m6A Target: Procathepsin L (CTSL)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03511
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Crosstalk ID: M6ACROT03524
 Crosstalk Info 
Epigenetic Regulator WD repeat-containing protein 5 (WDR5)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
m6A Target: Circ_RNF13
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03512
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Crosstalk ID: M6ACROT03525
 Crosstalk Info 
Epigenetic Regulator WD repeat-containing protein 5 (WDR5)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
m6A Target: long intergenic non-protein coding RNA 426 (LINC00426)
 Target Gene 
In total 6 item(s) under this m6A target
Crosstalk ID: M6ACROT03513
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Drug Cisplatin
 Drug Info 
Crosstalk ID: M6ACROT03514
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Drug Bleomycin
 Drug Info 
Crosstalk ID: M6ACROT03515
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Drug Imatinib
 Drug Info 
Crosstalk ID: M6ACROT03526
 Crosstalk Info 
Epigenetic Regulator WD repeat-containing protein 5 (WDR5)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Drug Cisplatin
 Drug Info 
Crosstalk ID: M6ACROT03527
 Crosstalk Info 
Epigenetic Regulator WD repeat-containing protein 5 (WDR5)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Drug Bleomycin
 Drug Info 
Crosstalk ID: M6ACROT03528
 Crosstalk Info 
Epigenetic Regulator WD repeat-containing protein 5 (WDR5)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Drug Imatinib
 Drug Info 
m6A Target: Serine/threonine-protein kinase Nek2 (NEK2)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03516
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
Crosstalk ID: M6ACROT03529
 Crosstalk Info 
Epigenetic Regulator WD repeat-containing protein 5 (WDR5)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Cervical cancer
 Disease Info 
m6A Target: Nucleolar protein 3 (ARC)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03530
 Crosstalk Info 
Epigenetic Regulator Lysine-specific histone demethylase 1A (KDM1A)
Regulated Target Histone H3 lysine 9 trimethylation (H3K9me3)
Crosstalk relationship Histone modification → m6A
Disease Alzheimer disease
 Disease Info 
m6A Target: Cysteine methyltransferase DNMT3A (DNMT3A)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03531
 Crosstalk Info 
Epigenetic Regulator Lysine-specific histone demethylase 1A (KDM1A)
Regulated Target Histone H3 lysine 9 trimethylation (H3K9me3)
Crosstalk relationship Histone modification → m6A
Disease Alzheimer disease
 Disease Info 
m6A Target: Mitogen-activated protein kinase 14 (p38/MAPK14)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03543
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03588
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Ephrin type-B receptor 2 (ERK/EPHB2)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03544
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03589
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Sprouty-related, EVH1 domain-containing protein 2 (SPRED2)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03545
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03590
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: microRNA 1246 (MIR1246)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03546
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03591
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: G1/S-specific cyclin-E1 (CCNE1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03547
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03592
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Glucose transporter type 1 (SLC2A1)
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT03549
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03571
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03594
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03616
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31/RP11)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03551
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03596
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: High mobility group protein HMG-I/HMG-Y (HMGA1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03552
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03597
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Long intergenic non-protein coding RNA 460 (LINC00460)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03553
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03598
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Circ_1662
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03554
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03599
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Transcriptional coactivator YAP1 (YAP1)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT03555
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03600
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03658
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Mothers against decapentaplegic homolog 3 (SMAD3)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03556
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03601
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Translocation protein SEC62 (SEC62)
 Target Gene 
In total 5 item(s) under this m6A target
Crosstalk ID: M6ACROT03557
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Drug Oxaliplatin
 Drug Info 
Crosstalk ID: M6ACROT03558
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Drug Fluorouracil
 Drug Info 
Crosstalk ID: M6ACROT03602
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Drug Oxaliplatin
 Drug Info 
Crosstalk ID: M6ACROT03603
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Drug Fluorouracil
 Drug Info 
Crosstalk ID: M6ACROT03644
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: LBX2 antisense RNA 1 (LBX2-AS1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03559
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Drug Fluorouracil
 Drug Info 
Crosstalk ID: M6ACROT03604
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Drug Fluorouracil
 Drug Info 
m6A Target: Putative pituitary tumor-transforming gene 3 protein (PTTG3P)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03560
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03605
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Class E basic helix-loop-helix protein 41 (BHLHE41)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03561
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03606
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Protein crumbs homolog 3 (CRB3)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03562
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03607
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Lactate dehydrogenase A (LDHA)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03563
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03608
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: RAD51-associated protein 1 (RAD51AP1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03564
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Drug Fluorouracil
 Drug Info 
Crosstalk ID: M6ACROT03609
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Drug Fluorouracil
 Drug Info 
m6A Target: hsa_circ_0000677 (Circ_ABCC1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03565
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03610
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Interferon gamma (IFN-gamma)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03566
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03611
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: C-X-C motif chemokine 9 (Cxcl9)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03567
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03612
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: C-X-C motif chemokine 10 (Cxcl10)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03568
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03613
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Transcription factor ISGF-3 components p91/p84 (Stat1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03569
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03614
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Interferon regulatory factor 1 (Irf1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03570
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03615
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Zinc finger protein SNAI1 (SNAI1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03572
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03617
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Urokinase-type plasminogen activator (PLAU)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03573
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03618
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: hsa-miR-181d-5p
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03574
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Drug Fluorouracil
 Drug Info 
Crosstalk ID: M6ACROT03619
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Drug Fluorouracil
 Drug Info 
m6A Target: Neurocalcin-delta (NCALD)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03575
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Drug Fluorouracil
 Drug Info 
Crosstalk ID: M6ACROT03620
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Drug Fluorouracil
 Drug Info 
m6A Target: TNF receptor-associated factor 5 (TRAF5)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03576
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Drug Oxaliplatin
 Drug Info 
Crosstalk ID: M6ACROT03621
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Drug Oxaliplatin
 Drug Info 
m6A Target: Protein yippee-like 5 (YPEL5)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03577
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03622
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Ephrin type-A receptor 2 (EphA2)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03578
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03623
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Vascular endothelial growth factor A (VEGFA)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03579
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03624
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Lithostathine-1-alpha (REG1A)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03580
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03625
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Polyamine-transporting ATPase 13A3 (ATP13A3)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03581
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03626
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Small nucleolar RNA host gene 1 (SNHG1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03582
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03627
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Circ_UHRF2
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03583
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03628
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Cohesin subunit SA-3 (STAG3)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03584
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03629
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: pri-miR-196b
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03585
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03630
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: hsa_circ_0124554
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03586
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03631
 Crosstalk Info 
Epigenetic Regulator N-lysine methyltransferase SMYD2 (SMYD2)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Potassium voltage-gated channel subfamily H member 6 (KCNH6)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03632
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 9 lactylation (H3K9la)
Crosstalk relationship Histone modification → m6A
Disease Pulmonary fibrosis
 Disease Info 
m6A Target: Cadherin-1 (CDH1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03633
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 9 lactylation (H3K9la)
Crosstalk relationship Histone modification → m6A
Disease Pulmonary fibrosis
 Disease Info 
m6A Target: Apoptosis regulator Bcl-2 (BCL2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03634
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Apoptosis regulator BAX (BAX)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03635
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Caspase-3 (CASP3)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03636
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Ribosomal protein S6 kinase beta-1 (RPS6KB1/p70S6K)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03638
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Rho GTPase activating protein 5 (ARHGAP5)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT03640
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
Drug Doxil
 Drug Info 
Crosstalk ID: M6ACROT03641
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
Drug Cisplatin
 Drug Info 
Crosstalk ID: M6ACROT03642
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
Drug Fluorouracil
 Drug Info 
m6A Target: Actin, aortic smooth muscle (ACTA2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03643
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Hepatoma-derived growth factor (HDGF)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03645
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Zinc finger MYM-type protein 1 (ZMYM1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03646
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Long intergenic non-protein coding RNA 470 (LINC00470)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03647
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: DNA replication licensing factor MCM5 (MCM5)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03649
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: DNA replication licensing factor MCM6 (MCM6)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03650
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: THAP7 antisense RNA 1 (THAP7-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03652
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Krueppel-like factor 2 (KLF2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03653
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Sphingosine kinase 2 (SPHK2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03654
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: A disintegrin and metalloproteinase with thrombospondin motifs 9 (ADAMTS9)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03655
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Poly [ADP-ribose] polymerase 1 (PARP1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03656
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
Drug Oxaliplatin
 Drug Info 
m6A Target: miR-17-92
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03657
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
Drug Everolimus
 Drug Info 
m6A Target: Basic leucine zipper transcriptional factor ATF-like 2 (BATF2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03661
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Small nucleolar RNA host gene 3 (SNHG3)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03662
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Small nucleolar RNA host gene (SNHG7)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03663
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Signal transducer and activator of transcription 3 (STAT3)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03665
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Centromere protein F (CENPF)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03666
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Kelch-like protein 5 (KLHL5)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03667
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Interleukin-12 subunit beta (IL12B)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05999
 Crosstalk Info 
Epigenetic Regulator Lysine-specific demethylase 6B (KDM6B)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship Histone modification → m6A
Disease Inflammatory response
 Disease Info 
Non-coding RNA
m6A Target: LINC00035 (ABHD11-AS1)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05026
 Crosstalk Info 
Epigenetic Regulator LINC00035 (ABHD11-AS1)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship m6A → ncRNA
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT05618
 Crosstalk Info 
Epigenetic Regulator LINC00035 (ABHD11-AS1)
Regulated Target Krueppel-like factor 4 (KLF4)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05690
 Crosstalk Info 
Epigenetic Regulator LINC00035 (ABHD11-AS1)
Regulated Target hsa-miR-1301-3p
Crosstalk relationship m6A → ncRNA
Disease Acute ischemic stroke
 Disease Info 
m6A Target: Integral membrane protein DGCR2/IDD (DGCR2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05028
 Crosstalk Info 
Epigenetic Regulator hsa-miR-423-3p
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
m6A Target: Tubulin beta-4B chain (TUBB4B)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05029
 Crosstalk Info 
Epigenetic Regulator hsa-miR-1226-3p
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
m6A Target: Transcription factor 4 (TCF4)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05030
 Crosstalk Info 
Epigenetic Regulator hsa-miR-330-5p
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
m6A Target: Small ribosomal subunit protein uS15 (RPS13)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05031
 Crosstalk Info 
Epigenetic Regulator mmu-miR-1981-5p
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
m6A Target: Epidermal growth factor receptor (EGFR)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05032
 Crosstalk Info 
Epigenetic Regulator hsa-miR-33a
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
 Disease Info 
m6A Target: Tafazzin (TAFAZZIN)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05033
 Crosstalk Info 
Epigenetic Regulator hsa-miR-33a
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
 Disease Info 
m6A Target: MAP kinase-activated protein kinase 2 (MAPKAPK2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05034
 Crosstalk Info 
Epigenetic Regulator hsa-miR-33a
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
 Disease Info 
m6A Target: Cysteine methyltransferase DNMT3A (DNMT3A)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05035
 Crosstalk Info 
Epigenetic Regulator hsa-miR-33a
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05961
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 942 (LINC00942)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Gastric cancer
 Disease Info 
Drug Decitabine
 Drug Info 
m6A Target: Ragulator complex protein LAMTOR5 (LAMTOR5/HBXIP)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05036
 Crosstalk Info 
Epigenetic Regulator MicroRNA let-7g (MIRLET7G)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Breast cancer
 Disease Info 
Crosstalk ID: M6ACROT05375
 Crosstalk Info 
Epigenetic Regulator MicroRNA let-7g (MIRLET7G)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship m6A → ncRNA
Disease Breast cancer
 Disease Info 
m6A Target: Rho GTPase activating protein 5 (ARHGAP5)
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT05051
 Crosstalk Info 
Epigenetic Regulator ARHGAP5 antisense RNA 1 (head to head) (ARHGAP5-AS1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Gastric cancer
 Disease Info 
Drug Cisplatin
 Drug Info 
Crosstalk ID: M6ACROT05218
 Crosstalk Info 
Epigenetic Regulator hsa-miR-532-5p
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Breast cancer
 Disease Info 
Crosstalk ID: M6ACROT05982
 Crosstalk Info 
Epigenetic Regulator ARHGAP5 antisense RNA 1 (head to head) (ARHGAP5-AS1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Gastric cancer
 Disease Info 
Drug Adriamycin
 Drug Info 
Crosstalk ID: M6ACROT05983
 Crosstalk Info 
Epigenetic Regulator ARHGAP5 antisense RNA 1 (head to head) (ARHGAP5-AS1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Gastric cancer
 Disease Info 
Drug Fluorouracil
 Drug Info 
m6A Target: Catenin beta-1 (CTNNB1/Beta-catenin)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05052
 Crosstalk Info 
Epigenetic Regulator MicroRNA 186 (MIR186)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Hepatoblastoma
 Disease Info 
m6A Target: microRNA 186 (MIR186)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05053
 Crosstalk Info 
Epigenetic Regulator MicroRNA 186 (MIR186)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Hepatoblastoma
 Disease Info 
Crosstalk ID: M6ACROT05416
 Crosstalk Info 
Epigenetic Regulator MicroRNA 186 (MIR186)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship m6A → ncRNA
Disease Hepatoblastoma
 Disease Info 
m6A Target: Cystine/glutamate transporter (SLC7A11)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05054
 Crosstalk Info 
Epigenetic Regulator MicroRNA 186 (MIR186)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Hepatoblastoma
 Disease Info 
m6A Target: OIP5 antisense RNA 1 (OIP5-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05065
 Crosstalk Info 
Epigenetic Regulator OIP5 antisense RNA 1 (OIP5-AS1)
Regulated Target Tripartite motif containing 5 (TRIM5)
Crosstalk relationship m6A → ncRNA
Disease Gastric cancer
 Disease Info 
m6A Target: GTPase KRas (KRAS)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05073
 Crosstalk Info 
Epigenetic Regulator hsa-miR-30c-5p
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Cervical cancer
 Disease Info 
m6A Target: Protein mono-ADP-ribosyltransferase PARP10 (PARP10)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05086
 Crosstalk Info 
Epigenetic Regulator Cardiac-hypertrophy-associated piRNA
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Cardiomegaly
 Disease Info 
m6A Target: Transcriptional coactivator YAP1 (YAP1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05092
 Crosstalk Info 
Epigenetic Regulator piR31115
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Triple-negative breast cancer
 Disease Info 
m6A Target: Cytochrome c oxidase subunit 4 isoform 1, mitochondrial (COX4I1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05095
 Crosstalk Info 
Epigenetic Regulator PM2.5-associated exosomal transcript PAET
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Asthma
 Disease Info 
m6A Target: Myc proto-oncogene protein (MYC)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05103
 Crosstalk Info 
Epigenetic Regulator hsa-miR-493-5p
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Acute myeloid leukaemia
 Disease Info 
Crosstalk ID: M6ACROT05104
 Crosstalk Info 
Epigenetic Regulator Maternally expressed 3 (MEG3)
Regulated Target hsa-miR-493-5p
Crosstalk relationship ncRNA → m6A
Disease Acute myeloid leukaemia
 Disease Info 
Crosstalk ID: M6ACROT05327
 Crosstalk Info 
Epigenetic Regulator hsa-miR-338-5p
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Lung cancer
 Disease Info 
m6A Target: Integrin alpha-6 (ITGA6)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05111
 Crosstalk Info 
Epigenetic Regulator hsa-miR-502-3p
Regulated Target Ragulator complex protein LAMTOR5 (LAMTOR5/HBXIP)
Crosstalk relationship ncRNA → m6A
Disease Liver hepatocellular carcinoma
 Disease Info 
Crosstalk ID: M6ACROT05112
 Crosstalk Info 
Epigenetic Regulator Small nucleolar RNA host gene 3 (SNHG3)
Regulated Target hsa-miR-502-3p
Crosstalk relationship ncRNA → m6A
Disease Liver hepatocellular carcinoma
 Disease Info 
m6A Target: NACHT, LRR and PYD domains-containing protein 3 (NLRP3)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05161
 Crosstalk Info 
Epigenetic Regulator hsa-miR-1208
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Osteoarthritis
 Disease Info 
Crosstalk ID: M6ACROT05223
 Crosstalk Info 
Epigenetic Regulator MIR570 host gene (MIR570HG)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
m6A Target: Tumor necrosis factor receptor superfamily member 6 (FAS)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05162
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 1410 (LINC01410)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Preeclampsia
 Disease Info 
m6A Target: Nuclear pore complex protein Nup214 (NUP214)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05164
 Crosstalk Info 
Epigenetic Regulator hsa-miR-1208
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Brain cancer
 Disease Info 
m6A Target: long intergenic non-protein coding RNA 662 (LINC00662)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05167
 Crosstalk Info 
Epigenetic Regulator hsa-miR-186-5p
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Triple-negative breast cancer
 Disease Info 
Drug Docetaxel
 Drug Info 
Crosstalk ID: M6ACROT05168
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 662 (LINC00662)
Regulated Target hsa-miR-186-5p
Crosstalk relationship ncRNA → m6A
Disease Triple-negative breast cancer
 Disease Info 
Drug Docetaxel
 Drug Info 
m6A Target: Paired box protein Pax-8 (PAX8)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05169
 Crosstalk Info 
Epigenetic Regulator hsa-miR-493-5p
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Thyroid Cancer
 Disease Info 
Drug Sodium iodide I 131
 Drug Info 
m6A Target: Intraflagellar transport protein 80 homolog (IFT80)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05177
 Crosstalk Info 
Epigenetic Regulator H2AZ2 pseudogene 1 (H2AZ2P1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Head and neck squamous carcinoma
 Disease Info 
m6A Target: Interleukin-1 beta (IL1B)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05180
 Crosstalk Info 
Epigenetic Regulator Long noncoding RNA HZ06 (Lnc-HZ06)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Abortion
 Disease Info 
Drug Benzo[a]pyrene
 Drug Info 
m6A Target: CCN family member 2 (CTGF)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05184
 Crosstalk Info 
Epigenetic Regulator AI662270
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Chronic kidney disease
 Disease Info 
m6A Target: Collagen alpha-2(I) chain (COL1A2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05188
 Crosstalk Info 
Epigenetic Regulator METTL3 binding lncRNA (MetBil)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Vascular disorders of the liver
 Disease Info 
m6A Target: Metalloproteinase inhibitor 1 (TIMP-1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05189
 Crosstalk Info 
Epigenetic Regulator METTL3 binding lncRNA (MetBil)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Vascular disorders of the liver
 Disease Info 
m6A Target: Amphiregulin (AREG)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05214
 Crosstalk Info 
Epigenetic Regulator hsa-miR-33a-3p
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Pancreatic cancer
 Disease Info 
m6A Target: 2,4-dienoyl-CoA reductase [ (DECR1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05227
 Crosstalk Info 
Epigenetic Regulator HNF4A antisense RNA 1 (HNF4A-AS1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
 Disease Info 
Drug Sorafenib
 Drug Info 
m6A Target: Transcription factor SOX-2 (SOX2)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05271
 Crosstalk Info 
Epigenetic Regulator Circ_VMP1
Regulated Target hsa-miR-524-5p
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
 Disease Info 
Drug Cisplatin
 Drug Info 
Crosstalk ID: M6ACROT05272
 Crosstalk Info 
Epigenetic Regulator hsa-miR-524-5p
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
 Disease Info 
Drug Cisplatin
 Drug Info 
m6A Target: Heat shock factor protein 1 (HSF1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05277
 Crosstalk Info 
Epigenetic Regulator hsa-miR-455-3p
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Heme oxygenase 1 (HMOX1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05279
 Crosstalk Info 
Epigenetic Regulator hsa-miR-340-3p
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Diseases of the female genital system
 Disease Info 
m6A Target: Bone morphogenetic protein 2 (BMP2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05282
 Crosstalk Info 
Epigenetic Regulator piR-36741
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Osteoporosis
 Disease Info 
m6A Target: Mutated in multiple advanced cancers 1 (PTEN)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05287
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 470 (LINC00470)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Gastric cancer
 Disease Info 
Crosstalk ID: M6ACROT05364
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 470 (LINC00470)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Chronic myeloid leukaemia
 Disease Info 
m6A Target: CUB domain-containing protein 1 (CDCP1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05293
 Crosstalk Info 
Epigenetic Regulator hsa-miR-338-5p
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Ferroptosis suppressor protein 1 (AIFM2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05301
 Crosstalk Info 
Epigenetic Regulator hsa-miR-4443
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
 Disease Info 
Drug Cisplatin
 Drug Info 
m6A Target: Wnt inhibitory factor 1 (WIF1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05304
 Crosstalk Info 
Epigenetic Regulator hsa-miR-21-5p
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Endometriosis
 Disease Info 
m6A Target: Interleukin enhancer-binding factor 3 (ILF3)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05305
 Crosstalk Info 
Epigenetic Regulator ILF3 divergent transcript (ILF3-DT)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
 Disease Info 
m6A Target: Translocation protein SEC62 (SEC62)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05312
 Crosstalk Info 
Epigenetic Regulator hsa-miR-4429
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Signal transducer and activator of transcription 3 (STAT3)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05324
 Crosstalk Info 
Epigenetic Regulator LOC10013.776 (AGAP2-AS1)
Regulated Target Pre-mRNA-splicing regulator WTAP (WTAP)
Crosstalk relationship ncRNA → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Neurotrophic factor BDNF precursor form (BDNF)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05336
 Crosstalk Info 
Epigenetic Regulator SnoRNA-ended lncRNA Enhances pre-Ribosomal RNA Transcription (SLERT)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Endometrial cancer
 Disease Info 
m6A Target: Signal transducer and activator of transcription 2 (STAT2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05342
 Crosstalk Info 
Epigenetic Regulator Small nucleolar RNA host gene 4 (SNHG4)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Congenital pneumonia
 Disease Info 
m6A Target: Kinesin-like protein KIF3C (KIF3C)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05343
 Crosstalk Info 
Epigenetic Regulator hsa-miR-320d
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Prostate cancer
 Disease Info 
m6A Target: Homeobox protein NANOG (NANOG)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05351
 Crosstalk Info 
Epigenetic Regulator MiR-135 family
Regulated Target Zinc finger protein 217 (ZNF217)
Crosstalk relationship ncRNA → m6A
Disease Breast cancer
 Disease Info 
m6A Target: Long intergenic non-protein coding RNA 1273 (LINC01273)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05354
 Crosstalk Info 
Epigenetic Regulator hsa-miR-600
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
 Disease Info 
Drug Sorafenib
 Drug Info 
Crosstalk ID: M6ACROT05355
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 1273 (LINC01273)
Regulated Target hsa-miR-600
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
 Disease Info 
Drug Sorafenib
 Drug Info 
Crosstalk ID: M6ACROT05611
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 1273 (LINC01273)
Regulated Target hsa-miR-600
Crosstalk relationship m6A → ncRNA
Disease Liver cancer
 Disease Info 
Drug Sorafenib
 Drug Info 
m6A Target: Aspartate--tRNA ligase, cytoplasmic (DARS)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05356
 Crosstalk Info 
Epigenetic Regulator DARS1 antisense RNA 1 (DARS1-AS1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Cervical cancer
 Disease Info 
m6A Target: Oxidized low-density lipoprotein receptor 1 (OLR1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05358
 Crosstalk Info 
Epigenetic Regulator Circ_TTLL13
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Brain cancer
 Disease Info 
Drug Temozolomide
 Drug Info 
m6A Target: Suppressor of cytokine signaling 2 (SOCS2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05360
 Crosstalk Info 
Epigenetic Regulator hsa-miR-302a
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Brain cancer
 Disease Info 
m6A Target: H/ACA ribonucleoprotein complex subunit DKC1 (DKC1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05363
 Crosstalk Info 
Epigenetic Regulator Circ_MEG3
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
 Disease Info 
m6A Target: Transcription factor SOX-9 (SOX9)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05370
 Crosstalk Info 
Epigenetic Regulator Circ_FTO
Regulated Target Methyltransferase-like protein 14 (METTL14)
Crosstalk relationship ncRNA → m6A
Disease Rheumatoid arthritis
 Disease Info 
m6A Target: microRNA 25 (MIR25)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05379
 Crosstalk Info 
Epigenetic Regulator MicroRNA 25 (MIR25)
Regulated Target PHLPP-like (PHLPP2)
Crosstalk relationship m6A → ncRNA
Disease Pancreatic cancer
 Disease Info 
m6A Target: hsa-miR-873-5p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05380
 Crosstalk Info 
Epigenetic Regulator hsa-miR-873-5p
Regulated Target Kelch-like ECH-associated protein 1 (KEAP1)
Crosstalk relationship m6A → ncRNA
Disease Diseases of the urinary system
 Disease Info 
m6A Target: microRNA 221 (MIR221)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05381
 Crosstalk Info 
Epigenetic Regulator MicroRNA 221 (MIR221)
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → ncRNA
Disease Bladder cancer
 Disease Info 
Crosstalk ID: M6ACROT05561
 Crosstalk Info 
Epigenetic Regulator MicroRNA 221 (MIR221)
Regulated Target Dickkopf-related protein 2 (DKK2)
Crosstalk relationship m6A → ncRNA
Disease Cardiomegaly
 Disease Info 
m6A Target: microRNA 222 (MIR222)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05382
 Crosstalk Info 
Epigenetic Regulator MicroRNA 222 (MIR222)
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → ncRNA
Disease Bladder cancer
 Disease Info 
Crosstalk ID: M6ACROT05562
 Crosstalk Info 
Epigenetic Regulator MicroRNA 222 (MIR222)
Regulated Target Dickkopf-related protein 2 (DKK2)
Crosstalk relationship m6A → ncRNA
Disease Cardiomegaly
 Disease Info 
m6A Target: Family with sequence similarity 225 member A (FAM225A)
 Target Gene 
In total 9 item(s) under this m6A target
Crosstalk ID: M6ACROT05396
 Crosstalk Info 
Epigenetic Regulator Family with sequence similarity 225 member A (FAM225A)
Regulated Target Integrin subunit beta 3 (ITGB3)
Crosstalk relationship m6A → ncRNA
Disease Nasopharyngeal carcinoma
 Disease Info 
Crosstalk ID: M6ACROT05942
 Crosstalk Info 
Epigenetic Regulator Family with sequence similarity 225 member A (FAM225A)
Regulated Target hsa-miR-590-3p
Crosstalk relationship m6A → ncRNA
Disease Cholangiocarcinoma
 Disease Info 
Crosstalk ID: M6ACROT05943
 Crosstalk Info 
Epigenetic Regulator Family with sequence similarity 225 member A (FAM225A)
Regulated Target MicroRNA 1275 (MIR1275)
Crosstalk relationship m6A → ncRNA
Disease Nasopharyngeal carcinoma
 Disease Info 
Crosstalk ID: M6ACROT05944
 Crosstalk Info 
Epigenetic Regulator Family with sequence similarity 225 member A (FAM225A)
Regulated Target hsa-miR-590-3p
Crosstalk relationship m6A → ncRNA
Disease Hepatocellular carcinoma
 Disease Info 
Crosstalk ID: M6ACROT05945
 Crosstalk Info 
Epigenetic Regulator Family with sequence similarity 225 member A (FAM225A)
Regulated Target MicroRNA 1275 (MIR1275)
Crosstalk relationship m6A → ncRNA
Disease Hepatocellular carcinoma
 Disease Info 
Crosstalk ID: M6ACROT05946
 Crosstalk Info 
Epigenetic Regulator hsa-miR-590-3p
Regulated Target Integrin subunit beta 3 (ITGB3)
Crosstalk relationship m6A → ncRNA
Disease Cholangiocarcinoma
 Disease Info 
Crosstalk ID: M6ACROT05947
 Crosstalk Info 
Epigenetic Regulator MicroRNA 1275 (MIR1275)
Regulated Target Integrin subunit beta 3 (ITGB3)
Crosstalk relationship m6A → ncRNA
Disease Nasopharyngeal carcinoma
 Disease Info 
Crosstalk ID: M6ACROT05948
 Crosstalk Info 
Epigenetic Regulator hsa-miR-590-3p
Regulated Target Integrin subunit beta 3 (ITGB3)
Crosstalk relationship m6A → ncRNA
Disease Hepatocellular carcinoma
 Disease Info 
Crosstalk ID: M6ACROT05949
 Crosstalk Info 
Epigenetic Regulator MicroRNA 1275 (MIR1275)
Regulated Target Integrin subunit beta 3 (ITGB3)
Crosstalk relationship m6A → ncRNA
Disease Hepatocellular carcinoma
 Disease Info 
m6A Target: microRNA 1246 (MIR1246)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05397
 Crosstalk Info 
Epigenetic Regulator MicroRNA 1246 (MIR1246)
Regulated Target Sprouty-related, EVH1 domain-containing protein 2 (SPRED2)
Crosstalk relationship m6A → ncRNA
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT05490
 Crosstalk Info 
Epigenetic Regulator MicroRNA 1246 (MIR1246)
Regulated Target Paternally-expressed gene 3 protein (PEG3)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
m6A Target: Long intergenic non-protein coding RNA 470 (LINC00470)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05402
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 470 (LINC00470)
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → ncRNA
Disease Gastric cancer
 Disease Info 
Crosstalk ID: M6ACROT05487
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 470 (LINC00470)
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → ncRNA
Disease Chronic myeloid leukaemia
 Disease Info 
m6A Target: Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
 Target Gene 
In total 14 item(s) under this m6A target
Crosstalk ID: M6ACROT05404
 Crosstalk Info 
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Regulated Target Transcriptional coactivator YAP1 (YAP1)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
Drug Cisplatin
 Drug Info 
Crosstalk ID: M6ACROT05424
 Crosstalk Info 
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Regulated Target MicroRNA 145 (MIR145)
Crosstalk relationship m6A → ncRNA
Disease Chronic kidney disease
 Disease Info 
Drug Dihydroartemisinin
 Drug Info 
Crosstalk ID: M6ACROT05479
 Crosstalk Info 
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Crosstalk relationship m6A → ncRNA
Disease Kidney failure
 Disease Info 
Crosstalk ID: M6ACROT05492
 Crosstalk Info 
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Regulated Target Transcription factor p65 (RELA)
Crosstalk relationship m6A → ncRNA
Disease Brain cancer
 Disease Info 
Crosstalk ID: M6ACROT05510
 Crosstalk Info 
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Regulated Target hsa-miR-26b
Crosstalk relationship m6A → ncRNA
Disease Breast cancer
 Disease Info 
Crosstalk ID: M6ACROT05515
 Crosstalk Info 
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Regulated Target Myc proto-oncogene protein (MYC)
Crosstalk relationship m6A → ncRNA
Disease Thymic epithelial tumors
 Disease Info 
Drug JQ1
 Drug Info 
Crosstalk ID: M6ACROT05516
 Crosstalk Info 
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Regulated Target Myc proto-oncogene protein (MYC)
Crosstalk relationship m6A → ncRNA
Disease Thymic epithelial tumors
 Disease Info 
Drug Cisplatin
 Drug Info 
Crosstalk ID: M6ACROT05608
 Crosstalk Info 
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Regulated Target hsa-miR-26b
Crosstalk relationship m6A → ncRNA
Disease Breast cancer
 Disease Info 
Crosstalk ID: M6ACROT05613
 Crosstalk Info 
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Regulated Target Transcription factor E2F1 (E2F1)
Crosstalk relationship m6A → ncRNA
Disease Breast cancer
 Disease Info 
Drug Adriamycin
 Drug Info 
Crosstalk ID: M6ACROT05644
 Crosstalk Info 
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Crosstalk relationship m6A → ncRNA
Disease Osteosarcoma
 Disease Info 
Crosstalk ID: M6ACROT05694
 Crosstalk Info 
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Regulated Target hsa-miR-124-3p
Crosstalk relationship m6A → ncRNA
Disease Ewing's sarcoma
 Disease Info 
Crosstalk ID: M6ACROT05728
 Crosstalk Info 
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05822
 Crosstalk Info 
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Crosstalk relationship m6A → ncRNA
Disease Osteosarcoma
 Disease Info 
Crosstalk ID: M6ACROT05930
 Crosstalk Info 
Epigenetic Regulator MicroRNA 145 (MIR145)
Regulated Target Focal adhesion kinase 1 (FAK)
Crosstalk relationship m6A → ncRNA
Disease Chronic kidney disease
 Disease Info 
Drug Dihydroartemisinin
 Drug Info 
m6A Target: hsa-miR-1914-3p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05406
 Crosstalk Info 
Epigenetic Regulator hsa-miR-1914-3p
Regulated Target Transcriptional coactivator YAP1 (YAP1)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
Drug Cisplatin
 Drug Info 
m6A Target: hsa-miR-143-3p
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05409
 Crosstalk Info 
Epigenetic Regulator hsa-miR-143-3p
Regulated Target Vasohibin 1 (VASH1)
Crosstalk relationship m6A → ncRNA
Disease Lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05554
 Crosstalk Info 
Epigenetic Regulator hsa-miR-143-3p
Regulated Target Protein kinase C epsilon (PRKCE)
Crosstalk relationship m6A → ncRNA
Disease Ischemic heart disease
 Disease Info 
Crosstalk ID: M6ACROT05760
 Crosstalk Info 
Epigenetic Regulator hsa-miR-143-3p
Regulated Target Mothers against decapentaplegic homolog 3 (SMAD3)
Crosstalk relationship m6A → ncRNA
Disease Asthma
 Disease Info 
m6A Target: mmu-miR-365-3p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05411
 Crosstalk Info 
Epigenetic Regulator mmu-miR-365-3p
Crosstalk relationship m6A → ncRNA
Disease Chronic pain
 Disease Info 
m6A Target: Long intergenic non-protein coding RNA 958 (LINC00958)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05412
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 958 (LINC00958)
Regulated Target Hepatoma-derived growth factor (HDGF)
Crosstalk relationship m6A → ncRNA
Disease Liver cancer
 Disease Info 
Crosstalk ID: M6ACROT05471
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 958 (LINC00958)
Regulated Target hsa-miR-378a-3p
Crosstalk relationship m6A → ncRNA
Disease Breast cancer
 Disease Info 
m6A Target: PncRNA-D
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05423
 Crosstalk Info 
Epigenetic Regulator PncRNA-D
Regulated Target G1/S-specific cyclin-D1 (CCND1)
Crosstalk relationship m6A → ncRNA
Disease Liposarcoma
 Disease Info 
m6A Target: LncRNA activating regulator of DKK1 (LNCAROD)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05425
 Crosstalk Info 
Epigenetic Regulator LncRNA activating regulator of DKK1 (LNCAROD)
Regulated Target Y-box-binding protein 1 (YBX1)
Crosstalk relationship m6A → ncRNA
Disease Head and neck squamous carcinoma
 Disease Info 
m6A Target: mmu-miR-7212-5p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05430
 Crosstalk Info 
Epigenetic Regulator mmu-miR-7212-5p
Regulated Target Fibroblast growth factor receptor 3 (FGFR3)
Crosstalk relationship m6A → ncRNA
Disease Unspecific body region injury
 Disease Info 
m6A Target: hsa-miR-25-3p
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05432
 Crosstalk Info 
Epigenetic Regulator hsa-miR-25-3p
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → ncRNA
Disease Diabetic retinopathy
 Disease Info 
Crosstalk ID: M6ACROT05433
 Crosstalk Info 
Epigenetic Regulator hsa-miR-25-3p
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → ncRNA
Disease Diabetes
 Disease Info 
m6A Target: microRNA 335 (MIR335)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05434
 Crosstalk Info 
Epigenetic Regulator MicroRNA 335 (MIR335)
Regulated Target ZFP36 ring finger protein like 1 (ZFP36L1)
Crosstalk relationship m6A → ncRNA
Disease Acute ischemic stroke
 Disease Info 
m6A Target: hsa_circ_0029589 (Circ_CHFR)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05436
 Crosstalk Info 
Epigenetic Regulator hsa_circ_0029589 (Circ_CHFR)
Crosstalk relationship m6A → ncRNA
Disease Acute coronary syndrome
 Disease Info 
m6A Target: Testis associated oncogenic lncRNA (THORLNC)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05441
 Crosstalk Info 
Epigenetic Regulator Testis associated oncogenic lncRNA (THORLNC)
Crosstalk relationship m6A → ncRNA
m6A Target: hsa-miR-126-5p
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05445
 Crosstalk Info 
Epigenetic Regulator hsa-miR-126-5p
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → ncRNA
Disease Ovarian cancer
 Disease Info 
Crosstalk ID: M6ACROT05449
 Crosstalk Info 
Epigenetic Regulator hsa-miR-126-5p
Regulated Target Phosphatidylinositol 3-kinase regulatory subunit beta (PI3K-p85/PIK3R2)
Crosstalk relationship m6A → ncRNA
Disease Chondropathies
 Disease Info 
m6A Target: Lnc_D63785
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05446
 Crosstalk Info 
Epigenetic Regulator Lnc_D63785
Regulated Target hsa-miR-422a
Crosstalk relationship m6A → ncRNA
Disease Unspecific body region injury
 Disease Info 
Crosstalk ID: M6ACROT05447
 Crosstalk Info 
Epigenetic Regulator hsa-miR-422a
Regulated Target Mitogen-activated protein kinase kinase 6 (MAP2K6)
Crosstalk relationship m6A → ncRNA
Disease Unspecific body region injury
 Disease Info 
Crosstalk ID: M6ACROT05940
 Crosstalk Info 
Epigenetic Regulator hsa-miR-422a
Regulated Target Myocyte enhancer factor 2D (MEF2D)
Crosstalk relationship m6A → ncRNA
Disease Unspecific body region injury
 Disease Info 
m6A Target: H19 imprinted maternally expressed transcript (H19)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05450
 Crosstalk Info 
Epigenetic Regulator H19 imprinted maternally expressed transcript (H19)
Crosstalk relationship m6A → ncRNA
Disease Abnormalities of breathing
 Disease Info 
m6A Target: ZNFX1 antisense RNA 1 (ZFAS1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05452
 Crosstalk Info 
Epigenetic Regulator ZNFX1 antisense RNA 1 (ZFAS1)
Regulated Target MicroRNA 647 (MIR647)
Crosstalk relationship m6A → ncRNA
Disease Cervical cancer
 Disease Info 
Crosstalk ID: M6ACROT05627
 Crosstalk Info 
Epigenetic Regulator ZNFX1 antisense RNA 1 (ZFAS1)
Regulated Target hsa-miR-100-3p
Crosstalk relationship m6A → ncRNA
Disease Nasopharyngeal carcinoma
 Disease Info 
m6A Target: Long intergenic non-protein coding RNA 2598 (LINC02598/RP11)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05461
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 2598 (LINC02598/RP11)
Regulated Target F-box/SPRY domain-containing protein 1 (FBXO45)
Crosstalk relationship m6A → ncRNA
Disease Colorectal cancer
 Disease Info 
m6A Target: hsa_circ_0092493 (circ_ARL3)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05463
 Crosstalk Info 
Epigenetic Regulator hsa_circ_0092493 (Circ_ARL3)
Regulated Target microRNA 1305 (MIR1305)
Crosstalk relationship m6A → ncRNA
Disease Liver cancer
 Disease Info 
m6A Target: hsa-miR-221-3p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05465
 Crosstalk Info 
Epigenetic Regulator hsa-miR-221-3p
Regulated Target Homeodomain-interacting protein kinase 2 (HIPK2)
Crosstalk relationship m6A → ncRNA
Disease Melanoma
 Disease Info 
Drug RSL3
 Drug Info 
m6A Target: Long intergenic non-protein coding RNA 460 (LINC00460)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05470
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 460 (LINC00460)
Regulated Target ATP-dependent RNA helicase A (DHX9)
Crosstalk relationship m6A → ncRNA
Disease Colorectal cancer
 Disease Info 
m6A Target: hsa-miR-186-5p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05473
 Crosstalk Info 
Epigenetic Regulator hsa-miR-186-5p
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship m6A → ncRNA
Disease Melanoma
 Disease Info 
Drug ML162
 Drug Info 
m6A Target: Small nucleolar RNA host gene 3 (SNHG3)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05474
 Crosstalk Info 
Epigenetic Regulator Small nucleolar RNA host gene 3 (SNHG3)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship m6A → ncRNA
Disease Melanoma
 Disease Info 
Drug ML-210
 Drug Info 
Crosstalk ID: M6ACROT05662
 Crosstalk Info 
Epigenetic Regulator Small nucleolar RNA host gene 3 (SNHG3)
Regulated Target hsa-miR-186-5p
Crosstalk relationship m6A → ncRNA
Disease Gastric cancer
 Disease Info 
Crosstalk ID: M6ACROT05688
 Crosstalk Info 
Epigenetic Regulator Small nucleolar RNA host gene 3 (SNHG3)
Regulated Target hsa-miR-330-5p
Crosstalk relationship m6A → ncRNA
Disease Melanoma
 Disease Info 
m6A Target: Pvt1 oncogene (PVT1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05480
 Crosstalk Info 
Epigenetic Regulator Pvt1 oncogene (PVT1)
Crosstalk relationship m6A → ncRNA
Disease Kidney failure
 Disease Info 
m6A Target: microRNA 93 (MIR93)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05481
 Crosstalk Info 
Epigenetic Regulator MicroRNA 93 (MIR93)
Regulated Target Dual specificity protein phosphatase 2 (DUSP2)
Crosstalk relationship m6A → ncRNA
Disease Emphysema
 Disease Info 
m6A Target: hsa_circ_0081609 (circ_CUX1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05484
 Crosstalk Info 
Epigenetic Regulator hsa_circ_0081609 (Circ_CUX1)
Regulated Target Caspase-1 (CASP1)
Crosstalk relationship m6A → ncRNA
Disease Hypopharyngeal cancer
 Disease Info 
m6A Target: X inactive specific transcript (XIST)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05486
 Crosstalk Info 
Epigenetic Regulator X inactive specific transcript (XIST)
Regulated Target hsa-miR-302a-3p
Crosstalk relationship m6A → ncRNA
Disease Ossification of spinal ligaments
 Disease Info 
m6A Target: Circ_1662
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05488
 Crosstalk Info 
Epigenetic Regulator Circ_1662
Regulated Target Transcriptional coactivator YAP1 (YAP1)
Crosstalk relationship m6A → ncRNA
Disease Colorectal cancer
 Disease Info 
m6A Target: Maternally expressed 3 (MEG3)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05494
 Crosstalk Info 
Epigenetic Regulator Maternally expressed 3 (MEG3)
Regulated Target MicroRNA 544b (MIR544B)
Crosstalk relationship m6A → ncRNA
Disease Liver cancer
 Disease Info 
m6A Target: hsa_circ_0004771 (circ_NRIP1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05496
 Crosstalk Info 
Epigenetic Regulator hsa_circ_0004771 (Circ_NRIP1)
Regulated Target hsa-miR-199a-5p
Crosstalk relationship m6A → ncRNA
Disease Osteosarcoma
 Disease Info 
m6A Target: miR-199a
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05497
 Crosstalk Info 
Epigenetic Regulator hsa-miR-199a-5p
Regulated Target Forkhead box protein C2 (FOXC2)
Crosstalk relationship m6A → ncRNA
Disease Osteosarcoma
 Disease Info 
m6A Target: LCAT3
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05498
 Crosstalk Info 
Epigenetic Regulator LCAT3
Regulated Target Far upstream element-binding protein 1 (FUBP1)
Crosstalk relationship m6A → ncRNA
Disease Lung cancer
 Disease Info 
m6A Target: Nuclear paraspeckle assembly transcript 1 (NEAT1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05502
 Crosstalk Info 
Epigenetic Regulator Nuclear paraspeckle assembly transcript 1 (NEAT1)
Regulated Target hsa-miR-766-5p
Crosstalk relationship m6A → ncRNA
Disease Chronic myeloid leukaemia
 Disease Info 
Crosstalk ID: M6ACROT05712
 Crosstalk Info 
Epigenetic Regulator Nuclear paraspeckle assembly transcript 1 (NEAT1)
Regulated Target hsa-miR-361-3p
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
m6A Target: hsa-miR-766-5p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05503
 Crosstalk Info 
Epigenetic Regulator hsa-miR-766-5p
Regulated Target Cyclin-dependent kinase inhibitor 1 (CDKN1A)
Crosstalk relationship m6A → ncRNA
Disease Chronic myeloid leukaemia
 Disease Info 
m6A Target: NIFK antisense RNA 1 (NIFK-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05504
 Crosstalk Info 
Epigenetic Regulator NIFK antisense RNA 1 (NIFK-AS1)
Regulated Target MicroRNA 637 (MIR637)
Crosstalk relationship m6A → ncRNA
Disease Liver cancer
 Disease Info 
Drug Sorafenib
 Drug Info 
m6A Target: LBX2 antisense RNA 1 (LBX2-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05517
 Crosstalk Info 
Epigenetic Regulator LBX2 antisense RNA 1 (LBX2-AS1)
Regulated Target hsa-miR-422a
Crosstalk relationship m6A → ncRNA
Disease Colorectal cancer
 Disease Info 
Drug 5-FU
 Drug Info 
m6A Target: FOXD2 adjacent opposite strand RNA 1 (FOXD2-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05521
 Crosstalk Info 
Epigenetic Regulator FOXD2 adjacent opposite strand RNA 1 (FOXD2-AS1)
Regulated Target Cyclin-dependent kinase inhibitor 1 (CDKN1A)
Crosstalk relationship m6A → ncRNA
Disease Cervical cancer
 Disease Info 
m6A Target: THAP7 antisense RNA 1 (THAP7-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05522
 Crosstalk Info 
Epigenetic Regulator THAP7 antisense RNA 1 (THAP7-AS1)
Regulated Target Cullin 4B (CUL4B)
Crosstalk relationship m6A → ncRNA
Disease Gastric cancer
 Disease Info 
m6A Target: LIFR antisense RNA 1 (LIFR-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05526
 Crosstalk Info 
Epigenetic Regulator LIFR antisense RNA 1 (LIFR-AS1)
Regulated Target hsa-miR-150-5p
Crosstalk relationship m6A → ncRNA
Disease Pancreatic cancer
 Disease Info 
m6A Target: hsa_circ_0008399 (Circ_RBM3)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05530
 Crosstalk Info 
Epigenetic Regulator hsa_circ_0008399 (Circ_RBM3)
Regulated Target Pre-mRNA-splicing regulator WTAP (WTAP)
Crosstalk relationship m6A → ncRNA
Disease Bladder cancer
 Disease Info 
Drug Cisplatin
 Drug Info 
m6A Target: hsa_circ_0021427 (circ_HPS5)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05532
 Crosstalk Info 
Epigenetic Regulator hsa_circ_0021427 (Circ_HPS5)
Regulated Target hsa-miR-370-3p
Crosstalk relationship m6A → ncRNA
Disease Liver cancer
 Disease Info 
m6A Target: microRNA 370 (MIR370)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05534
 Crosstalk Info 
Epigenetic Regulator MicroRNA 370 (MIR370)
Regulated Target High mobility group protein HMGI-C (HMGA2)
Crosstalk relationship m6A → ncRNA
Disease Liver cancer
 Disease Info 
m6A Target: hsa-miR-140-3p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05544
 Crosstalk Info 
Epigenetic Regulator hsa-miR-140-3p
Regulated Target Ubiquitin-conjugating enzyme E2 C (UBE2C)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
m6A Target: Small nucleolar RNA host gene 1 (SNHG1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05545
 Crosstalk Info 
Epigenetic Regulator Small nucleolar RNA host gene 1 (SNHG1)
Regulated Target hsa-miR-140-3p
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05701
 Crosstalk Info 
Epigenetic Regulator Small nucleolar RNA host gene 1 (SNHG1)
Crosstalk relationship m6A → ncRNA
Disease Colorectal cancer
 Disease Info 
m6A Target: hsa_circ_0058493 (Circ_RHBDD1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05547
 Crosstalk Info 
Epigenetic Regulator hsa_circ_0058493 (Circ_RHBDD1)
Crosstalk relationship m6A → ncRNA
Disease Liver cancer
 Disease Info 
m6A Target: microRNA let-7b (MIRLET7B)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05549
 Crosstalk Info 
Epigenetic Regulator MicroRNA let-7b (MIRLET7B)
Crosstalk relationship m6A → ncRNA
Disease Lung cancer
 Disease Info 
Drug Osimertinib
 Drug Info 
m6A Target: hsa-miR-21-5p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05555
 Crosstalk Info 
Epigenetic Regulator hsa-miR-21-5p
Regulated Target Sprouty RTK signaling antagonist 1 (SPRY1)
Crosstalk relationship m6A → ncRNA
Disease Kidney disorders
 Disease Info 
m6A Target: hsa-miR-375-3p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05556
 Crosstalk Info 
Epigenetic Regulator hsa-miR-375-3p
Regulated Target PDH kinase 1 (PDK1)
Crosstalk relationship m6A → ncRNA
Disease Atherosclerosis
 Disease Info 
m6A Target: microRNA 150 (MIR150)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05558
 Crosstalk Info 
Epigenetic Regulator MicroRNA 150 (MIR150)
Regulated Target Neurotrophic factor BDNF precursor form (BDNF)
Crosstalk relationship m6A → ncRNA
Disease Neuropathic pain
 Disease Info 
m6A Target: LOC10013.776 (AGAP2-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05560
 Crosstalk Info 
Epigenetic Regulator LOC10013.776 (AGAP2-AS1)
Regulated Target hsa-miR-424-5p
Crosstalk relationship m6A → ncRNA
Disease Psoriasis
 Disease Info 
m6A Target: hsa-miR-380-3p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05563
 Crosstalk Info 
Epigenetic Regulator hsa-miR-380-3p
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → ncRNA
Disease Pancreatic cancer
 Disease Info 
m6A Target: KRT7-AS
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05565
 Crosstalk Info 
Epigenetic Regulator KRT7-AS
Regulated Target Keratin, type II cytoskeletal 7 (KRT7)
Crosstalk relationship m6A → ncRNA
Disease Breast cancer
 Disease Info 
m6A Target: hsa_circ_0000677
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05566
 Crosstalk Info 
Epigenetic Regulator hsa_circ_0000677 (Circ_ABCC1)
Regulated Target ATP binding cassette subfamily C member 1 (ABCC1 blood group) (ABCC1)
Crosstalk relationship m6A → ncRNA
Disease Colorectal cancer
 Disease Info 
m6A Target: hsa-miR-582-3p
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05568
 Crosstalk Info 
Epigenetic Regulator hsa-miR-582-3p
Regulated Target Transcriptional coactivator YAP1 (YAP1)
Crosstalk relationship m6A → ncRNA
Disease Intrahepatic cholangiocarcinoma
 Disease Info 
Crosstalk ID: M6ACROT05640
 Crosstalk Info 
Epigenetic Regulator hsa-miR-582-3p
Regulated Target Transcriptional coactivator YAP1 (YAP1)
Crosstalk relationship m6A → ncRNA
Disease Intrahepatic cholangiocarcinoma
 Disease Info 
m6A Target: hsa_circ_0008542 (Circ_PHF12)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05569
 Crosstalk Info 
Epigenetic Regulator hsa_circ_0008542 (Circ_PHF12)
Regulated Target hsa-miR-185-5p
Crosstalk relationship m6A → ncRNA
Disease Diseases of the musculoskeletal system
 Disease Info 
m6A Target: Prostate cancer associated transcript 6 (PCAT6)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05571
 Crosstalk Info 
Epigenetic Regulator Prostate cancer associated transcript 6 (PCAT6)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship m6A → ncRNA
Disease Prostate cancer
 Disease Info 
m6A Target: Circ_IGF2BP3
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05576
 Crosstalk Info 
Epigenetic Regulator Circ_IGF2BP3
Regulated Target hsa-miR-328-3p
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
m6A Target: hsa-miR-29a-3p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05580
 Crosstalk Info 
Epigenetic Regulator hsa-miR-29a-3p
Regulated Target Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A)
Crosstalk relationship m6A → ncRNA
Disease Acute respiratory distress syndrome
 Disease Info 
m6A Target: miR-17-92
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05582
 Crosstalk Info 
Epigenetic Regulator hsa-miR-17-92
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → ncRNA
Disease Gastric cancer
 Disease Info 
Drug Everolimus
 Drug Info 
Crosstalk ID: M6ACROT05941
 Crosstalk Info 
Epigenetic Regulator hsa-miR-17-92
Regulated Target Transmembrane protein 127 (TMEM127)
Crosstalk relationship m6A → ncRNA
Disease Gastric cancer
 Disease Info 
Drug Everolimus
 Drug Info 
m6A Target: hsa-miR-146a-5p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05583
 Crosstalk Info 
Epigenetic Regulator hsa-miR-146a-5p
Regulated Target Protein numb homolog (NUMB)
Crosstalk relationship m6A → ncRNA
Disease Bladder cancer
 Disease Info 
Drug Melittin
 Drug Info 
m6A Target: Long intergenic non-protein coding RNA 680 (LINC00680)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05584
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 680 (LINC00680)
Regulated Target NAD-dependent protein deacetylase sirtuin-1 (SIRT1)
Crosstalk relationship m6A → ncRNA
Disease Osteoarthritis
 Disease Info 
m6A Target: Circ_ASK1
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05586
 Crosstalk Info 
Epigenetic Regulator Circ_ASK1
Regulated Target Mitogen-activated protein kinase kinase kinase 5 (MAP3K5)
Crosstalk relationship m6A → ncRNA
Disease Lung cancer
 Disease Info 
Drug Gefitinib
 Drug Info 
m6A Target: miR-182
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05587
 Crosstalk Info 
Epigenetic Regulator MiR-182
Crosstalk relationship m6A → ncRNA
Disease Prostate cancer
 Disease Info 
m6A Target: hsa-miR-193b
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05593
 Crosstalk Info 
Epigenetic Regulator hsa-miR-193b
Regulated Target G1/S-specific cyclin-D1 (CCND1)
Crosstalk relationship m6A → ncRNA
Disease Cervical cancer
 Disease Info 
m6A Target: microRNA 126 (MIR126)
 Target Gene 
In total 8 item(s) under this m6A target
Crosstalk ID: M6ACROT05595
 Crosstalk Info 
Epigenetic Regulator MicroRNA 126 (MIR126)
Crosstalk relationship m6A → ncRNA
Disease Endometriosis
 Disease Info 
Crosstalk ID: M6ACROT05681
 Crosstalk Info 
Epigenetic Regulator MicroRNA 126 (MIR126)
Regulated Target ADAM metallopeptidase domain 9 (ADAM9)
Crosstalk relationship m6A → ncRNA
Disease Acute myeloid leukaemia
 Disease Info 
Crosstalk ID: M6ACROT05924
 Crosstalk Info 
Epigenetic Regulator MicroRNA 126 (MIR126)
Regulated Target Scaffold protein ILK (ILK)
Crosstalk relationship m6A → ncRNA
Disease Acute myeloid leukaemia
 Disease Info 
Crosstalk ID: M6ACROT05926
 Crosstalk Info 
Epigenetic Regulator MicroRNA 126 (MIR126)
Regulated Target Cyclin-dependent kinase 3 (CDK3)
Crosstalk relationship m6A → ncRNA
Disease Acute myeloid leukaemia
 Disease Info 
Crosstalk ID: M6ACROT05932
 Crosstalk Info 
Epigenetic Regulator MicroRNA 126 (MIR126)
Regulated Target Target of Myb1 membrane trafficking protein (TOM1)
Crosstalk relationship m6A → ncRNA
Disease Acute myeloid leukaemia
 Disease Info 
Crosstalk ID: M6ACROT05934
 Crosstalk Info 
Epigenetic Regulator MicroRNA 126 (MIR126)
Regulated Target High affinity immunoglobulin gamma Fc receptor I (FCGR1A)
Crosstalk relationship m6A → ncRNA
Disease Acute myeloid leukaemia
 Disease Info 
Crosstalk ID: M6ACROT05936
 Crosstalk Info 
Epigenetic Regulator MicroRNA 126 (MIR126)
Regulated Target Ficolin-1 (FCN1)
Crosstalk relationship m6A → ncRNA
Disease Acute myeloid leukaemia
 Disease Info 
Crosstalk ID: M6ACROT05938
 Crosstalk Info 
Epigenetic Regulator MicroRNA 126 (MIR126)
Regulated Target Leucine-rich repeat and calponin homology domain-containing protein 4 (LRCH4)
Crosstalk relationship m6A → ncRNA
Disease Acute myeloid leukaemia
 Disease Info 
m6A Target: Circ_DLC1
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05596
 Crosstalk Info 
Epigenetic Regulator Circ_DLC1
Regulated Target hsa-miR-671-5p
Crosstalk relationship m6A → ncRNA
Disease Brain cancer
 Disease Info 
m6A Target: hsa-miR-671-5p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05597
 Crosstalk Info 
Epigenetic Regulator hsa-miR-671-5p
Regulated Target Beta-catenin-interacting protein 1 (CTNNBIP1)
Crosstalk relationship m6A → ncRNA
Disease Brain cancer
 Disease Info 
m6A Target: pri-miR-143
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05600
 Crosstalk Info 
Epigenetic Regulator pri-miR-143
Regulated Target YY1-associated protein 1 (YY1AP1)
Crosstalk relationship m6A → ncRNA
Disease Acute myocardial infarction
 Disease Info 
Crosstalk ID: M6ACROT06027
 Crosstalk Info 
Epigenetic Regulator pri-miR-143
Regulated Target Catenin delta-1 (CTNND1)
Crosstalk relationship m6A → ncRNA
Disease Acute myocardial infarction
 Disease Info 
m6A Target: pri-miR-27
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05604
 Crosstalk Info 
Epigenetic Regulator MicroRNA MIR27 family
Crosstalk relationship m6A → ncRNA
Disease Multiple myeloma
 Disease Info 
m6A Target: hsa-miR-1915-3p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05605
 Crosstalk Info 
Epigenetic Regulator hsa-miR-1915-3p
Regulated Target Protein SET (SET)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
m6A Target: hsa-miR-34a
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05607
 Crosstalk Info 
Epigenetic Regulator hsa-miR-34a
Regulated Target NAD-dependent protein deacetylase sirtuin-1 (SIRT1)
Crosstalk relationship m6A → ncRNA
Disease Abdominal aortic aneurysm
 Disease Info 
m6A Target: hsa-miR-26b
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05610
 Crosstalk Info 
Epigenetic Regulator hsa-miR-26b
Regulated Target High mobility group protein HMGI-C (HMGA2)
Crosstalk relationship m6A → ncRNA
Disease Breast cancer
 Disease Info 
m6A Target: hsa-miR-181d-5p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05615
 Crosstalk Info 
Epigenetic Regulator hsa-miR-181d-5p
Regulated Target Neurocalcin-delta (NCALD)
Crosstalk relationship m6A → ncRNA
Disease Colorectal cancer
 Disease Info 
Drug 5-FU
 Drug Info 
m6A Target: SVIL antisense RNA 1 (SVIL-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05617
 Crosstalk Info 
Epigenetic Regulator SVIL antisense RNA 1 (SVIL-AS1)
Regulated Target Transcription factor E2F1 (E2F1)
Crosstalk relationship m6A → ncRNA
Disease Lung cancer
 Disease Info 
m6A Target: Long intergenic non-protein coding RNA 1833 (LINC01833)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05620
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 1833 (LINC01833)
Regulated Target Heterogeneous nuclear ribonucleoprotein A2/B1 (HNRNPA2B1)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
m6A Target: Small nucleolar RNA host gene (SNHG7)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05623
 Crosstalk Info 
Epigenetic Regulator Small nucleolar RNA host gene (SNHG7)
Regulated Target Myc proto-oncogene protein (MYC)
Crosstalk relationship m6A → ncRNA
Disease Prostate cancer
 Disease Info 
Crosstalk ID: M6ACROT05698
 Crosstalk Info 
Epigenetic Regulator Small nucleolar RNA host gene (SNHG7)
Crosstalk relationship m6A → ncRNA
Disease Gastric cancer
 Disease Info 
m6A Target: DBH antisense RNA 1 (Lnc_DBH-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05625
 Crosstalk Info 
Epigenetic Regulator DBH antisense RNA 1 (Lnc_DBH-AS1)
Regulated Target MicroRNA 3163 (MIR3163)
Crosstalk relationship m6A → ncRNA
Disease Pancreatic cancer
 Disease Info 
Drug Gemcitabine
 Drug Info 
m6A Target: miR-503
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05626
 Crosstalk Info 
Epigenetic Regulator MiR-503
Regulated Target PPARG coactivator 1 beta (PPARGC1B)
Crosstalk relationship m6A → ncRNA
Disease Injury of heart
 Disease Info 
m6A Target: hsa-miR-222-3p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05629
 Crosstalk Info 
Epigenetic Regulator hsa-miR-222-3p
Regulated Target Serine/threonine-protein kinase 4 (STK4)
Crosstalk relationship m6A → ncRNA
Disease Thyroid Cancer
 Disease Info 
m6A Target: hsa-miR-589-5p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05630
 Crosstalk Info 
Epigenetic Regulator hsa-miR-589-5p
Crosstalk relationship m6A → ncRNA
Disease Liver cancer
 Disease Info 
m6A Target: hsa-miR-320b
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05635
 Crosstalk Info 
Epigenetic Regulator hsa-miR-320b
Regulated Target Programmed cell death 4 (PDCD4)
Crosstalk relationship m6A → ncRNA
Disease Esophageal Squamous Cell Carcinoma
 Disease Info 
m6A Target: RNA component of 7SK nuclear ribonucleoprotein (RN7SK)
 Target Gene 
In total 6 item(s) under this m6A target
Crosstalk ID: M6ACROT05648
 Crosstalk Info 
Epigenetic Regulator RNA component of 7SK nuclear ribonucleoprotein (RN7SK)
Regulated Target The positive transcription elongation factor b complex (P-TEFb)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05660
 Crosstalk Info 
Epigenetic Regulator RNA component of 7SK nuclear ribonucleoprotein (RN7SK)
Regulated Target Cullin 1 (CUL1)
Crosstalk relationship m6A → ncRNA
Drug mitoxantrone (MIT)
 Drug Info 
Crosstalk ID: M6ACROT06030
 Crosstalk Info 
Epigenetic Regulator RNA component of 7SK nuclear ribonucleoprotein (RN7SK)
Regulated Target Cullin 1 (CUL1)
Crosstalk relationship m6A → ncRNA
Drug hydroxyurea (HYD)
 Drug Info 
Crosstalk ID: M6ACROT06033
 Crosstalk Info 
Epigenetic Regulator RNA component of 7SK nuclear ribonucleoprotein (RN7SK)
Regulated Target Cullin 1 (CUL1)
Crosstalk relationship m6A → ncRNA
Drug raltitrexed (RAL)
 Drug Info 
Crosstalk ID: M6ACROT06036
 Crosstalk Info 
Epigenetic Regulator RNA component of 7SK nuclear ribonucleoprotein (RN7SK)
Regulated Target Cullin 1 (CUL1)
Crosstalk relationship m6A → ncRNA
Drug oxaliplatin (OXA)
 Drug Info 
Crosstalk ID: M6ACROT06039
 Crosstalk Info 
Epigenetic Regulator RNA component of 7SK nuclear ribonucleoprotein (RN7SK)
Regulated Target Cullin 1 (CUL1)
Crosstalk relationship m6A → ncRNA
Drug etoposide (ETO)
 Drug Info 
m6A Target: Long intergenic non-protein coding RNA 1638 (LINC01638)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05654
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 1638 (LINC01638)
Crosstalk relationship m6A → ncRNA
Disease Periodontitis
 Disease Info 
m6A Target: AC026356.1
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05656
 Crosstalk Info 
Epigenetic Regulator AC026356.1
Regulated Target Interleukin-11 (IL11)
Crosstalk relationship m6A → ncRNA
Disease Liver cancer
 Disease Info 
m6A Target: Circ_SETD2
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05657
 Crosstalk Info 
Epigenetic Regulator Circ_SETD2
Regulated Target hsa-miR-181a-5p
Crosstalk relationship m6A → ncRNA
Disease Pre-eclampsia
 Disease Info 
m6A Target: FGD5 antisense RNA 1 (FGD5-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05665
 Crosstalk Info 
Epigenetic Regulator FGD5 antisense RNA 1 (FGD5-AS1)
Crosstalk relationship m6A → ncRNA
Disease Endometrial cancer
 Disease Info 
Drug paclitaxel (PTX)
 Drug Info 
m6A Target: EN_42575
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05675
 Crosstalk Info 
Epigenetic Regulator EN_42575
Crosstalk relationship m6A → ncRNA
Disease Change in bowel habit
 Disease Info 
m6A Target: chromosome 2 open reading frame 92 (C2orf92)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05678
 Crosstalk Info 
Epigenetic Regulator Chromosome 2 open reading frame 92 (C2ORF92)
Crosstalk relationship m6A → ncRNA
Disease Papillary thyroid cancer
 Disease Info 
m6A Target: hsa_circ_0007905 (Circ_STX6)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05680
 Crosstalk Info 
Epigenetic Regulator Circ_STX6
Regulated Target hsa-miR-6749-3p
Crosstalk relationship m6A → ncRNA
Disease Age-related cataracts
 Disease Info 
m6A Target: Circ_MYO1C
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05686
 Crosstalk Info 
Epigenetic Regulator Circ_MYO1C
Regulated Target CD274 molecule (CD274)
Crosstalk relationship m6A → ncRNA
Disease Pancreatic ductal adenocarcinoma
 Disease Info 
m6A Target: hsa-miR-181a-5p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05687
 Crosstalk Info 
Epigenetic Regulator hsa-miR-181a-5p
Regulated Target NFKB activating protein (NKAP)
Crosstalk relationship m6A → ncRNA
Disease Ageing-related disease
 Disease Info 
m6A Target: BRAF-activated non-protein coding RNA (BANCR)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05689
 Crosstalk Info 
Epigenetic Regulator BRAF-activated non-protein coding RNA (BANCR)
Crosstalk relationship m6A → ncRNA
Disease Pancreatic cancer
 Disease Info 
m6A Target: hsa-miR-148a-3p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05693
 Crosstalk Info 
Epigenetic Regulator hsa-miR-148a-3p
Regulated Target Thioredoxin-interacting protein (TXNIP)
Crosstalk relationship m6A → ncRNA
Disease Prostate cancer
 Disease Info 
m6A Target: Long intergenic non-protein coding RNA 662 (LINC00662)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05699
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 662 (LINC00662)
Regulated Target Integrin subunit alpha 1 (ITGA1)
Crosstalk relationship m6A → ncRNA
Disease Pancreatic cancer
 Disease Info 
m6A Target: KCNQ1 opposite strand/antisense transcript 1 (KCNQ1OT1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05702
 Crosstalk Info 
Epigenetic Regulator KCNQ1 opposite strand/antisense transcript 1 (KCNQ1OT1)
Regulated Target hsa-miR-103a-3p
Crosstalk relationship m6A → ncRNA
Disease Breast cancer
 Disease Info 
Drug DOX
 Drug Info 
m6A Target: hsa-miR-1908-5p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05703
 Crosstalk Info 
Epigenetic Regulator hsa-miR-1908-5p
Regulated Target HOP homeobox (HOPX)
Crosstalk relationship m6A → ncRNA
Disease Nasopharyngeal carcinoma
 Disease Info 
m6A Target: Circ_RNF13
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05706
 Crosstalk Info 
Epigenetic Regulator Circ_RNF13
Regulated Target C-X-C motif chemokine ligand 1 (CXCL1)
Crosstalk relationship m6A → ncRNA
Disease Cervical cancer
 Disease Info 
m6A Target: Circ_EPHB4
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05708
 Crosstalk Info 
Epigenetic Regulator Circ_EPHB4
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship m6A → ncRNA
Disease Brain cancer
 Disease Info 
m6A Target: Long intergenic non-protein coding RNA 426 (LINC00426)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05713
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 426 (LINC00426)
Regulated Target hsa-miR-200a-3p
Crosstalk relationship m6A → ncRNA
Disease Cervical cancer
 Disease Info 
Drug Cisplatin
 Drug Info 
Crosstalk ID: M6ACROT05714
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 426 (LINC00426)
Regulated Target hsa-miR-200a-3p
Crosstalk relationship m6A → ncRNA
Disease Cervical cancer
 Disease Info 
Drug Bleomycin
 Drug Info 
Crosstalk ID: M6ACROT05715
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 426 (LINC00426)
Regulated Target hsa-miR-200a-3p
Crosstalk relationship m6A → ncRNA
Disease Cervical cancer
 Disease Info 
Drug imatinib
 Drug Info 
m6A Target: Circ_UHRF2
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05716
 Crosstalk Info 
Epigenetic Regulator Circ_UHRF2
Regulated Target Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship m6A → ncRNA
Disease Colorectal cancer
 Disease Info 
m6A Target: Growth arrest specific 5 (GAS5)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05717
 Crosstalk Info 
Epigenetic Regulator Growth arrest specific 5 (GAS5)
Regulated Target Dynamin-1-like protein (DRP1)
Crosstalk relationship m6A → ncRNA
Disease Vascular disorders of the liver
 Disease Info 
m6A Target: pri-miR-196b
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05731
 Crosstalk Info 
Epigenetic Regulator pri-miR-196b
Crosstalk relationship m6A → ncRNA
Disease Colorectal cancer
 Disease Info 
m6A Target: microRNA 675 (MIR675)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05732
 Crosstalk Info 
Epigenetic Regulator MicroRNA 675 (MIR675)
Regulated Target myosin phosphatase targeting protein 1 (MYPT1)
Crosstalk relationship m6A → ncRNA
Disease Gastrointestinal stromal tumor
 Disease Info 
m6A Target: hsa-miR-99a-5p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05737
 Crosstalk Info 
Epigenetic Regulator hsa-miR-99a-5p
Regulated Target Beta-transducin repeat containing E3 ubiquitin protein ligase pseudogene 1 (BTRCP1)
Crosstalk relationship m6A → ncRNA
Disease Oral squamous cell carcinoma
 Disease Info 
m6A Target: HOXD antisense growth-associated long non-coding RNA (HAGLR)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05738
 Crosstalk Info 
Epigenetic Regulator HOXD antisense growth-associated long non-coding RNA (HAGLR)
Regulated Target MicroRNA 135a-1 (MIR135A1)
Crosstalk relationship m6A → ncRNA
Disease Pre-eclampsia
 Disease Info 
m6A Target: Circ_MIRLET7BHG
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05739
 Crosstalk Info 
Epigenetic Regulator Circ_MIRLET7BHG
Regulated Target Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship m6A → ncRNA
Disease Allergic rhinitis
 Disease Info 
m6A Target: pri-miR-935
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05743
 Crosstalk Info 
Epigenetic Regulator pri-miR-935
Regulated Target Gap junction alpha-1 protein (GJA1)
Crosstalk relationship m6A → ncRNA
Disease Intrahepatic cholangiocarcinoma
 Disease Info 
m6A Target: Circ_ABCC4
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05744
 Crosstalk Info 
Epigenetic Regulator Circ_ABCC4
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship m6A → ncRNA
Disease Prostate cancer
 Disease Info 
m6A Target: hsa-miR-27a-3p
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05745
 Crosstalk Info 
Epigenetic Regulator hsa-miR-27a-3p
Regulated Target Peroxisome proliferator-activated receptor gamma (PPARG)
Crosstalk relationship m6A → ncRNA
Disease Infantile hemangioma
 Disease Info 
Drug Oxymatrine
 Drug Info 
Crosstalk ID: M6ACROT05746
 Crosstalk Info 
Epigenetic Regulator hsa-miR-27a-3p
Regulated Target Peroxisome proliferator-activated receptor gamma (PPARG)
Crosstalk relationship m6A → ncRNA
Disease Infantile hemangioma
 Disease Info 
Drug propranolol (PPNL)
 Drug Info 
m6A Target: RNF32 divergent transcript (RNF32-DT)
 Target Gene 
In total 16 item(s) under this m6A target
Crosstalk ID: M6ACROT05750
 Crosstalk Info 
Epigenetic Regulator RNF32 divergent transcript (RNF32-DT)
Regulated Target MicroRNA 2682 (MIR2682)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05902
 Crosstalk Info 
Epigenetic Regulator RNF32 divergent transcript (RNF32-DT)
Regulated Target MicroRNA 34a (MIR34A)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05903
 Crosstalk Info 
Epigenetic Regulator RNF32 divergent transcript (RNF32-DT)
Regulated Target MicroRNA 34b (MIR34B)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05904
 Crosstalk Info 
Epigenetic Regulator RNF32 divergent transcript (RNF32-DT)
Regulated Target MicroRNA 34c (MIR34C)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05905
 Crosstalk Info 
Epigenetic Regulator MicroRNA 2682 (MIR2682)
Regulated Target Myc proto-oncogene protein (MYC)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05906
 Crosstalk Info 
Epigenetic Regulator hsa-miR-34a
Regulated Target Myc proto-oncogene protein (MYC)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05907
 Crosstalk Info 
Epigenetic Regulator MicroRNA 34b (MIR34B)
Regulated Target Myc proto-oncogene protein (MYC)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05908
 Crosstalk Info 
Epigenetic Regulator MicroRNA 34c (MIR34C)
Regulated Target Myc proto-oncogene protein (MYC)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05909
 Crosstalk Info 
Epigenetic Regulator RNF32 divergent transcript (RNF32-DT)
Regulated Target MicroRNA 2682 (MIR2682)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05910
 Crosstalk Info 
Epigenetic Regulator RNF32 divergent transcript (RNF32-DT)
Regulated Target MicroRNA 34a (MIR34A)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05911
 Crosstalk Info 
Epigenetic Regulator RNF32 divergent transcript (RNF32-DT)
Regulated Target MicroRNA 34b (MIR34B)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05912
 Crosstalk Info 
Epigenetic Regulator RNF32 divergent transcript (RNF32-DT)
Regulated Target MicroRNA 34c (MIR34C)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05913
 Crosstalk Info 
Epigenetic Regulator MicroRNA 2682 (MIR2682)
Regulated Target Myc proto-oncogene protein (MYC)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05914
 Crosstalk Info 
Epigenetic Regulator hsa-miR-34a
Regulated Target Myc proto-oncogene protein (MYC)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05915
 Crosstalk Info 
Epigenetic Regulator MicroRNA 34b (MIR34B)
Regulated Target Myc proto-oncogene protein (MYC)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05916
 Crosstalk Info 
Epigenetic Regulator MicroRNA 34c (MIR34C)
Regulated Target Myc proto-oncogene protein (MYC)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
 Disease Info 
m6A Target: hsa-miR-196b-5p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05751
 Crosstalk Info 
Epigenetic Regulator hsa-miR-196b-5p
Crosstalk relationship m6A → ncRNA
Disease Structural developmental anomalies of teeth and periodontal tissues
 Disease Info 
m6A Target: Long intergenic non-protein coding RNA 294 (LINC00294)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05756
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 294 (LINC00294)
Regulated Target YTH N6-methyladenosine RNA binding protein C1 (YTHDC1)
Crosstalk relationship m6A → ncRNA
Disease Liver cancer
 Disease Info 
m6A Target: SLC7A11 antisense RNA 1 (SLC7A11-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05761
 Crosstalk Info 
Epigenetic Regulator SLC7A11 antisense RNA 1 (SLC7A11-AS1)
Regulated Target E3 ubiquitin-protein ligase CHIP (STUB1)
Crosstalk relationship m6A → ncRNA
Disease Liver cancer
 Disease Info 
m6A Target: hsa_circ_0124554
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05763
 Crosstalk Info 
Epigenetic Regulator hsa_circ_0124554
Regulated Target MicroRNA 1184-1 (MIR1184-1)
Crosstalk relationship m6A → ncRNA
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT05898
 Crosstalk Info 
Epigenetic Regulator MicroRNA 1184 (MIR1184)
Regulated Target LIM and SH3 protein 1 (LASP1)
Crosstalk relationship m6A → ncRNA
Disease Colorectal cancer
 Disease Info 
m6A Target: Circ_ASXL1
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05764
 Crosstalk Info 
Epigenetic Regulator Circ_ASXL1
Regulated Target hsa-miR-320d
Crosstalk relationship m6A → ncRNA
Disease Ovarian cancer
 Disease Info 
Crosstalk ID: M6ACROT05896
 Crosstalk Info 
Epigenetic Regulator hsa-miR-320d
Regulated Target Rac GTPase-activating protein 1 (RACGAP1)
Crosstalk relationship m6A → ncRNA
Disease Ovarian cancer
 Disease Info 
m6A Target: Circ_PRKAR1B
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05769
 Crosstalk Info 
Epigenetic Regulator Circ_PRKAR1B
Regulated Target Spectrin beta, non-erythrocytic 1 (SPTBN1)
Crosstalk relationship m6A → ncRNA
Disease Crohn disease
 Disease Info 
m6A Target: hsa-mir-320a
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05788
 Crosstalk Info 
Epigenetic Regulator hsa-mir-320a
Regulated Target Runt-related transcription factor 2 (Runx2)
Crosstalk relationship m6A → ncRNA
m6A Target: MIRLET7E
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05805
 Crosstalk Info 
Epigenetic Regulator MIRLET7E
Regulated Target Thrombospondin 1 (THBS1)
Crosstalk relationship m6A → ncRNA
m6A Target: hsa-miR-20a-5p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05814
 Crosstalk Info 
Epigenetic Regulator hsa-miR-20a-5p
Regulated Target Nuclear factor 1 C-type (NFIC)
Crosstalk relationship m6A → ncRNA
m6A Target: Urothelial cancer associated 1 (UCA1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05815
 Crosstalk Info 
Epigenetic Regulator Urothelial cancer associated 1 (UCA1)
Crosstalk relationship m6A → ncRNA
m6A Target: hsa_circ_0072380 (Circ_ZNF131)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05820
 Crosstalk Info 
Epigenetic Regulator hsa_circ_0072380 (Circ_ZNF131)
Crosstalk relationship m6A → ncRNA
Disease Gestational diabetes mellitus
 Disease Info 
m6A Target: hsa_circ_0136959
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05824
 Crosstalk Info 
Epigenetic Regulator hsa_circ_0136959
Crosstalk relationship m6A → ncRNA
Disease Papillary thyroid cancer
 Disease Info 
m6A Target: pre-miR-665
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05828
 Crosstalk Info 
Epigenetic Regulator hsa-miR-665
Regulated Target Homeobox protein DLX-3 (DLX3)
Crosstalk relationship m6A → ncRNA
Disease Structural developmental anomalies of teeth and periodontal tissues
 Disease Info 
m6A Target: SREBF2 antisense RNA 1 (SREBF2-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05833
 Crosstalk Info 
Epigenetic Regulator SREBF2 antisense RNA 1 (SREBF2-AS1)
Regulated Target FMR1 autosomal homolog 1 (FXR1)
Crosstalk relationship m6A → ncRNA
Disease Acute myeloid leukaemia
 Disease Info 
Drug Chidamide
 Drug Info 
m6A Target: Lnc668
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05870
 Crosstalk Info 
Epigenetic Regulator Lnc668
Regulated Target Phosphatidylinositol-binding clathrin assembly protein (PICALM)
Crosstalk relationship m6A → ncRNA
Disease Pulmonary fibrosis
 Disease Info 
m6A Target: Retinoic Acid Receptor Alpha-Retinoic Acid Receptor Alpha (PML-RARalpha)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05878
 Crosstalk Info 
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Blood malignancies
 Disease Info 
m6A Target: Spectrin beta, non-erythrocytic 2 (SPTBN2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05929
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 1605
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
 Disease Info 
Xenobiotics Compound(s) Regulating the m6A Methylation Regulator
Compound Name MA2 Approved
Synonyms
Ethyl ester form of meclofenamic acid (MA)
    Click to Show/Hide
Description
Knockdown of METTL3 or METTL14 induced changes in mRNA m6A enrichment and altered mRNA expression of genes (e.g.,ADAM19) with critical biological functions inGSCs. Treatment with MA2, a chemical inhibitor of FTO, dramatically suppressed GSC-induced tumorigenesis and prolonged lifespan in GSC-grafted animals.
 [194]
Compound Name Simovil Approved
Synonyms
Cholestat; Coledis; Colemin; Corolin; Denan; Labistatin; Lipex; Lipovas; Lodales; Medipo; Nivelipol; Pantok; Rendapid; Simovil; Simvastatina; Simvastatine; Simvastatinum; Sinvacor; Sivastin; Synvinolin; Vasotenal; Zocor; Zocord; Simvast CR; Simvastatina [Spanish]; Simvastatine [French]; Simvastatinum [Latin]; MK 0733; MK 733; MK733; TNP00259; DRG-0320; KS-1113; L 644128-000U; MK-0733; MK-733; Simcard (TN); Simlup (TN); Simvacor (TN); Simvastatin & Primycin; Simvastatin, Compactin; Zocor (TN); Simvastatin [USAN:INN:BAN]; Simvastatin (JAN/USP/INN); Zocor, Simlup, Simcard, Simvacor, Simvoget, Zorced, Simvastatin; [(1S,3R,7S,8S,8aR)-8-[2-[(2R,4R)-4-hydroxy-6-oxooxan-2-yl]ethyl]-3,7-dimethyl-1,2,3,7,8,8a-hexahydronaphthalen-1-yl] 2,2-dimethylbutanoate; Butanoic acid, 2,2-dimethyl-, (1S,3R,7S,8S,8aR)-1,2,3,7,8,8a-hexahydro-3,7-dimethyl-8-[2-[(2R,4R)-tetrahydro-4-hydroxy-6-oxo-2H-pyran-2-yl]ethyl]-1-naphthalenyl ester; Butanoic acid, 2,2-dimethyl-, (1S,3R,7S,8S,8aR)-1,2,3,7,8,8a-hexahydro-3,7-dimethyl-8-(2-((2R,4R)-tetrahydro-4-hydroxy-6-oxo-2H-pyran-2-yl)ethyl)-1-naphthalenyl ester; Butanoic acid, 2,2-dimethyl-, (1S,3R,7S,8S,*aR)-1,2,3,7,8,8a-hexahydro-3,7-dimethyl-8-(2-((2R,4R)-tetrahydro-4-hydroxy-6-oxo-2H-pyran-2-yl)ethyl)-1-naphthalenyl ester; (1S,3R,7S,8S,8aR)-8-{2-[(2R,4R)-4-hydroxy-6-oxotetrahydro-2H-pyran-2-yl]ethyl}-3,7-dimethyl-1,2,3,7,8,8a-hexahydronaphthalen-1-yl 2,2-dimethylbutanoate; Butanoic acid, 2,2-dimethyl-,1,2,3,7,8,8a-hexahydro-3,7-dimethyl-8-[2-(tetrahydro-4-hydroxy-6-oxo-2H-pyran-2-yl)-ethyl]-1-naphthalenyl ester, [1S-[1 alpha,3 alpha,7 beta,8 beta(2S*,4S*),-8a beta; 2,2-Dimethylbutanoic acid (1S,3R,7S,8S,8aR)-1,2,3,7,8,8a-hexahydro-3,7-dimethyl-8-[2-[(2R,4R)-tetrahydro-4-hydroxy-6-oxo-2H-pyran-2-yl]ethyl]-1-naphthalenyl ester; 2,2-Dimethylbutyric acid, 8-ester with (4R,6R)-6-(2-((1S,2S,6R,8S,8aR)-1,2,6,7,8,8a-hexahydro-8-hydroxy-2,6-dimethyl-1-naphthyl)ethyl)tetrahydro-4-hydroxy-2H-pyran-2-one
    Click to Show/Hide
External link
CID: 54454
TTD: D0H0ND
DrugBank: DB00641
Description
Simvastatin induces METTL3 down-regulation in lung cancer tissues, which further influences EMT via m6A modification onEZH2 mRNA and thus inhibits the malignant progression oflung cancer.
 [59]
Compound Name Rapamycin Approved
Synonyms
Rapamune; Rapamycin (Sirolimus); AY-22989; Rapammune; sirolimusum; WY-090217; RAPA; Antibiotic AY 22989; AY 22989; UNII-W36ZG6FT64; CCRIS 9024; CHEBI:9168; SILA 9268A; W36ZG6FT64; HSDB 7284; C51H79NO13; NSC 226080; DE-109; NCGC00021305-05; DSSTox_CID_3582; DSSTox_RID_77091; DSSTox_GSID_23582; Cypher; Supralimus; Wy 090217; Perceiva; RAP; RPM; Rapamycin from Streptomyces hygroscopicus; SIIA 9268A; LCP-Siro; MS-R001; Rapamune (TN); Rapamycin (TN); Sirolimus (RAPAMUNE); Rapamycin C-7, analog 4; Sirolimus (USAN/INN); Sirolimus [USAN:BAN:INN]; Sirolimus, Rapamune,Rapamycin; Heptadecahydro-9,27-dihydroxy-3-[(1R)-2-[(1S,3R,4R)-4-hydroxy; 23,27-Epoxy-3H-pyrido(2,1-c)(1,4)oxaazacyclohentriacontine; 23,27-Epoxy-3H-pyrido[2,1-c][1,4]oxaazacyclohentriacontine; 23,27-epoxy-3H-pyrido[2,1-c][1,4]oxaazacyclohentriacontine-1,5,11,28,29; 3H-pyrido(2,1-c)(1,4)oxaazacyclohentriacontine-1,5,11,28,29(4H,6H,31H)-pentone; Sirolimus (MTOR inhibitor)
    Click to Show/Hide
External link
CID: 5284616
TTD: D03LJR
DrugBank: DB00877
Description
METTL3 promotes the progression ofretinoblastoma throughPI3K/AKT/mTOR pathways in vitro and in vivo. METTL3 has an impact on the PI3K-AKT-mTOR-P70S6K/4EBP1 pathway. The cell proliferation results show that the stimulatory function of METTL3 is lost after rapamycin treatment.
[44]
Compound Name BEZ235 Phase 2
Synonyms
BEZ-235; S14-0511; NVP-BEZ-235; NVP-BEZ235, BEZ235; 2-(4-(2,3-dihydro-3-methyl-2-oxo-8-(quinolin-3-yl)imidazo[4,5-c]quinolin-1-yl)phenyl)-2-methylpropanenitrile
    Click to Show/Hide
External link
CID: 11977753
TTD: D0VG0D
DrugBank: DB11651
Description
METTL3 plays a carcinogenic role in human EC progression partially throughAKT signaling pathways, suggesting that METTL3 serves as a potential therapeutic target foresophageal cancer therapy. A double-effect inhibitor (BEZ235) inhibited AKT and mTOR phosphorylation and hindered the effect of METTL3 overexpression on the proliferation and migration of Eca-109 and KY-SE150 cells.
[212]
Compound Name STM2457 Preclinical
Synonyms
STM-2457; SCHEMBL22499068; GTPL11529; CHEBI:172325; EX-A5018; STM 2457; s9870; HY-134836; N-[(6-{[(cyclohexylmethyl)amino]methyl}imidazo[1,2-a]pyridin-2-yl)methyl]-4-oxo-4H-pyrido[1,2-a]pyrimidine-2-carboxamide; N-[[6-[(cyclohexylmethylamino)methyl]imidazo[1,2-a]pyridin-2-yl]methyl]-4-oxopyrido[1,2-a]pyrimidine-2-carboxamide
    Click to Show/Hide
External link
CID: 155167581
Description
inhibition of METTL3 by STM2457 targets key stem cell populations ofacute myeloid leukaemia and reverses the AML phenotype, preventing or slowing the development of AML in re-transplantation experiments.
 [595]
Compound Name N~2~-hexyl-6,7-dimethoxy-N~4~-(1-methylpiperidin-4-yl)quinazoline-2,4-diamine Investigative
Synonyms
CHEMBL4086403; SCHEMBL23260478; MS012; BDBM50501525; MS 012; MS-012; N~2~-hexyl-6,7-dimethoxy-N~4~-(1-methylpiperidin-4-yl)quinazoline-2,4-diamine; 2089617-83-2
    Click to Show/Hide
External link
CID: 137348638
Activity
IC50=7±2 nM
 [638]
Compound Name 6,7-Dimethoxy-N-(1-Methylpiperidin-4-Yl)-2-(Morpholin-4-Yl)quinazolin-4-Amine Investigative
Synonyms
CHEMBL571717; 6,7-Dimethoxy-N-(1-Methylpiperidin-4-Yl)-2-(Morpholin-4-Yl)quinazolin-4-Amine; 7L6; SCHEMBL15280520; BDBM50300032; NCGC00185861-01; 6,7-dimethoxy-N-(1-methylpiperidin-4-yl)-2-morpholinoquinazolin-4-amine
    Click to Show/Hide
External link
CID: 44605026
Activity
IC50=13 ± 4 nM
 [638]
Compound Name Cycloleucine Investigative
Synonyms
1-Aminocyclopentanecarboxylic acid; 52-52-8; 1-Aminocyclopentane-1-carboxylic acid; Cycloleucin; 1-Amino-1-cyclopentanecarboxylic acid; 1-Amino-1-carboxycyclopentane; 1-Amino-cyclopentanecarboxylic acid; CYCLO-LEUCINE; Cyclopentanecarboxylic acid, 1-amino-; NSC 1026; CB 1639; X 201; UNII-0TQU7668EI; 1-Aminocyclopentanecarboxylate; HSDB 5195; WR 14,997; NSC1026; 1-amino cyclopentane carboxylic acid; EINECS 200-144-6; BRN 0636626; aminocyclopentanecarboxylic acid; Cyclopentanecarboxylic acid, 1-amino-, L-; AI3-26442
    Click to Show/Hide
External link
CID: 2901
TTD: D0P0GT
DrugBank: DB04620
Description
METTL3-mediated m6A RNA methylation modulatesuveal melanoma cell proliferation, migration, and invasion by targetingc-Met. Cycloleucine (Cyc) was used to block m6 A methylation in UM cells.
[175]
Compound Name AdoHcy Investigative
Synonyms
S-Adenosyl-L-homocysteine; S-adenosylhomocysteine; S-adenosyl-L-homocysteine; 979-92-0; AdoHcy; S-(5'-adenosyl)-L-homocysteine; adenosylhomocysteine; Formycinylhomocysteine; Adenosyl-L-homocysteine; S-(5'-deoxyadenosin-5'-yl)-L-homocysteine; 2-S-adenosyl-L-homocysteine; 5'-Deoxy-S-adenosyl-L-homocysteine; S-adenosyl-homocysteine; S-Adenosyl Homocysteine; L-S-Adenosylhomocysteine; L-Homocysteine, S-(5'-deoxyadenosin-5'-yl)-; adenosylhomo-cys; adenosyl-homo-cys; UNII-8K31Q2S66S; (S)-5'-(S)-(3-Amino-3-carboxypropyl)-5'-thioadenosine; BRN 5166233; SAH; S-Adenosylhomocysteine; S-Adenosyl-L-Homocysteine
    Click to Show/Hide
External link
CID: 439155
TTD: D09CLP
DrugBank: DB01752
Description
Mettl3 inhibitor, S-adenosylhomocysteine promoted the apoptosis and autophagy of chondrocytes with inflammation in vitro and aggravated the degeneration of chondrocytes and subchondral bone in monosodium iodoacetate (MIA) inducedtemporomandibular joint osteoarthritis mice in vivo. Bcl2 protein interacted with Beclin1 protein in chondrocytes induced by TNF-alpha stimulation. Mettl3 inhibits the apoptosis and autophagy of chondrocytes in inflammation through m6A/Ythdf1/Bcl2 signal axis which provides promising therapeutic strategy fortemporomandibular joint osteoarthritis.
 [10]
References
Ref 1 RNA m6A methyltransferase METTL3 regulates invasiveness of melanoma cells by matrix metallopeptidase 2. Melanoma Res. 2019 Aug;29(4):382-389. doi: 10.1097/CMR.0000000000000580.
Ref 2 METTL3-mediated m6A methylation of ASPM drives hepatocellular carcinoma cells growth and metastasis. J Clin Lab Anal. 2021 Sep;35(9):e23931. doi: 10.1002/jcla.23931. Epub 2021 Aug 16.
Ref 3 METTL3 promotes tumour development by decreasing APC expression mediated by APC mRNA N(6)-methyladenosine-dependent YTHDF binding. Nat Commun. 2021 Jun 21;12(1):3803. doi: 10.1038/s41467-021-23501-5.
Ref 4 The m(6)A methyltransferase METTL3 promotes bladder cancer progression via AFF4/NF-KappaB/MYC signaling network. Oncogene. 2019 May;38(19):3667-3680. doi: 10.1038/s41388-019-0683-z. Epub 2019 Jan 18.
Ref 5 The m(6)A Methylation-Regulated AFF4 Promotes Self-Renewal of Bladder Cancer Stem Cells. Stem Cells Int. 2020 Jul 2;2020:8849218. doi: 10.1155/2020/8849218. eCollection 2020.
Ref 6 Deficiency of Mettl3 in Bladder Cancer Stem Cells Inhibits Bladder Cancer Progression and Angiogenesis. Front Cell Dev Biol. 2021 Feb 18;9:627706. doi: 10.3389/fcell.2021.627706. eCollection 2021.
Ref 7 Knockdown of METTL3 inhibits enterovirus 71-induced apoptosis of mouse Schwann cell through regulation of autophagy. Pathog Dis. 2021 Jul 28;79(6):ftab036. doi: 10.1093/femspd/ftab036.
Ref 8 METTL3 Promotes the Proliferation and Mobility of Gastric Cancer Cells. Open Med (Wars). 2019 Mar 2;14:25-31. doi: 10.1515/med-2019-0005. eCollection 2019.
Ref 9 The N(6)-methyladenosine (m(6)A)-forming enzyme METTL3 controls myeloid differentiation of normal hematopoietic and leukemia cells. Nat Med. 2017 Nov;23(11):1369-1376. doi: 10.1038/nm.4416. Epub 2017 Sep 18.
Ref 10 Mettl3 inhibits the apoptosis and autophagy of chondrocytes in inflammation through mediating Bcl2 stability via Ythdf1-mediated m(6)A modification. Bone. 2022 Jan;154:116182. doi: 10.1016/j.bone.2021.116182. Epub 2021 Sep 13.
Ref 11 METTL3?mediated m6A modification of Bcl?2 mRNA promotes non?small cell lung cancer progression. Oncol Rep. 2021 Aug;46(2):163. doi: 10.3892/or.2021.8114. Epub 2021 Jun 16.
Ref 12 N6-methyladenosine METTL3 promotes the breast cancer progression via targeting Bcl-2. Gene. 2020 Jan 5;722:144076. doi: 10.1016/j.gene.2019.144076. Epub 2019 Aug 24.
Ref 13 DARS-AS1 recruits METTL3/METTL14 to bind and enhance DARS mRNA m(6)A modification and translation for cytoprotective autophagy in cervical cancer. RNA Biol. 2022 Jan;19(1):751-763. doi: 10.1080/15476286.2022.2079889.
Ref 14 TRIM11 facilitates chemoresistance in nasopharyngeal carcinoma by activating the Beta-catenin/ABCC9 axis via p62-selective autophagic degradation of Daple. Oncogenesis. 2020 May 7;9(5):45. doi: 10.1038/s41389-020-0229-9.
Ref 15 The RNA N6-Methyladenosine Methyltransferase METTL3 Promotes the Progression of Kidney Cancer via N6-Methyladenosine-Dependent Translational Enhancement of ABCD1. Front Cell Dev Biol. 2021 Sep 23;9:737498. doi: 10.3389/fcell.2021.737498. eCollection 2021.
Ref 16 Silencing METTL3 inhibits the proliferation and invasion of osteosarcoma by regulating ATAD2. Biomed Pharmacother. 2020 May;125:109964. doi: 10.1016/j.biopha.2020.109964. Epub 2020 Feb 7.
Ref 17 RNA N6-methyladenosine: a new player in autophagy-mediated anti-cancer drug resistance. Br J Cancer. 2021 May;124(10):1621-1622. doi: 10.1038/s41416-021-01314-z. Epub 2021 Mar 15.
Ref 18 The mechanism of m(6)A methyltransferase METTL3-mediated autophagy in reversing gefitinib resistance in NSCLC cells by Beta-elemene. Cell Death Dis. 2020 Nov 11;11(11):969. doi: 10.1038/s41419-020-03148-8.
Ref 19 The m6A methyltransferase METTL3 regulates autophagy and sensitivity to cisplatin by targeting ATG5 in seminoma. Transl Androl Urol. 2021 Apr;10(4):1711-1722. doi: 10.21037/tau-20-1411.
Ref 20 m(6)A modification-mediated BATF2 acts as a tumor suppressor in gastric cancer through inhibition of ERK signaling. Mol Cancer. 2020 Jul 10;19(1):114. doi: 10.1186/s12943-020-01223-4.
Ref 21 Molecular mechanism of m(6)A methylation of circDLC1 mediated by RNA methyltransferase METTL3 in the malignant proliferation of glioma cells. Cell Death Discov. 2022 Apr 26;8(1):229. doi: 10.1038/s41420-022-00979-6.
Ref 22 METTL3 promotes adriamycin resistance in MCF-7 breast cancer cells by accelerating pri-microRNA-221-3p maturation in a m6A-dependent manner. Exp Mol Med. 2021 Jan;53(1):91-102. doi: 10.1038/s12276-020-00510-w. Epub 2021 Jan 8.
Ref 23 N6-Methyladenosine Modification of CDH1 mRNA Promotes PM2.5-Induced Pulmonary Fibrosis via Mediating Epithelial Mesenchymal Transition. Toxicol Sci. 2022 Jan 24;185(2):143-157. doi: 10.1093/toxsci/kfab133.
Ref 24 Upregulated METTL3 in nasopharyngeal carcinoma enhances the motility of cancer cells. Kaohsiung J Med Sci. 2020 Nov;36(11):895-903. doi: 10.1002/kjm2.12266. Epub 2020 Jul 15.
Ref 25 m(6)A mRNA methylation regulates CTNNB1 to promote the proliferation of hepatoblastoma. Mol Cancer. 2019 Dec 23;18(1):188. doi: 10.1186/s12943-019-1119-7.
Ref 26 Ethionine-mediated reduction of S-adenosylmethionine is responsible for the neural tube defects in the developing mouse embryo-mediated m6A modification and is involved in neural tube defects via modulating Wnt/Beta-catenin signaling pathway. Epigenetics Chromatin. 2021 Dec 4;14(1):52. doi: 10.1186/s13072-021-00426-3.
Ref 27 N(6)-methyladenosine mediates arsenite-induced human keratinocyte transformation by suppressing p53 activation. Environ Pollut. 2020 Apr;259:113908. doi: 10.1016/j.envpol.2019.113908. Epub 2020 Jan 7.
Ref 28 The m(6)A RNA methyltransferase METTL3/METTL14 promotes leukemogenesis through the mdm2/p53 pathway in acute myeloid leukemia. J Cancer. 2022 Jan 4;13(3):1019-1030. doi: 10.7150/jca.60381. eCollection 2022.
Ref 29 An N(6)-methyladenosine at the transited codon 273 of p53 pre-mRNA promotes the expression of R273H mutant protein and drug resistance of cancer cells. Biochem Pharmacol. 2019 Feb;160:134-145. doi: 10.1016/j.bcp.2018.12.014. Epub 2018 Dec 19.
Ref 30 p53 m(6)A modulation sensitizes hepatocellular carcinoma to apatinib through apoptosis. Apoptosis. 2022 Jun;27(5-6):426-440. doi: 10.1007/s10495-022-01728-x. Epub 2022 May 3.
Ref 31 Reduced Expression of METTL3 Promotes Metastasis of Triple-Negative Breast Cancer by m6A Methylation-Mediated COL3A1 Up-Regulation. Front Oncol. 2020 Jul 14;10:1126. doi: 10.3389/fonc.2020.01126. eCollection 2020.
Ref 32 METTL3 promotes experimental osteoarthritis development by regulating inflammatory response and apoptosis in chondrocyte. Biochem Biophys Res Commun. 2019 Aug 13;516(1):22-27. doi: 10.1016/j.bbrc.2019.05.168. Epub 2019 Jun 8.
Ref 33 METTL3 involves the progression of osteoarthritis probably by affecting ECM degradation and regulating the inflammatory response. Life Sci. 2021 Aug 1;278:119528. doi: 10.1016/j.lfs.2021.119528. Epub 2021 Apr 21.
Ref 34 Dynamic m(6)A mRNA methylation reveals the role of METTL3-m(6)A-CDCP1 signaling axis in chemical carcinogenesis. Oncogene. 2019 Jun;38(24):4755-4772. doi: 10.1038/s41388-019-0755-0. Epub 2019 Feb 22.
Ref 35 Programmable N6-methyladenosine modification of CDCP1 mRNA by RCas9-methyltransferase like 3 conjugates promotes bladder cancer development. Mol Cancer. 2020 Dec 3;19(1):169. doi: 10.1186/s12943-020-01289-0.
Ref 36 The M6A methyltransferase METTL3 regulates proliferation in esophageal squamous cell carcinoma. Biochem Biophys Res Commun. 2021 Nov 26;580:48-55. doi: 10.1016/j.bbrc.2021.05.048. Epub 2021 Oct 5.
Ref 37 Metformin exhibits antiproliferation activity in breast cancer via miR-483-3p/METTL3/m(6)A/p21 pathway. Oncogenesis. 2021 Jan 5;10(1):7. doi: 10.1038/s41389-020-00290-y.
Ref 38 METTL3 contributes to renal ischemia-reperfusion injury by regulating Foxd1 methylation. Am J Physiol Renal Physiol. 2020 Nov 1;319(5):F839-F847. doi: 10.1152/ajprenal.00222.2020. Epub 2020 Sep 21.
Ref 39 Cigarette smoking induces aberrant N(6)-methyladenosine of DAPK2 to promote non-small cell lung cancer progression by activating NF-KappaB pathway. Cancer Lett. 2021 Oct 10;518:214-229. doi: 10.1016/j.canlet.2021.07.022. Epub 2021 Jul 21.
Ref 40 m6A-dependent up-regulation of DRG1 by METTL3 and ELAVL1 promotes growth, migration, and colony formation in osteosarcoma. Biosci Rep. 2020 Apr 30;40(4):BSR20200282. doi: 10.1042/BSR20200282.
Ref 41 RNA m(6)A methylation regulates the ultraviolet-induced DNA damage response. Nature. 2017 Mar 23;543(7646):573-576. doi: 10.1038/nature21671. Epub 2017 Mar 15.
Ref 42 METTL3 Promotes the Progression of Gastric Cancer via Targeting the MYC Pathway. Front Oncol. 2020 Feb 26;10:115. doi: 10.3389/fonc.2020.00115. eCollection 2020.
Ref 43 N6-Methyladenosine modification of the TRIM7 positively regulates tumorigenesis and chemoresistance in osteosarcoma through ubiquitination of BRMS1. EBioMedicine. 2020 Sep;59:102955. doi: 10.1016/j.ebiom.2020.102955. Epub 2020 Aug 24.
Ref 44 m(6)A methyltransferase METTL3 promotes retinoblastoma progression via PI3K/AKT/mTOR pathway. J Cell Mol Med. 2020 Oct 8;24(21):12368-78. doi: 10.1111/jcmm.15736. Online ahead of print.
Ref 45 METTL3 mediates osteoblast apoptosis by regulating endoplasmic reticulum stress during LPS-induced inflammation. Cell Signal. 2022 Jul;95:110335. doi: 10.1016/j.cellsig.2022.110335. Epub 2022 Apr 21.
Ref 46 m6A methylated EphA2 and VEGFA through IGF2BP2/3 regulation promotes vasculogenic mimicry in colorectal cancer via PI3K/AKT and ERK1/2 signaling. Cell Death Dis. 2022 May 21;13(5):483. doi: 10.1038/s41419-022-04950-2.
Ref 47 LCAT3, a novel m6A-regulated long non-coding RNA, plays an oncogenic role in lung cancer via binding with FUBP1 to activate c-MYC. J Hematol Oncol. 2021 Jul 17;14(1):112. doi: 10.1186/s13045-021-01123-0.
Ref 48 METTL3 inhibits hepatic insulin sensitivity via N6-methyladenosine modification of Fasn mRNA and promoting fatty acid metabolism. Biochem Biophys Res Commun. 2019 Oct 8;518(1):120-126. doi: 10.1016/j.bbrc.2019.08.018. Epub 2019 Aug 10.
Ref 49 Methyltransferase like 3 promotes colorectal cancer proliferation by stabilizing CCNE1 mRNA in an m6A-dependent manner. J Cell Mol Med. 2020 Mar;24(6):3521-3533. doi: 10.1111/jcmm.15042. Epub 2020 Feb 10.
Ref 50 CircMEG3 inhibits telomerase activity by reducing Cbf5 in human liver cancer stem cells. Mol Ther Nucleic Acids. 2020 Nov 17;23:310-323. doi: 10.1016/j.omtn.2020.11.009. eCollection 2021 Mar 5.
Ref 51 m6A RNA Methylation Controls Proliferation of Human Glioma Cells by Influencing Cell Apoptosis. Cytogenet Genome Res. 2019;159(3):119-125. doi: 10.1159/000499062. Epub 2019 Oct 23.
Ref 52 Progression of Thyroid Carcinoma Is Promoted by the m6A Methyltransferase METTL3 Through Regulating m(6)A Methylation on TCF1. Onco Targets Ther. 2020 Feb 21;13:1605-1612. doi: 10.2147/OTT.S234751. eCollection 2020.
Ref 53 METTL3-mediated m(6)A modification of HDGF mRNA promotes gastric cancer progression and has prognostic significance. Gut. 2020 Jul;69(7):1193-1205. doi: 10.1136/gutjnl-2019-319639. Epub 2019 Oct 3.
Ref 54 m(6)A-dependent glycolysis enhances colorectal cancer progression. Mol Cancer. 2020 Apr 3;19(1):72. doi: 10.1186/s12943-020-01190-w.
Ref 55 N(6)-methyladenosine METTL3 promotes cervical cancer tumorigenesis and Warburg effect through YTHDF1/HK2 modification. Cell Death Dis. 2020 Oct 24;11(10):911. doi: 10.1038/s41419-020-03071-y.
Ref 56 m6A modification of circHPS5 and hepatocellular carcinoma progression through HMGA2 expression. Mol Ther Nucleic Acids. 2021 Sep 14;26:637-648. doi: 10.1016/j.omtn.2021.09.001. eCollection 2021 Dec 3.
Ref 57 The m6A methyltransferase METTL3 controls epithelial-mesenchymal transition, migration and invasion of breast cancer through the MALAT1/miR-26b/HMGA2 axis. Cancer Cell Int. 2021 Aug 21;21(1):441. doi: 10.1186/s12935-021-02113-5.
Ref 58 METTL3 promotes the progression of nasopharyngeal carcinoma through mediating M6A modification of EZH2. Eur Rev Med Pharmacol Sci. 2020 Apr;24(8):4328-4336. doi: 10.26355/eurrev_202004_21014.
Ref 59 Simvastatin is beneficial to lung cancer progression by inducing METTL3-induced m6A modification on EZH2 mRNA. Eur Rev Med Pharmacol Sci. 2020 Apr;24(8):4263-4270. doi: 10.26355/eurrev_202004_21006.
Ref 60 METTL3 Accelerates Breast Cancer Progression via Regulating EZH2 m(6)A Modification. J Healthc Eng. 2022 Mar 29;2022:5794422. doi: 10.1155/2022/5794422. eCollection 2022.
Ref 61 METTL3 promotes inflammation and cell apoptosis in a pediatric pneumonia model by regulating EZH2. Allergol Immunopathol (Madr). 2021 Sep 1;49(5):49-56. doi: 10.15586/aei.v49i5.445. eCollection 2021.
Ref 62 YTHDF2 mediates the mRNA degradation of the tumor suppressors to induce AKT phosphorylation in N6-methyladenosine-dependent way in prostate cancer. Mol Cancer. 2020 Oct 29;19(1):152. doi: 10.1186/s12943-020-01267-6.
Ref 63 Cap-independent mRNA translation is upregulated in long-lived endocrine mutant mice. J Mol Endocrinol. 2019 Aug 1;63(2):123-138. doi: 10.1530/JME-19-0021.
Ref 64 Long Noncoding RNA FAM225A Promotes Nasopharyngeal Carcinoma Tumorigenesis and Metastasis by Acting as ceRNA to Sponge miR-590-3p/miR-1275 and Upregulate ITGB3. Cancer Res. 2019 Sep 15;79(18):4612-4626. doi: 10.1158/0008-5472.CAN-19-0799. Epub 2019 Jul 22.
Ref 65 METTL3-mediated M6A methylation modification is involved in colistin-induced nephrotoxicity through apoptosis mediated by Keap1/Nrf2 signaling pathway. Toxicology. 2021 Oct;462:152961. doi: 10.1016/j.tox.2021.152961. Epub 2021 Sep 21.
Ref 66 METTL3/IGF2BP1/CD47 contributes to the sublethal heat treatment induced mesenchymal transition in HCC. Biochem Biophys Res Commun. 2021 Mar 26;546:169-177. doi: 10.1016/j.bbrc.2021.01.085. Epub 2021 Feb 12.
Ref 67 Dynamic m(6)A mRNA Methylation Reveals the Role of METTL3/14-m(6)A-MNK2-ERK Signaling Axis in Skeletal Muscle Differentiation and Regeneration. Front Cell Dev Biol. 2021 Oct 1;9:744171. doi: 10.3389/fcell.2021.744171. eCollection 2021.
Ref 68 METTL3-mediated m(6)A modification of TIMP2 mRNA promotes podocyte injury in diabetic nephropathy. Mol Ther. 2022 Apr 6;30(4):1721-1740. doi: 10.1016/j.ymthe.2022.01.002. Epub 2022 Jan 4.
Ref 69 METTL3 Promotes the Resistance of Glioma to Temozolomide via Increasing MGMT and ANPG in a m(6)A Dependent Manner. Front Oncol. 2021 Jul 15;11:702983. doi: 10.3389/fonc.2021.702983. eCollection 2021.
Ref 70 Methyltransferase-like 3 contributes to inflammatory pain by targeting TET1 in YTHDF2-dependent manner. Pain. 2021 Jul 1;162(7):1960-1976. doi: 10.1097/j.pain.0000000000002218.
Ref 71 Methyltransferase-like 3-induced N6-methyladenosine upregulation promotes oral squamous cell carcinoma by through p38. Oral Dis. 2021 Sep 3. doi: 10.1111/odi.14016. Online ahead of print.
Ref 72 m(6)A methyltransferase METTL3 suppresses colorectal cancer proliferation and migration through p38/ERK pathways. Onco Targets Ther. 2019 Jun 4;12:4391-4402. doi: 10.2147/OTT.S201052. eCollection 2019.
Ref 73 Dysregulation of LINC00470 and METTL3 promotes chemoresistance and suppresses autophagy of chronic myelocytic leukaemia cells. J Cell Mol Med. 2021 May;25(9):4248-4259. doi: 10.1111/jcmm.16478. Epub 2021 Mar 21.
Ref 74 Beta-Elemene Restrains PTEN mRNA Degradation to Restrain the Growth of Lung Cancer Cells via METTL3-Mediated N(6) Methyladenosine Modification. J Oncol. 2022 Jan 12;2022:3472745. doi: 10.1155/2022/3472745. eCollection 2022.
Ref 75 The m(6)A methyltransferase METTL3 promotes hypoxic pulmonary arterial hypertension. Life Sci. 2021 Jun 1;274:119366. doi: 10.1016/j.lfs.2021.119366. Epub 2021 Mar 16.
Ref 76 [Methyltransferase-like 3 Promotes the Proliferation of Acute Myeloid Leukemia Cells by Regulating N6-methyladenosine Levels of MYC]. Zhongguo Yi Xue Ke Xue Yuan Xue Bao. 2018 Jun 28;40(3):308-314. doi: 10.3881/j.issn.1000-503X.2018.03.002.
Ref 77 METTL3 Facilitates Oral Squamous Cell Carcinoma Tumorigenesis by Enhancing c-Myc Stability via YTHDF1-Mediated m(6)A Modification. Mol Ther Nucleic Acids. 2020 Jun 5;20:1-12. doi: 10.1016/j.omtn.2020.01.033. Epub 2020 Feb 4.
Ref 78 HBXIP promotes gastric cancer via METTL3-mediated MYC mRNA m6A modification. Aging (Albany NY). 2020 Oct 13;12(24):24967-24982. doi: 10.18632/aging.103767. Epub 2020 Oct 13.
Ref 79 N6-methyladenosine methyltransferase METTL3 promotes colorectal cancer cell proliferation through enhancing MYC expression. Am J Transl Res. 2020 May 15;12(5):1789-1806. eCollection 2020.
Ref 80 Correlation of m6A methylation with immune infiltrates and poor prognosis in non-small cell lung cancer via a comprehensive analysis of RNA expression profiles. Ann Transl Med. 2021 Sep;9(18):1465. doi: 10.21037/atm-21-4248.
Ref 81 The M6A methyltransferase METTL3 promotes the development and progression of prostate carcinoma via mediating MYC methylation. J Cancer. 2020 Mar 25;11(12):3588-3595. doi: 10.7150/jca.42338. eCollection 2020.
Ref 82 A methionine-Mettl3-N(6)-methyladenosine axis promotes polycystic kidney disease. Cell Metab. 2021 Jun 1;33(6):1234-1247.e7. doi: 10.1016/j.cmet.2021.03.024. Epub 2021 Apr 13.
Ref 83 METTL3 regulates alternative splicing of MyD88 upon the lipopolysaccharide-induced inflammatory response in human dental pulp cells. J Cell Mol Med. 2018 May;22(5):2558-2568. doi: 10.1111/jcmm.13491. Epub 2018 Mar 4.
Ref 84 The m6A methyltransferase METTL3 cooperates with demethylase ALKBH5 to regulate osteogenic differentiation through NF-KappaB signaling. Mol Cell Biochem. 2020 Jan;463(1-2):203-210. doi: 10.1007/s11010-019-03641-5. Epub 2019 Oct 23.
Ref 85 METTL3-dependent N(6)-methyladenosine RNA modification mediates the atherogenic inflammatory cascades in vascular endothelium. Proc Natl Acad Sci U S A. 2021 Feb 16;118(7):e2025070118. doi: 10.1073/pnas.2025070118.
Ref 86 Total Flavones of Abelmoschus manihot Ameliorates Podocyte Pyroptosis and Injury in High Glucose Conditions by Targeting METTL3-Dependent m(6)A Modification-Mediated NLRP3-Inflammasome Activation and PTEN/PI3K/Akt Signaling. Front Pharmacol. 2021 Jul 15;12:667644. doi: 10.3389/fphar.2021.667644. eCollection 2021.
Ref 87 METTL3-Mediated m(6)A RNA Modification Regulates Corneal Injury Repair. Stem Cells Int. 2021 Oct 22;2021:5512153. doi: 10.1155/2021/5512153. eCollection 2021.
Ref 88 N6?methyladenosine upregulates miR?181d?5p in exosomes derived from cancer?associated fibroblasts to inhibit 5?FU sensitivity by targeting NCALD in colorectal cancer. Int J Oncol. 2022 Feb;60(2):14. doi: 10.3892/ijo.2022.5304. Epub 2022 Jan 11.
Ref 89 METTL3-Mediated N6-Methyladenosine Modification Is Involved in the Dysregulation of NRIP1 Expression in Down Syndrome. Front Cell Dev Biol. 2021 Apr 1;9:621374. doi: 10.3389/fcell.2021.621374. eCollection 2021.
Ref 90 Mettl3-mediated m(6)A RNA methylation regulates the fate of bone marrow mesenchymal stem cells and osteoporosis. Nat Commun. 2018 Nov 14;9(1):4772. doi: 10.1038/s41467-018-06898-4.
Ref 91 MTTL3 upregulates microRNA-1246 to promote occurrence and progression of NSCLC via targeting paternally expressed gene 3. Mol Ther Nucleic Acids. 2021 Feb 24;24:542-553. doi: 10.1016/j.omtn.2021.02.020. eCollection 2021 Jun 4.
Ref 92 Circadian Clock Regulation of Hepatic Lipid Metabolism by Modulation of m(6)A mRNA Methylation. Cell Rep. 2018 Nov 13;25(7):1816-1828.e4. doi: 10.1016/j.celrep.2018.10.068.
Ref 93 New insight into the catalytic -dependent and -independent roles of METTL3 in sustaining aberrant translation in chronic myeloid leukemia. Cell Death Dis. 2021 Sep 24;12(10):870. doi: 10.1038/s41419-021-04169-7.
Ref 94 m(6)A mRNA methylation regulates AKT activity to promote the proliferation and tumorigenicity of endometrial cancer. Nat Cell Biol. 2018 Sep;20(9):1074-1083. doi: 10.1038/s41556-018-0174-4. Epub 2018 Aug 27.
Ref 95 The m6A Methyltransferase METTL3 Is Functionally Implicated in DLBCL Development by Regulating m6A Modification in PEDF. Front Genet. 2020 Aug 27;11:955. doi: 10.3389/fgene.2020.00955. eCollection 2020.
Ref 96 METTL3-mediated N (6)-methyladenosine modification governs pericyte dysfunction during diabetes-induced retinal vascular complication. Theranostics. 2022 Jan 1;12(1):277-289. doi: 10.7150/thno.63441. eCollection 2022.
Ref 97 m(6)A modification regulates lung fibroblast-to-myofibroblast transition through modulating KCNH6 mRNA translation. Mol Ther. 2021 Dec 1;29(12):3436-3448. doi: 10.1016/j.ymthe.2021.06.008. Epub 2021 Jun 8.
Ref 98 METTL3 promotes homologous recombination repair and modulates chemotherapeutic response in breast cancer by regulating the EGF/RAD51 axis. Elife. 2022 May 3;11:e75231. doi: 10.7554/eLife.75231.
Ref 99 METTL3 Intensifies the Progress of Oral Squamous Cell Carcinoma via Modulating the m6A Amount of PRMT5 and PD-L1. J Immunol Res. 2021 Aug 23;2021:6149558. doi: 10.1155/2021/6149558. eCollection 2021.
Ref 100 METTL3/IGF2BP3 axis inhibits tumor immune surveillance by upregulating N(6)-methyladenosine modification of PD-L1 mRNA in breast cancer. Mol Cancer. 2022 Feb 23;21(1):60. doi: 10.1186/s12943-021-01447-y.
Ref 101 JNK Signaling Promotes Bladder Cancer Immune Escape by Regulating METTL3-Mediated m6A Modification of PD-L1 mRNA. Cancer Res. 2022 May 3;82(9):1789-1802. doi: 10.1158/0008-5472.CAN-21-1323.
Ref 102 MicroRNA-1915-3p inhibits cell migration and invasion by targeting SET in non-small-cell lung cancer. BMC Cancer. 2021 Nov 13;21(1):1218. doi: 10.1186/s12885-021-08961-8.
Ref 103 METTL3 restrains papillary thyroid cancer progression via m(6)A/c-Rel/IL-8-mediated neutrophil infiltration. Mol Ther. 2021 May 5;29(5):1821-1837. doi: 10.1016/j.ymthe.2021.01.019. Epub 2021 Jan 21.
Ref 104 N(6)-methyladenosine regulates glycolysis of cancer cells through PDK4. Nat Commun. 2020 May 22;11(1):2578. doi: 10.1038/s41467-020-16306-5.
Ref 105 N (6)-Methyladenosine modification of hepatitis B and C viral RNAs attenuates host innate immunity via RIG-I signaling. J Biol Chem. 2020 Sep 11;295(37):13123-13133. doi: 10.1074/jbc.RA120.014260. Epub 2020 Jul 27.
Ref 106 METTL3 regulates viral m6A RNA modification and host cell innate immune responses during SARS-CoV-2 infection. Cell Rep. 2021 May 11;35(6):109091. doi: 10.1016/j.celrep.2021.109091. Epub 2021 May 3.
Ref 107 METTL3-Induced miR-222-3p Upregulation Inhibits STK4 and Promotes the Malignant Behaviors of Thyroid Carcinoma Cells. J Clin Endocrinol Metab. 2022 Jan 18;107(2):474-490. doi: 10.1210/clinem/dgab480.
Ref 108 Methyltransferase-like 3 promotes the progression of lung cancer via activating PI3K/AKT/mTOR pathway. Clin Exp Pharmacol Physiol. 2022 Jul;49(7):748-758. doi: 10.1111/1440-1681.13647. Epub 2022 May 23.
Ref 109 The M6A methyltransferase METTL3: acting as a tumor suppressor in renal cell carcinoma. Oncotarget. 2017 Oct 10;8(56):96103-96116. doi: 10.18632/oncotarget.21726. eCollection 2017 Nov 10.
Ref 110 m(6)A mRNA methylation-directed myeloid cell activation controls progression of NAFLD and obesity. Cell Rep. 2021 Nov 9;37(6):109968. doi: 10.1016/j.celrep.2021.109968.
Ref 111 Long noncoding RNA SNHG4 remits lipopolysaccharide-engendered inflammatory lung damage by inhibiting METTL3 - Mediated m(6)A level of STAT2 mRNA. Mol Immunol. 2021 Nov;139:10-22. doi: 10.1016/j.molimm.2021.08.008. Epub 2021 Aug 25.
Ref 112 Dysregulated m6A modification promotes lipogenesis and development of non-alcoholic fatty liver disease and hepatocellular carcinoma. Mol Ther. 2022 Jun 1;30(6):2342-2353. doi: 10.1016/j.ymthe.2022.02.021. Epub 2022 Feb 19.
Ref 113 Tumor-Associated Macrophages Promote Oxaliplatin Resistance via METTL3-Mediated m(6)A of TRAF5 and Necroptosis in Colorectal Cancer. Mol Pharm. 2021 Mar 1;18(3):1026-1037. doi: 10.1021/acs.molpharmaceut.0c00961. Epub 2021 Feb 8.
Ref 114 m6A-dependent upregulation of TRAF6 by METTL3 is associated with metastatic osteosarcoma. J Bone Oncol. 2022 Jan 19;32:100411. doi: 10.1016/j.jbo.2022.100411. eCollection 2022 Feb.
Ref 115 METTL3 potentiates resistance to cisplatin through m(6) A modification of TFAP2C in seminoma. J Cell Mol Med. 2020 Oct;24(19):11366-11380. doi: 10.1111/jcmm.15738. Epub 2020 Aug 28.
Ref 116 Effect of m6A methyltransferase METTL3 -mediated MALAT1/E2F1/AGR2 axis on adriamycin resistance in breast cancer. J Biochem Mol Toxicol. 2022 Jan;36(1):e22922. doi: 10.1002/jbt.22922. Epub 2021 Dec 28.
Ref 117 METTL3 and ALKBH5 oppositely regulate m(6)A modification of TFEB mRNA, which dictates the fate of hypoxia/reoxygenation-treated cardiomyocytes. Autophagy. 2019 Aug;15(8):1419-1437. doi: 10.1080/15548627.2019.1586246. Epub 2019 Mar 17.
Ref 118 m(6) A RNA methyltransferases METTL3/14 regulate immune responses to anti-PD-1 therapy. EMBO J. 2020 Oct 15;39(20):e104514. doi: 10.15252/embj.2020104514. Epub 2020 Sep 23.
Ref 119 The m6A methyltransferase METTL3 contributes to Transforming Growth Factor-beta-induced epithelial-mesenchymal transition of lung cancer cells through the regulation of JUNB. Biochem Biophys Res Commun. 2020 Mar 26;524(1):150-155. doi: 10.1016/j.bbrc.2020.01.042. Epub 2020 Jan 22.
Ref 120 Essential role of METTL3-mediated m(6)A modification in glioma stem-like cells maintenance and radioresistance. Oncogene. 2018 Jan 25;37(4):522-533. doi: 10.1038/onc.2017.351. Epub 2017 Oct 9.
Ref 121 METTL3 facilitates tumor progression via an m(6)A-IGF2BP2-dependent mechanism in colorectal carcinoma. Mol Cancer. 2019 Jun 24;18(1):112. doi: 10.1186/s12943-019-1038-7.
Ref 122 The m6A methyltransferase METTL3 promotes the stemness and malignant progression of breast cancer by mediating m6A modification on SOX2. J BUON. 2021 Mar-Apr;26(2):444-449.
Ref 123 m6A Methyltransferase 3 Promotes the Proliferation and Migration of Gastric Cancer Cells through the m6A Modification of YAP1. J Oncol. 2021 Aug 4;2021:8875424. doi: 10.1155/2021/8875424. eCollection 2021.
Ref 124 N6-methyladenosine-induced circ1662 promotes metastasis of colorectal cancer by accelerating YAP1 nuclear localization. Theranostics. 2021 Feb 25;11(9):4298-4315. doi: 10.7150/thno.51342. eCollection 2021.
Ref 125 RNA m6A methylation promotes the formation of vasculogenic mimicry in hepatocellular carcinoma via Hippo pathway. Angiogenesis. 2021 Feb;24(1):83-96. doi: 10.1007/s10456-020-09744-8. Epub 2020 Sep 13.
Ref 126 m(6)A mRNA methylation initiated by METTL3 directly promotes YAP translation and increases YAP activity by regulating the MALAT1-miR-1914-3p-YAP axis to induce NSCLC drug resistance and metastasis. J Hematol Oncol. 2019 Dec 9;12(1):135. doi: 10.1186/s13045-019-0830-6.
Ref 127 MiR-4429 prevented gastric cancer progression through targeting METTL3 to inhibit m(6)A-caused stabilization of SEC62. Biochem Biophys Res Commun. 2019 Oct 1;517(4):581-587. doi: 10.1016/j.bbrc.2019.07.058. Epub 2019 Aug 5.
Ref 128 Sec62 promotes stemness and chemoresistance of human colorectal cancer through activating Wnt/Beta-catenin pathway. J Exp Clin Cancer Res. 2021 Apr 15;40(1):132. doi: 10.1186/s13046-021-01934-6.
Ref 129 METTL3 mediated m(6)A modification plays an oncogenic role in cutaneous squamous cell carcinoma by regulating DeltaNp63. Biochem Biophys Res Commun. 2019 Jul 23;515(2):310-317. doi: 10.1016/j.bbrc.2019.05.155. Epub 2019 May 29.
Ref 130 N6-Methyladenosine Methyltransferase METTL3 Promotes Angiogenesis and Atherosclerosis by Upregulating the JAK2/STAT3 Pathway via m6A Reader IGF2BP1. Front Cell Dev Biol. 2021 Dec 7;9:731810. doi: 10.3389/fcell.2021.731810. eCollection 2021.
Ref 131 METTL3-mediated m(6)A modification of ATG7 regulates autophagy-GATA4 axis to promote cellular senescence and osteoarthritis progression. Ann Rheum Dis. 2022 Jan;81(1):87-99. doi: 10.1136/annrheumdis-2021-221091. Epub 2021 Oct 27.
Ref 132 METTL3-mediated m(6)A modification of ZBTB4 mRNA is involved in the smoking-induced EMT in cancer of the lung. Mol Ther Nucleic Acids. 2020 Dec 10;23:487-500. doi: 10.1016/j.omtn.2020.12.001. eCollection 2021 Mar 5.
Ref 133 METTL3-mediated N6-methyladenosine modification is critical for epithelial-mesenchymal transition and metastasis of gastric cancer. Mol Cancer. 2019 Oct 13;18(1):142. doi: 10.1186/s12943-019-1065-4.
Ref 134 m(6)A-mediated ZNF750 repression facilitates nasopharyngeal carcinoma progression. Cell Death Dis. 2018 Dec 5;9(12):1169. doi: 10.1038/s41419-018-1224-3.
Ref 135 RNA m(6)A Methyltransferase METTL3 Promotes The Growth Of Prostate Cancer By Regulating Hedgehog Pathway. Onco Targets Ther. 2019 Nov 5;12:9143-9152. doi: 10.2147/OTT.S226796. eCollection 2019.
Ref 136 m(6)A methyltransferase METTL3-mediated lncRNA FOXD2-AS1 promotes the tumorigenesis of cervical cancer. Mol Ther Oncolytics. 2021 Jul 21;22:574-581. doi: 10.1016/j.omto.2021.07.004. eCollection 2021 Sep 24.
Ref 137 N(6) -Methyladenosine Regulates mRNA Stability and Translation Efficiency of KRT7 to Promote Breast Cancer Lung Metastasis. Cancer Res. 2021 Jun 1;81(11):2847-2860. doi: 10.1158/0008-5472.CAN-20-3779. Epub 2021 Apr 1.
Ref 138 LncRNA LBX2-AS1 promotes colorectal cancer progression and 5-fluorouracil resistance. Cancer Cell Int. 2021 Sep 17;21(1):501. doi: 10.1186/s12935-021-02209-y.
Ref 139 LNCAROD is stabilized by m6A methylation and promotes cancer progression via forming a ternary complex with HSPA1A and YBX1 in head and neck squamous cell carcinoma. Mol Oncol. 2020 Jun;14(6):1282-1296. doi: 10.1002/1878-0261.12676. Epub 2020 Apr 13.
Ref 140 Methyltransferase 3, N6-adenosine-methyltransferase complex catalytic subunit-induced long intergenic non-protein coding RNA 1833 N6-methyladenosine methylation promotes the non-small cell lung cancer progression via regulating heterogeneous nuclear ribonucleoprotein A2/B1 expression. Bioengineered. 2022 Apr;13(4):10493-10503. doi: 10.1080/21655979.2022.2061305.
Ref 141 M6A-mediated upregulation of LINC00958 increases lipogenesis and acts as a nanotherapeutic target in hepatocellular carcinoma. J Hematol Oncol. 2020 Jan 8;13(1):5. doi: 10.1186/s13045-019-0839-x.
Ref 142 m(6)A-induced LINC00958 promotes breast cancer tumorigenesis via the miR-378a-3p/YY1 axis. Cell Death Discov. 2021 Feb 2;7(1):27. doi: 10.1038/s41420-020-00382-z.
Ref 143 METTL3 enhances the stability of MALAT1 with the assistance of HuR via m6A modification and activates NF-KappaB to promote the malignant progression of IDH-wildtype glioma. Cancer Lett. 2021 Jul 28;511:36-46. doi: 10.1016/j.canlet.2021.04.020. Epub 2021 Apr 29.
Ref 144 METTL3-dependent MALAT1 delocalization drives c-Myc induction in thymic epithelial tumors. Clin Epigenetics. 2021 Sep 16;13(1):173. doi: 10.1186/s13148-021-01159-6.
Ref 145 m(6)A-induced lncRNA MALAT1 aggravates renal fibrogenesis in obstructive nephropathy through the miR-145/FAK pathway. Aging (Albany NY). 2020 Mar 23;12(6):5280-5299. doi: 10.18632/aging.102950. Epub 2020 Mar 23.
Ref 146 Changes and relationship of N(6)-methyladenosine modification and long non-coding RNAs in oxidative damage induced by cadmium in pancreatic Beta-cells. Toxicol Lett. 2021 Jun 1;343:56-66. doi: 10.1016/j.toxlet.2021.02.014. Epub 2021 Feb 24.
Ref 147 m(6) A modification of lncRNA PCAT6 promotes bone metastasis in prostate cancer through IGF2BP2-mediated IGF1R mRNA stabilization. Clin Transl Med. 2021 Jun;11(6):e426. doi: 10.1002/ctm2.426.
Ref 148 Comprehensive Pan-Cancer Analysis of the Prognostic and Immunological Roles of the METTL3/lncRNA-SNHG1/miRNA-140-3p/UBE2C Axis. Front Cell Dev Biol. 2021 Nov 10;9:765772. doi: 10.3389/fcell.2021.765772. eCollection 2021.
Ref 149 lncRNA THAP7-AS1, transcriptionally activated by SP1 and post-transcriptionally stabilized by METTL3-mediated m6A modification, exerts oncogenic properties by improving CUL4B entry into the nucleus. Cell Death Differ. 2022 Mar;29(3):627-641. doi: 10.1038/s41418-021-00879-9. Epub 2021 Oct 4.
Ref 150 METTL3-Mediated ADAMTS9 Suppression Facilitates Angiogenesis and Carcinogenesis in Gastric Cancer. Front Oncol. 2022 Apr 28;12:861807. doi: 10.3389/fonc.2022.861807. eCollection 2022.
Ref 151 Dysregulated N6-methyladenosine?methylation writer METTL3 contributes to the proliferation and migration of gastric cancer. J Cell Physiol. 2020 Jan;235(1):548-562. doi: 10.1002/jcp.28994. Epub 2019 Jun 24.
Ref 152 Adenylate Kinase 4 Modulates the Resistance of Breast Cancer Cells to Tamoxifen through an m(6)A-Based Epitranscriptomic Mechanism. Mol Ther. 2020 Dec 2;28(12):2593-2604. doi: 10.1016/j.ymthe.2020.09.007. Epub 2020 Sep 5.
Ref 153 The essential roles of m(6)A RNA modification to stimulate ENO1-dependent glycolysis and tumorigenesis in lung adenocarcinoma. J Exp Clin Cancer Res. 2022 Jan 25;41(1):36. doi: 10.1186/s13046-021-02200-5.
Ref 154 Vitamin D3 Suppresses Human Cytomegalovirus-Induced Vascular Endothelial Apoptosis via Rectification of Paradoxical m6A Modification of Mitochondrial Calcium Uniporter mRNA, Which Is Regulated by METTL3 and YTHDF3. Front Microbiol. 2022 Mar 11;13:861734. doi: 10.3389/fmicb.2022.861734. eCollection 2022.
Ref 155 METTL3-m(6)A-Rubicon axis inhibits autophagy in nonalcoholic fatty liver disease. Mol Ther. 2022 Feb 2;30(2):932-946. doi: 10.1016/j.ymthe.2021.09.016. Epub 2021 Sep 20.
Ref 156 METTL3 Regulates Liver Homeostasis, Hepatocyte Ploidy, and Circadian Rhythm-Controlled Gene Expression in Mice. Am J Pathol. 2022 Jan;192(1):56-71. doi: 10.1016/j.ajpath.2021.09.005. Epub 2021 Sep 29.
Ref 157 CircMETTL3, upregulated in a m6A-dependent manner, promotes breast cancer progression. Int J Biol Sci. 2021 Mar 15;17(5):1178-1190. doi: 10.7150/ijbs.57783. eCollection 2021.
Ref 158 The N6-methyladenosine modification enhances ferroptosis resistance through inhibiting SLC7A11 mRNA deadenylation in hepatoblastoma. Clin Transl Med. 2022 May;12(5):e778. doi: 10.1002/ctm2.778.
Ref 159 METTL3 promotes lung adenocarcinoma tumor growth and inhibits ferroptosis by stabilizing SLC7A11 m(6)A modification. Cancer Cell Int. 2022 Jan 7;22(1):11. doi: 10.1186/s12935-021-02433-6.
Ref 160 The aberrant cross-talk of epithelium-macrophages via METTL3-regulated extracellular vesicle miR-93 in smoking-induced emphysema. Cell Biol Toxicol. 2022 Feb;38(1):167-183. doi: 10.1007/s10565-021-09585-1. Epub 2021 Mar 4.
Ref 161 METTL3-mediated N6-methyladenosine modification of DUSP5 mRNA promotes gallbladder-cancer progression. Cancer Gene Ther. 2022 Jul;29(7):1012-1020. doi: 10.1038/s41417-021-00406-5. Epub 2021 Nov 19.
Ref 162 METTL3 Regulates Osteoblast Differentiation and Inflammatory Response via Smad Signaling and MAPK Signaling. Int J Mol Sci. 2019 Dec 27;21(1):199. doi: 10.3390/ijms21010199.
Ref 163 Silencing of METTL3 effectively hinders invasion and metastasis of prostate cancer cells. Theranostics. 2021 Jun 11;11(16):7640-7657. doi: 10.7150/thno.61178. eCollection 2021.
Ref 164 METTL3 induces PLX4032 resistance in melanoma by promoting m(6)A-dependent EGFR translation. Cancer Lett. 2021 Dec 1;522:44-56. doi: 10.1016/j.canlet.2021.09.015. Epub 2021 Sep 13.
Ref 165 METTL3-mediated m(6)A mRNA modification of FBXW7 suppresses lung adenocarcinoma. J Exp Clin Cancer Res. 2021 Mar 6;40(1):90. doi: 10.1186/s13046-021-01880-3.
Ref 166 Circular RNA circNRIP1 plays oncogenic roles in the progression of osteosarcoma. Mamm Genome. 2021 Dec;32(6):448-456. doi: 10.1007/s00335-021-09891-3. Epub 2021 Jul 10.
Ref 167 RNA m(6) A methylation regulates sorafenib resistance in liver cancer through FOXO3-mediated autophagy. EMBO J. 2020 Jun 17;39(12):e103181. doi: 10.15252/embj.2019103181. Epub 2020 May 5.
Ref 168 METTL3 serves an oncogenic role in human ovarian cancer cells partially via the AKT signaling pathway. Oncol Lett. 2020 Apr;19(4):3197-3204. doi: 10.3892/ol.2020.11425. Epub 2020 Mar 3.
Ref 169 N(6)-Methyladenosine Associated Silencing of miR-193b Promotes Cervical Cancer Aggressiveness by Targeting CCND1. Front Oncol. 2021 Jun 10;11:666597. doi: 10.3389/fonc.2021.666597. eCollection 2021.
Ref 170 ZFP217 regulates adipogenesis by controlling mitotic clonal expansion in a METTL3-m(6)A dependent manner. RNA Biol. 2019 Dec;16(12):1785-1793. doi: 10.1080/15476286.2019.1658508. Epub 2019 Aug 27.
Ref 171 RNA N(6)-Methyladenosine Methyltransferase METTL3 Facilitates Colorectal Cancer by Activating the m(6)A-GLUT1-mTORC1 Axis and Is a Therapeutic Target. Gastroenterology. 2021 Mar;160(4):1284-1300.e16. doi: 10.1053/j.gastro.2020.11.013. Epub 2020 Nov 18.
Ref 172 Integrated analysis of the transcriptome-wide m6A methylome in preeclampsia and healthy control placentas. PeerJ. 2020 Sep 15;8:e9880. doi: 10.7717/peerj.9880. eCollection 2020.
Ref 173 Chidamide increases the sensitivity of Non-small Cell Lung Cancer to Crizotinib by decreasing c-MET mRNA methylation. Int J Biol Sci. 2020 Jul 19;16(14):2595-2611. doi: 10.7150/ijbs.45886. eCollection 2020.
Ref 174 RNA methyltransferase METTL3 induces intrinsic resistance to gefitinib by combining with MET to regulate PI3K/AKT pathway in lung adenocarcinoma. J Cell Mol Med. 2021 Mar;25(5):2418-2425. doi: 10.1111/jcmm.16114. Epub 2021 Jan 24.
Ref 175 RNA m(6) A methylation regulates uveal melanoma cell proliferation, migration, and invasion by targeting c-Met. J Cell Physiol. 2020 Oct;235(10):7107-7119. doi: 10.1002/jcp.29608. Epub 2020 Feb 4.
Ref 176 LINC00460/DHX9/IGF2BP2 complex promotes colorectal cancer proliferation and metastasis by mediating HMGA1 mRNA stability depending on m6A modification. J Exp Clin Cancer Res. 2021 Feb 1;40(1):52. doi: 10.1186/s13046-021-01857-2.
Ref 177 METTL3 stabilizes HDAC5 mRNA in an m(6)A-dependent manner to facilitate malignant proliferation of osteosarcoma cells. Cell Death Discov. 2022 Apr 8;8(1):179. doi: 10.1038/s41420-022-00926-5.
Ref 178 METTL3/YTHDF2 m(6) A axis promotes tumorigenesis by degrading SETD7 and KLF4 mRNAs in bladder cancer. J Cell Mol Med. 2020 Apr;24(7):4092-4104. doi: 10.1111/jcmm.15063. Epub 2020 Mar 3.
Ref 179 MicroRNA-135 inhibits initiation of epithelial-mesenchymal transition in breast cancer by targeting ZNF217 and promoting m6A modification of NANOG. Oncogene. 2022 Mar;41(12):1742-1751. doi: 10.1038/s41388-022-02211-2. Epub 2022 Feb 4.
Ref 180 HBXIP drives metabolic reprogramming in hepatocellular carcinoma cells via METTL3-mediated m6A modification of HIF-1Alpha. J Cell Physiol. 2021 May;236(5):3863-3880. doi: 10.1002/jcp.30128. Epub 2020 Dec 11.
Ref 181 N(6)-methyladenosine modification of ITGA6 mRNA promotes the development and progression of bladder cancer. EBioMedicine. 2019 Sep;47:195-207. doi: 10.1016/j.ebiom.2019.07.068. Epub 2019 Aug 10.
Ref 182 METTL3 enhances cell adhesion through stabilizing integrin Beta1 mRNA via an m6A-HuR-dependent mechanism in prostatic carcinoma. Am J Cancer Res. 2020 Mar 1;10(3):1012-1025. eCollection 2020.
Ref 183 N(6)-Methyladenosine METTL3 Modulates the Proliferation and Apoptosis of Lens Epithelial Cells in Diabetic Cataract. Mol Ther Nucleic Acids. 2020 Jun 5;20:111-116. doi: 10.1016/j.omtn.2020.02.002. Epub 2020 Feb 11.
Ref 184 METTL3 promotes intrahepatic cholangiocarcinoma progression by regulating IFIT2 expression in an m(6)A-YTHDF2-dependent manner. Oncogene. 2022 Mar;41(11):1622-1633. doi: 10.1038/s41388-022-02185-1. Epub 2022 Jan 29.
Ref 185 ADAR1 is a new target of METTL3 and plays a pro-oncogenic role in glioblastoma by an editing-independent mechanism. Genome Biol. 2021 Jan 28;22(1):51. doi: 10.1186/s13059-021-02271-9.
Ref 186 Long non-coding RNA ILF3-AS1 facilitates hepatocellular carcinoma progression by stabilizing ILF3 mRNA in an m(6)A-dependent manner. Hum Cell. 2021 Nov;34(6):1843-1854. doi: 10.1007/s13577-021-00608-x. Epub 2021 Sep 7.
Ref 187 METTL3 Promotes Activation and Inflammation of FLSs Through the NF-KappaB Signaling Pathway in Rheumatoid Arthritis. Front Med (Lausanne). 2021 Jul 6;8:607585. doi: 10.3389/fmed.2021.607585. eCollection 2021.
Ref 188 METTL3-mediated mRNA N(6)-methyladenosine is required for oocyte and follicle development in mice. Cell Death Dis. 2021 Oct 23;12(11):989. doi: 10.1038/s41419-021-04272-9.
Ref 189 METTL3-mediated m6A modification of KIF3C-mRNA promotes prostate cancer progression and is negatively regulated by miR-320d. Aging (Albany NY). 2021 Sep 19;13(18):22332-22344. doi: 10.18632/aging.203541. Epub 2021 Sep 19.
Ref 190 METTL3-mediated m(6)A methylation of SPHK2 promotes gastric cancer progression by targeting KLF2. Oncogene. 2021 Apr;40(16):2968-2981. doi: 10.1038/s41388-021-01753-1. Epub 2021 Mar 23.
Ref 191 The m6A methyltransferase METTL3 promotes osteosarcoma progression by regulating the m6A level of LEF1. Biochem Biophys Res Commun. 2019 Aug 27;516(3):719-725. doi: 10.1016/j.bbrc.2019.06.128. Epub 2019 Jun 26.
Ref 192 m6A methyltransferase METTL3 promotes the progression of prostate cancer via m6A-modified LEF1. Eur Rev Med Pharmacol Sci. 2020 Apr;24(7):3565-3571. doi: 10.26355/eurrev_202004_20817.
Ref 193 METTL3 modulates m6A modification of CDC25B and promotes head and neck squamous cell carcinoma malignant progression. Exp Hematol Oncol. 2022 Mar 14;11(1):14. doi: 10.1186/s40164-022-00256-3.
Ref 194 m(6)A RNA Methylation Regulates the Self-Renewal and Tumorigenesis of Glioblastoma Stem Cells. Cell Rep. 2017 Mar 14;18(11):2622-2634. doi: 10.1016/j.celrep.2017.02.059.
Ref 195 METTL3-mediated m6A modification of STEAP2 mRNA inhibits papillary thyroid cancer progress by blocking the Hedgehog signaling pathway and epithelial-to-mesenchymal transition. Cell Death Dis. 2022 Apr 18;13(4):358. doi: 10.1038/s41419-022-04817-6.
Ref 196 Exosomal and intracellular miR-320b promotes lymphatic metastasis in esophageal squamous cell carcinoma. Mol Ther Oncolytics. 2021 Sep 25;23:163-180. doi: 10.1016/j.omto.2021.09.003. eCollection 2021 Dec 17.
Ref 197 METTL3 promotes prostate cancer progression by regulating miR-182 maturation in m6A-dependent manner. Andrologia. 2022 Aug;54(7):1581-1591. doi: 10.1111/and.14422. Epub 2022 Apr 12.
Ref 198 METTL3 promotes IL-1Beta-induced degeneration of endplate chondrocytes by driving m6A-dependent maturation of miR-126-5p. J Cell Mol Med. 2020 Dec;24(23):14013-14025. doi: 10.1111/jcmm.16012. Epub 2020 Oct 23.
Ref 199 N(6)-methyladenosine (m(6)A) methyltransferase METTL3-mediated LINC00680 accelerates osteoarthritis through m(6)A/SIRT1 manner. Cell Death Discov. 2022 May 2;8(1):240. doi: 10.1038/s41420-022-00890-0.
Ref 200 METTL3-mediated m(6)A mRNA modification promotes esophageal cancer initiation and progression via Notch signaling pathway. Mol Ther Nucleic Acids. 2021 Jul 21;26:333-346. doi: 10.1016/j.omtn.2021.07.007. eCollection 2021 Dec 3.
Ref 201 Therapeutic targeting m6A-guided miR-146a-5p signaling contributes to the melittin-induced selective suppression of bladder cancer. Cancer Lett. 2022 May 28;534:215615. doi: 10.1016/j.canlet.2022.215615. Epub 2022 Mar 9.
Ref 202 YTHDF2 facilitates UBXN1 mRNA decay by recognizing METTL3-mediated m(6)A modification to activate NF-KappaB and promote the malignant progression of glioma. J Hematol Oncol. 2021 Jul 10;14(1):109. doi: 10.1186/s13045-021-01124-z.
Ref 203 METTL3/METTL14 Transactivation and m(6)A-Dependent TGF-Beta1 Translation in Activated Kupffer Cells. Cell Mol Gastroenterol Hepatol. 2021;12(3):839-856. doi: 10.1016/j.jcmgh.2021.05.007. Epub 2021 May 13.
Ref 204 NUCB1 Suppresses Growth and Shows Additive Effects With Gemcitabine in Pancreatic Ductal Adenocarcinoma via the Unfolded Protein Response. Front Cell Dev Biol. 2021 Mar 29;9:641836. doi: 10.3389/fcell.2021.641836. eCollection 2021.
Ref 205 Methyltransferase-Like 3 Rescues the Amyloid-beta protein-Induced Reduction of Activity-Regulated Cytoskeleton Associated Protein Expression via YTHDF1-Dependent N6-Methyladenosine Modification. Front Aging Neurosci. 2022 Apr 25;14:890134. doi: 10.3389/fnagi.2022.890134. eCollection 2022.
Ref 206 METTL3 regulates PM(2.5)-induced cell injury by targeting OSGIN1 in human airway epithelial cells. J Hazard Mater. 2021 Aug 5;415:125573. doi: 10.1016/j.jhazmat.2021.125573. Epub 2021 Mar 3.
Ref 207 miR-600 inhibits lung cancer via downregulating the expression of METTL3. Cancer Manag Res. 2019 Feb 1;11:1177-1187. doi: 10.2147/CMAR.S181058. eCollection 2019.
Ref 208 METTL3 promotes oxaliplatin resistance of gastric cancer CD133+?stem cells by promoting PARP1 mRNA stability. Cell Mol Life Sci. 2022 Feb 18;79(3):135. doi: 10.1007/s00018-022-04129-0.
Ref 209 METTL3 Promotes Tumorigenesis and Metastasis through BMI1 m(6)A Methylation in Oral Squamous Cell Carcinoma. Mol Ther. 2020 Oct 7;28(10):2177-2190. doi: 10.1016/j.ymthe.2020.06.024. Epub 2020 Jun 24.
Ref 210 METTL3/YTHDF2 m6A axis accelerates colorectal carcinogenesis through epigenetically suppressing YPEL5. Mol Oncol. 2021 Aug;15(8):2172-2184. doi: 10.1002/1878-0261.12898. Epub 2021 Jan 25.
Ref 211 METTL3 mediates bone marrow mesenchymal stem cell adipogenesis to promote chemoresistance in acute myeloid leukaemia. FEBS Open Bio. 2021 Jun;11(6):1659-1672. doi: 10.1002/2211-5463.13165. Epub 2021 May 20.
Ref 212 METTL3 promotes the proliferation and invasion of esophageal cancer cells partly through AKT signaling pathway. Pathol Res Pract. 2020 Sep;216(9):153087. doi: 10.1016/j.prp.2020.153087. Epub 2020 Jun 27.
Ref 213 Methyltransferase-like 3 upregulation is involved in the chemoresistance of non-small cell lung cancer. Ann Transl Med. 2022 Feb;10(3):139. doi: 10.21037/atm-21-6608.
Ref 214 HBXIP-elevated methyltransferase METTL3 promotes the progression of breast cancer via inhibiting tumor suppressor let-7g. Cancer Lett. 2018 Feb 28;415:11-19. doi: 10.1016/j.canlet.2017.11.018. Epub 2017 Nov 22.
Ref 215 Impaired autophagic degradation of lncRNA ARHGAP5-AS1 promotes chemoresistance in gastric cancer. Cell Death Dis. 2019 May 16;10(6):383. doi: 10.1038/s41419-019-1585-2.
Ref 216 N6-methyladenosine regulates ATM expression and downstream signaling. J Cancer. 2021 Oct 17;12(23):7041-7051. doi: 10.7150/jca.64061. eCollection 2021.
Ref 217 N(6)-Methyladenosine Modulates Nonsense-Mediated mRNA Decay in Human Glioblastoma. Cancer Res. 2019 Nov 15;79(22):5785-5798. doi: 10.1158/0008-5472.CAN-18-2868. Epub 2019 Sep 17.
Ref 218 METTL3-mediated m(6)A modification regulates cell cycle progression of dental pulp stem cells. Stem Cell Res Ther. 2021 Mar 1;12(1):159. doi: 10.1186/s13287-021-02223-x.
Ref 219 LINC01605, regulated by the EP300-SMYD2 complex, potentiates the binding between METTL3 and SPTBN2 in colorectal cancer. Cancer Cell Int. 2021 Sep 20;21(1):504. doi: 10.1186/s12935-021-02180-8.
Ref 220 Upregulated METTL3 promotes metastasis of colorectal Cancer via miR-1246/SPRED2/MAPK signaling pathway. J Exp Clin Cancer Res. 2019 Sep 6;38(1):393. doi: 10.1186/s13046-019-1408-4.
Ref 221 Histone demethylase JMJD1C promotes the polarization of M1 macrophages to prevent glioma by upregulating miR-302a. Clin Transl Med. 2021 Sep;11(9):e424. doi: 10.1002/ctm2.424.
Ref 222 Knockdown of m6A methyltransferase METTL3 in gastric cancer cells results in suppression of cell proliferation. Oncol Lett. 2020 Sep;20(3):2191-2198. doi: 10.3892/ol.2020.11794. Epub 2020 Jul 1.
Ref 223 m6A methyltransferase METTL3 maintains colon cancer tumorigenicity by suppressing SOCS2 to promote cell proliferation. Oncol Rep. 2020 Sep;44(3):973-986. doi: 10.3892/or.2020.7665. Epub 2020 Jun 26.
Ref 224 RNA N6-methyladenosine methyltransferase-like 3 promotes liver cancer progression through YTHDF2-dependent posttranscriptional silencing of SOCS2. Hepatology. 2018 Jun;67(6):2254-2270. doi: 10.1002/hep.29683. Epub 2018 Apr 19.
Ref 225 METTL3 Is Involved in the Development of Graves' Disease by Inducing SOCS mRNA m6A Modification. Front Endocrinol (Lausanne). 2021 Sep 20;12:666393. doi: 10.3389/fendo.2021.666393. eCollection 2021.
Ref 226 m(6)A Methyltransferase METTL3 Promotes the Progression of Primary Acral Melanoma via Mediating TXNDC5 Methylation. Front Oncol. 2022 Jan 18;11:770325. doi: 10.3389/fonc.2021.770325. eCollection 2021.
Ref 227 Promoter-bound METTL3 maintains myeloid leukaemia by m(6)A-dependent translation control. Nature. 2017 Dec 7;552(7683):126-131. doi: 10.1038/nature24678. Epub 2017 Nov 27.
Ref 228 METTL3 facilitates multiple myeloma tumorigenesis by enhancing YY1 stability and pri-microRNA-27 maturation in m(6)A-dependent manner. Cell Biol Toxicol. 2022 Jan 17. doi: 10.1007/s10565-021-09690-1. Online ahead of print.
Ref 229 METTL3 promotes ovarian carcinoma growth and invasion through the regulation of AXL translation and epithelial to mesenchymal transition. Gynecol Oncol. 2018 Nov;151(2):356-365. doi: 10.1016/j.ygyno.2018.09.015. Epub 2018 Sep 21.
Ref 230 METTL3 facilitates the progression of hepatocellular carcinoma by modulating the m6A level of USP7. Am J Transl Res. 2021 Dec 15;13(12):13423-13437. eCollection 2021.
Ref 231 Methyltransferase-like 3 Aggravates HCC Development via Mediating N6-Methyladenosine of Ubiquitin-Specific Protease 7. J Oncol. 2022 May 5;2022:6167832. doi: 10.1155/2022/6167832. eCollection 2022.
Ref 232 METTL3-induced UCK2 m(6)A hypermethylation promotes melanoma cancer cell metastasis via the WNT/Beta-catenin pathway. Ann Transl Med. 2021 Jul;9(14):1155. doi: 10.21037/atm-21-2906.
Ref 233 METTL3 promotes colorectal cancer metastasis by stabilizing PLAU mRNA in an m6A-dependent manner. Biochem Biophys Res Commun. 2022 Jul 23;614:9-16. doi: 10.1016/j.bbrc.2022.04.141. Epub 2022 May 6.
Ref 234 Mettl3 Regulates Osteogenic Differentiation and Alternative Splicing of Vegfa in Bone Marrow Mesenchymal Stem Cells. Int J Mol Sci. 2019 Jan 28;20(3):551. doi: 10.3390/ijms20030551.
Ref 235 N6-Methyladenosine Regulates the Expression and Secretion of TGFBeta1 to Affect the Epithelial-Mesenchymal Transition of Cancer Cells. Cells. 2020 Jan 25;9(2):296. doi: 10.3390/cells9020296.
Ref 236 The m6A methyltransferase METTL3 aggravates the progression of nasopharyngeal carcinoma through inducing EMT by m6A-modified Snail mRNA. Minerva Med. 2022 Apr;113(2):309-314. doi: 10.23736/S0026-4806.20.06653-7. Epub 2020 Jun 5.
Ref 237 RNA m(6)A methyltransferase METTL3 promotes colorectal cancer cell proliferation and invasion by regulating Snail expression. Oncol Lett. 2021 Oct;22(4):711. doi: 10.3892/ol.2021.12972. Epub 2021 Aug 5.
Ref 238 RNA m(6)A methylation regulates the epithelial mesenchymal transition of cancer cells and translation of Snail. Nat Commun. 2019 May 6;10(1):2065. doi: 10.1038/s41467-019-09865-9.
Ref 239 SUMO1 modification of methyltransferase-like 3 promotes tumor progression via regulating Snail mRNA homeostasis in hepatocellular carcinoma. Theranostics. 2020 Apr 27;10(13):5671-5686. doi: 10.7150/thno.42539. eCollection 2020.
Ref 240 N6-methyladenosine methyltransferase plays a role in hypoxic preconditioning partially through the interaction with lncRNA H19. Acta Biochim Biophys Sin (Shanghai). 2020 Dec 29;52(12):1306-1315. doi: 10.1093/abbs/gmaa130.
Ref 241 LncRNA LINC00470 promotes the degradation of PTEN mRNA to facilitate malignant behavior in gastric cancer cells. Biochem Biophys Res Commun. 2020 Jan 22;521(4):887-893. doi: 10.1016/j.bbrc.2019.11.016. Epub 2019 Nov 8.
Ref 242 m(6)A Modification of lncRNA NEAT1 Regulates Chronic Myelocytic Leukemia Progression via miR-766-5p/CDKN1A Axis. Front Oncol. 2021 Jul 20;11:679634. doi: 10.3389/fonc.2021.679634. eCollection 2021.
Ref 243 Cross talk between RNA N6-methyladenosine methyltransferase-like 3 and miR-186 regulates hepatoblastoma progression through Wnt/Beta-catenin signalling pathway. Cell Prolif. 2020 Mar;53(3):e12768. doi: 10.1111/cpr.12768. Epub 2020 Jan 22.
Ref 244 METTL3 promote tumor proliferation of bladder cancer by accelerating pri-miR221/222 maturation in m6A-dependent manner. Mol Cancer. 2019 Jun 22;18(1):110. doi: 10.1186/s12943-019-1036-9.
Ref 245 Methyltransferase 3 Mediated miRNA m6A Methylation Promotes Stress Granule Formation in the Early Stage of Acute Ischemic Stroke. Front Mol Neurosci. 2020 Jun 5;13:103. doi: 10.3389/fnmol.2020.00103. eCollection 2020.
Ref 246 Extracellular vesicle-packaged mitochondrial disturbing miRNA exacerbates cardiac injury during acute myocardial infarction. Clin Transl Med. 2022 Apr;12(4):e779. doi: 10.1002/ctm2.779.
Ref 247 The "m6A writer" METTL3 and the "m6A reader" IGF2BP2 regulate cutaneous T-cell lymphomas progression via CDKN2A. Hematol Oncol. 2022 Apr 21. doi: 10.1002/hon.3005. Online ahead of print.
Ref 248 Methylation of adenosine at the N(6) position post-transcriptionally regulates hepatic P450s expression. Biochem Pharmacol. 2020 Jan;171:113697. doi: 10.1016/j.bcp.2019.113697. Epub 2019 Nov 7.
Ref 249 METTL3 Contributes to Osteosarcoma Progression by Increasing DANCR mRNA Stability via m6A Modification. Front Cell Dev Biol. 2022 Jan 12;9:784719. doi: 10.3389/fcell.2021.784719. eCollection 2021.
Ref 250 METTL3 Promotes Esophageal Squamous Cell Carcinoma Metastasis Through Enhancing GLS2 Expression. Front Oncol. 2021 May 19;11:667451. doi: 10.3389/fonc.2021.667451. eCollection 2021.
Ref 251 The methyltransferase METTL3 negatively regulates nonalcoholic steatohepatitis (NASH) progression. Nat Commun. 2021 Dec 10;12(1):7213. doi: 10.1038/s41467-021-27539-3.
Ref 252 N(6)-methyladenosine modification regulates imatinib resistance of gastrointestinal stromal tumor by enhancing the expression of multidrug transporter MRP1. Cancer Lett. 2022 Apr 1;530:85-99. doi: 10.1016/j.canlet.2022.01.008. Epub 2022 Jan 13.
Ref 253 Mechanism of METTL3-Mediated m(6)A Modification in Cardiomyocyte Pyroptosis and Myocardial Ischemia-Reperfusion Injury. Cardiovasc Drugs Ther. 2022 Jan 23. doi: 10.1007/s10557-021-07300-0. Online ahead of print.
Ref 254 m(6) A transferase METTL3-induced lncRNA ABHD11-AS1 promotes the Warburg effect of non-small-cell lung cancer. J Cell Physiol. 2021 Apr;236(4):2649-2658. doi: 10.1002/jcp.30023. Epub 2020 Sep 6.
Ref 255 N(6)-methyladenosine-modified long non-coding RNA AGAP2-AS1 promotes psoriasis pathogenesis via miR-424-5p/AKT3 axis. J Dermatol Sci. 2022 Jan;105(1):27-36. doi: 10.1016/j.jdermsci.2021.11.007. Epub 2021 Nov 18.
Ref 256 Long intergenic non-protein coding RNA 1273 confers sorafenib resistance in hepatocellular carcinoma via regulation of methyltransferase 3. Bioengineered. 2022 Feb;13(2):3108-3121. doi: 10.1080/21655979.2022.2025701.
Ref 257 m6A-Induced LncRNA MEG3 Suppresses the Proliferation, Migration and Invasion of Hepatocellular Carcinoma Cell Through miR-544b/BTG2 Signaling. Onco Targets Ther. 2021 Jun 15;14:3745-3755. doi: 10.2147/OTT.S289198. eCollection 2021.
Ref 258 Upregulation of lncRNA NIFK-AS1 in hepatocellular carcinoma by m(6)A methylation promotes disease progression and sorafenib resistance. Hum Cell. 2021 Nov;34(6):1800-1811. doi: 10.1007/s13577-021-00587-z. Epub 2021 Aug 10.
Ref 259 Targeting SNHG3/miR-186-5p reverses the increased m6A level caused by platinum treatment through regulating METTL3 in esophageal cancer. Cancer Cell Int. 2021 Feb 17;21(1):114. doi: 10.1186/s12935-021-01747-9.
Ref 260 N6-methyladenosine-induced SVIL antisense RNA 1 restrains lung adenocarcinoma cell proliferation by destabilizing E2F1. Bioengineered. 2022 Feb;13(2):3093-3107. doi: 10.1080/21655979.2022.2025697.
Ref 261 METTL3 Regulates Ossification of the Posterior Longitudinal Ligament via the lncRNA XIST/miR-302a-3p/USP8 Axis. Front Cell Dev Biol. 2021 Mar 5;9:629895. doi: 10.3389/fcell.2021.629895. eCollection 2021.
Ref 262 The m6A methyltransferase METTL3 affects autophagy and progression of nasopharyngeal carcinoma by regulating the stability of lncRNA ZFAS1. Infect Agent Cancer. 2022 Jan 3;17(1):1. doi: 10.1186/s13027-021-00411-1.
Ref 263 ZFAS1 Exerts an Oncogenic Role via Suppressing miR-647 in an m(6)A-Dependent Manner in Cervical Cancer. Onco Targets Ther. 2020 Nov 17;13:11795-11806. doi: 10.2147/OTT.S274492. eCollection 2020.
Ref 264 Adalimumab for psoriasis patients who are non-responders to etanercept: open-label prospective evaluation. J Eur Acad Dermatol Venereol. 2009 Dec;23(12):1394-7. doi: 10.1111/j.1468-3083.2009.03325.x. Epub 2009 Jul 1.
Ref 265 Transport of anthelmintic benzimidazole drugs by breast cancer resistance protein (BCRP/ABCG2). Drug Metab Dispos. 2005 May;33(5):614-8. doi: 10.1124/dmd.104.003319. Epub 2005 Feb 9.
Ref 266 The SLC2 (GLUT) family of membrane transporters. Mol Aspects Med. 2013 Apr-Jun;34(2-3):121-38. doi: 10.1016/j.mam.2012.07.001.
Ref 267 FDA label of Trifarotene. The 2020 official website of the U.S. Food and Drug Administration.
Ref 268 Rociletinib in EGFR-mutated non-small-cell lung cancer. N Engl J Med. 2015 Apr 30;372(18):1700-9. doi: 10.1056/NEJMoa1413654.
Ref 269 Methyltransferase-like 3 induces the development of cervical cancer by enhancing insulin-like growth factor 2 mRNA-binding proteins 3-mediated apoptotic chromatin condensation inducer 1 mRNA stability. Bioengineered. 2022 Mar;13(3):7034-7048. doi: 10.1080/21655979.2022.2044261.
Ref 270 Raft nanodomains contribute to Akt/PKB plasma membrane recruitment and activation. Nat Chem Biol. 2008 Sep;4(9):538-47. doi: 10.1038/nchembio.103. Epub 2008 Jul 20.
Ref 271 Association of the ABCG2 C421A polymorphism with prostate cancer risk and survival. BJU Int. 2008 Dec;102(11):1694-9. doi: 10.1111/j.1464-410X.2008.07913.x. Epub 2008 Aug 14.
Ref 272 Inhibition of human cytochrome p450 1b1 further clarifies its role in the activation of dibenzo[a,l]pyrene in cells in culture. J Biochem Mol Toxicol. 2007;21(3):101-9. doi: 10.1002/jbt.20168.
Ref 273 Characterization of human cytochrome P450 enzymes catalyzing domperidone N-dealkylation and hydroxylation in vitro. Br J Clin Pharmacol. 2004 Sep;58(3):277-87. doi: 10.1111/j.1365-2125.2004.02156.x.
Ref 274 Biochemical characterization of TAK-593, a novel VEGFR/PDGFR inhibitor with a two-step slow binding mechanism. Biochemistry. 2011 Feb 8;50(5):738-51. doi: 10.1021/bi101777f. Epub 2011 Jan 10.
Ref 275 ClinicalTrials.gov (NCT01526473) A Phase I Study To Evaluate The Antitumor Activity And Safety Of AVX901. U.S. National Institutes of Health.
Ref 276 Glucose transporter isoforms GLUT1 and GLUT3 transport dehydroascorbic acid. J Biol Chem. 1997 Jul 25;272(30):18982-9. doi: 10.1074/jbc.272.30.18982.
Ref 277 Halofantrine metabolism in microsomes in man: major role of CYP 3A4 and CYP 3A5. J Pharm Pharmacol. 1999 Apr;51(4):419-26. doi: 10.1211/0022357991772628.
Ref 278 Identification of the brominated flame retardant 1,2-dibromo-4-(1,2-dibromoethyl)cyclohexane as an androgen agonist. J Med Chem. 2006 Dec 14;49(25):7366-72. doi: 10.1021/jm060713d.
Ref 279 MDR-ABC transporters: biomarkers in rheumatoid arthritis. Clin Exp Rheumatol. 2013 Sep-Oct;31(5):779-87. Epub 2013 May 27.
Ref 280 METTL3 Inhibits Antitumor Immunity by Targeting m(6)A-BHLHE41-CXCL1/CXCR2 Axis to Promote Colorectal Cancer. Gastroenterology. 2022 Jun 11:S0016-5085(22)00629-1. doi: 10.1053/j.gastro.2022.06.024. Online ahead of print.
Ref 281 Inhibition of Anti-Apoptotic Bcl-2 Proteins in Preclinical and Clinical Studies: Current Overview in Cancer. Cells. 2020 May 21;9(5):1287. doi: 10.3390/cells9051287.
Ref 282 Cytochrome P450 isozymes responsible for the metabolism of toluene and styrene in human liver microsomes. Xenobiotica. 1997 Jul;27(7):657-65. doi: 10.1080/004982597240253.
Ref 283 Selective inhibition of matrix metalloproteinase isozymes and in vivo protection against emphysema by substituted gamma-keto carboxylic acids. J Med Chem. 2006 Jan 26;49(2):456-8. doi: 10.1021/jm051101g.
Ref 284 Broad spectrum matrix metalloproteinase inhibitors: an examination of succinamide hydroxamate inhibitors with P1 C alpha gem-disubstitution. Bioorg Med Chem Lett. 1998 Jun 16;8(12):1443-8. doi: 10.1016/s0960-894x(98)00255-8.
Ref 285 METTL3-mediated RNA m6A Hypermethylation Promotes Tumorigenesis and GH Secretion of Pituitary Somatotroph Adenomas. J Clin Endocrinol Metab. 2022 Jan 1;107(1):136-149. doi: 10.1210/clinem/dgab652.
Ref 286 Two concurrent phase II trials of paclitaxel/carboplatin/trastuzumab (weekly or every-3-week schedule) as first-line therapy in women with HER2-overexpressing metastatic breast cancer: NCCTG study 983252. Clin Breast Cancer. 2005 Dec;6(5):425-32. doi: 10.3816/CBC.2005.n.047.
Ref 287 Comparative studies on the cytochrome p450-associated metabolism and interaction potential of selegiline between human liver-derived in vitro systems. Drug Metab Dispos. 2003 Sep;31(9):1093-102. doi: 10.1124/dmd.31.9.1093.
Ref 288 2011 Pipeline of Quark Pharm.
Ref 289 Cytochrome P-450 3A4 and 2C8 are involved in zopiclone metabolism. Drug Metab Dispos. 1999 Sep;27(9):1068-73.
Ref 290 Comparison of 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) reductase inhibitors (statins) as inhibitors of cytochrome P450 2C8. Basic Clin Pharmacol Toxicol. 2005 Aug;97(2):104-8. doi: 10.1111/j.1742-7843.2005.pto_134.x.
Ref 291 MiR-33a suppresses proliferation of NSCLC cells via targeting METTL3 mRNA. Biochem Biophys Res Commun. 2017 Jan 22;482(4):582-589. doi: 10.1016/j.bbrc.2016.11.077. Epub 2016 Nov 14.
Ref 292 NRF2 Regulation Processes as a Source of Potential Drug Targets against Neurodegenerative Diseases. Biomolecules. 2020 Jun 14;10(6):904. doi: 10.3390/biom10060904.
Ref 293 TNFerade, an adenovector carrying the transgene for human tumor necrosis factor alpha, for patients with advanced solid tumors: surgical experience and long-term follow-up. Ann Surg Oncol. 2005 Oct;12(10):825-30. doi: 10.1245/ASO.2005.03.023. Epub 2005 Aug 9.
Ref 294 MM-141, an IGF-IR- and ErbB3-directed bispecific antibody, overcomes network adaptations that limit activity of IGF-IR inhibitors. Mol Cancer Ther. 2014 Feb;13(2):410-25. doi: 10.1158/1535-7163.MCT-13-0255. Epub 2013 Nov 26.
Ref 295 2-methoxyestradiol inhibits hypoxia-inducible factor 1alpha, tumor growth, and angiogenesis and augments paclitaxel efficacy in head and neck squamous cell carcinoma. Clin Cancer Res. 2004 Dec 15;10(24):8665-73. doi: 10.1158/1078-0432.CCR-04-1393.
Ref 296 Identification of 4-(2-(4-amino-1,2,5-oxadiazol-3-yl)-1-ethyl-7-{[(3S)-3-piperidinylmethyl]oxy}-1H-imidazo[4,5-c]pyridin-4-yl)-2-methyl-3-butyn-2-ol (GSK690693), a novel inhibitor of AKT kinase. J Med Chem. 2008 Sep 25;51(18):5663-79. doi: 10.1021/jm8004527.
Ref 297 Ninlaro- European Medicines Agency - European Union
Ref 298 Interplay of m(6) A and histone modifications contributes to temozolomide resistance in glioblastoma. Clin Transl Med. 2021 Sep;11(9):e553. doi: 10.1002/ctm2.553.
Ref 299 An in vitro evaluation of guanfacine as a substrate for P-glycoprotein. Neuropsychiatr Dis Treat. 2011;7:501-5.
Ref 300 Cytochromes P450 in crustacea. Comp Biochem Physiol C Pharmacol Toxicol Endocrinol. 1998 Nov;121(1-3):157-72. doi: 10.1016/s0742-8413(98)10036-1.
Ref 301 A potent, selective inhibitor of matrix metalloproteinase-3 for the topical treatment of chronic dermal ulcers. J Med Chem. 2003 Jul 31;46(16):3514-25. doi: 10.1021/jm0308038.
Ref 302 MicroPET/CT Imaging of AXL Downregulation by HSP90 Inhibition in Triple-Negative Breast Cancer. Contrast Media Mol Imaging. 2017 May 14;2017:1686525. doi: 10.1155/2017/1686525. eCollection 2017.
Ref 303 Pioglitazone is metabolised by CYP2C8 and CYP3A4 in vitro: potential for interactions with CYP2C8 inhibitors. Basic Clin Pharmacol Toxicol. 2006 Jul;99(1):44-51. doi: 10.1111/j.1742-7843.2006.pto_437.x.
Ref 304 BMS-936564/MDX-1338: a fully human anti-CXCR4 antibody induces apoptosis in vitro and shows antitumor activity in vivo in hematologic malignancies. Clin Cancer Res. 2013 Jan 15;19(2):357-66. doi: 10.1158/1078-0432.CCR-12-2333. Epub 2012 Dec 4.
Ref 305 N(6)-methyladenosine-mediated LDHA induction potentiates chemoresistance of colorectal cancer cells through metabolic reprogramming. Theranostics. 2022 Jun 13;12(10):4802-4817. doi: 10.7150/thno.73746. eCollection 2022.
Ref 306 Diversity-oriented synthesis: exploring the intersections between chemistry and biology. Nat Chem Biol. 2005 Jul;1(2):74-84. doi: 10.1038/nchembio0705-74.
Ref 307 Small molecule-based reversible reprogramming of cellular lifespan. Nat Chem Biol. 2006 Jul;2(7):369-74. doi: 10.1038/nchembio800. Epub 2006 Jun 11.
Ref 308 2011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4. doi: 10.1038/nrd3657.
Ref 309 ATP-binding cassette B1 transports seliciclib (R-roscovitine), a cyclin-dependent kinase inhibitor. Drug Metab Dispos. 2010 Nov;38(11):2000-6.
Ref 310 Clinical pipeline report, company report or official report of Merus.
Ref 311 Characterization of the metabolism of fenretinide by human liver microsomes, cytochrome P450 enzymes and UDP-glucuronosyltransferases. Br J Pharmacol. 2011 Feb;162(4):989-99. doi: 10.1111/j.1476-5381.2010.01104.x.
Ref 312 Coronaviruses - drug discovery and therapeutic options. Nat Rev Drug Discov. 2016 May;15(5):327-47. doi: 10.1038/nrd.2015.37. Epub 2016 Feb 12.
Ref 313 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2030).
Ref 314 Selective JAK inhibitors in development for rheumatoid arthritis. Expert Opin Investig Drugs. 2014 Aug;23(8):1067-77. doi: 10.1517/13543784.2014.918604. Epub 2014 May 12.
Ref 315 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2020
Ref 316 Preclinical Development of ONC1-13B, Novel Antiandrogen for Prostate Cancer Treatment. J Cancer. 2014 Jan 21;5(2):133-42. doi: 10.7150/jca.7773. eCollection 2014.
Ref 317 Modulation of CD44 Activity by A6-Peptide. Front Immunol. 2015 Mar 30;6:135. doi: 10.3389/fimmu.2015.00135. eCollection 2015.
Ref 318 Inhibiting the function of ABCB1 and ABCG2 by the EGFR tyrosine kinase inhibitor AG1478. Biochem Pharmacol. 2009 Mar 1;77(5):781-93.
Ref 319 Growth factors and their receptors: new targets for prostate cancer therapy. Urology. 2001 Aug;58(2 Suppl 1):114-22. doi: 10.1016/s0090-4295(01)01253-5.
Ref 320 PD-1 blockade by CT-011, anti-PD-1 antibody, enhances ex vivo T-cell responses to autologous dendritic cell/myeloma fusion vaccine. J Immunother. 2011 Jun;34(5):409-18. doi: 10.1097/CJI.0b013e31821ca6ce.
Ref 321 Design, synthesis, biological evaluation and molecular docking of curcumin analogues as antioxidant, cyclooxygenase inhibitory and anti-inflammatory agents. Bioorg Med Chem Lett. 2005 Apr 1;15(7):1793-7. doi: 10.1016/j.bmcl.2005.02.039.
Ref 322 Clinical pipeline report, company report or official report of Shionogi (2011).
Ref 323 METTL3 promotes colorectal carcinoma progression by regulating the m6A-CRB3-Hippo axis. J Exp Clin Cancer Res. 2022 Jan 10;41(1):19. doi: 10.1186/s13046-021-02227-8.
Ref 324 Tyrosine kinase inhibitors. 15. 4-(Phenylamino)quinazoline and 4-(phenylamino)pyrido[d]pyrimidine acrylamides as irreversible inhibitors of the ATP binding site of the epidermal growth factor receptor. J Med Chem. 1999 May 20;42(10):1803-15. doi: 10.1021/jm9806603.
Ref 325 Evidence that CYP2C19 is the major (S)-mephenytoin 4'-hydroxylase in humans. Biochemistry. 1994 Feb 22;33(7):1743-52. doi: 10.1021/bi00173a017.
Ref 326 N6-Methyladenosine Modification of PTTG3P Contributes to Colorectal Cancer Proliferation via YAP1. Front Oncol. 2021 Sep 30;11:669731. doi: 10.3389/fonc.2021.669731. eCollection 2021.
Ref 327 METTL3 antagonizes 5?FU chemotherapy and confers drug resistance in colorectal carcinoma. Int J Oncol. 2022 Sep;61(3):106. doi: 10.3892/ijo.2022.5396. Epub 2022 Jul 20.
Ref 328 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019
Ref 329 Synthesis and biological evaluation of substrate-based inhibitors of 6-phosphogluconate dehydrogenase as potential drugs against African trypanosomiasis. Bioorg Med Chem. 2003 Jul 17;11(14):3205-14. doi: 10.1016/s0968-0896(03)00191-3.
Ref 330 Human 3-alpha hydroxysteroid dehydrogenase type 3 (3Alpha-HSD3): the V54L mutation restricting the steroid alternative binding and enhancing the 20Alpha-HSD activity. J Steroid Biochem Mol Biol. 2014 May;141:135-43. doi: 10.1016/j.jsbmb.2014.01.003. Epub 2014 Jan 13.
Ref 331 Interactions between riluzole and ABCG2/BCRP transporter. Neurosci Lett. 2009 Mar 6;452(1):12-6. doi: 10.1016/j.neulet.2008.12.061. Epub 2009 Jan 6.
Ref 332 Prediction of in vivo drug-drug interactions between tolbutamide and various sulfonamides in humans based on in vitro experiments. Drug Metab Dispos. 2000 Apr;28(4):475-81.
Ref 333 Interaction of enrofloxacin with breast cancer resistance protein (BCRP/ABCG2): influence of flavonoids and role in milk secretion in sheep. J Vet Pharmacol Ther. 2006 Aug;29(4):279-87.
Ref 334 DOI: 10.1158/1538-7445.AM2015-4693
Ref 335 Identification of cytochrome P450 enzymes involved in the metabolism of 4'-methoxy-alpha-pyrrolidinopropiophenone (MOPPP), a designer drug, in human liver microsomes. Xenobiotica. 2003 Oct;33(10):989-98. doi: 10.1080/00498250310001602775.
Ref 336 Selective benzopyranone and pyrimido[2,1-a]isoquinolin-4-one inhibitors of DNA-dependent protein kinase: synthesis, structure-activity studies, and radiosensitization of a human tumor cell line in vitro. J Med Chem. 2005 Jan 27;48(2):569-85. doi: 10.1021/jm049526a.
Ref 337 J Clin Oncol 32:5s, 2014 (suppl; abstr 2515).
Ref 338 ABCG2: determining its relevance in clinical drug resistance. Cancer Metastasis Rev. 2007 Mar;26(1):39-57. doi: 10.1007/s10555-007-9042-6.
Ref 339 GEMSTONE-301: a phase III clinical trial of CS1001 as consolidation therapy in patients with locally advanced/unresectable (stage III) non-small cell lung cancer (NSCLC) who did not have disease progression after prior concurrent/sequential chemoradiotherapy. Transl Lung Cancer Res. 2020 Oct;9(5):2008-2015. doi: 10.21037/tlcr-20-608.
Ref 340 Sterol transport by the human breast cancer resistance protein (ABCG2) expressed in Lactococcus lactis. J Biol Chem. 2003 Jun 6;278(23):20645-51. doi: 10.1074/jbc.M301358200. Epub 2003 Mar 28.
Ref 341 Metabolism of retinoids and arachidonic acid by human and mouse cytochrome P450 1b1. Drug Metab Dispos. 2004 Aug;32(8):840-7. doi: 10.1124/dmd.32.8.840.
Ref 342 Prevent Oral Cancer With Mouthwash. Introgen Therapeutics.
Ref 343 US patent application no. 7,375,212, Modulation of Aurora B expression.
Ref 344 Beperminogene perplasmid for the treatment of critical limb ischemia. Expert Rev Cardiovasc Ther. 2014 Oct;12(10):1145-56. doi: 10.1586/14779072.2014.955850. Epub 2014 Sep 5.
Ref 345 Discovery of cyclic amine-substituted benzoic acids as PPARAlpha agonists. Bioorg Med Chem Lett. 2012 Jan 1;22(1):334-8. doi: 10.1016/j.bmcl.2011.11.002. Epub 2011 Nov 9.
Ref 346 Emerging drugs for psoriasis. Expert Opin Emerg Drugs. 2009 Mar;14(1):145-63. doi: 10.1517/14728210902771334.
Ref 347 Identification of a subtype selective human PPARalpha agonist through parallel-array synthesis. Bioorg Med Chem Lett. 2001 May 7;11(9):1225-7. doi: 10.1016/s0960-894x(01)00188-3.
Ref 348 Sulfamethoxazole and its metabolite nitroso sulfamethoxazole stimulate dendritic cell costimulatory signaling. J Immunol. 2007 May 1;178(9):5533-42. doi: 10.4049/jimmunol.178.9.5533.
Ref 349 Targeting estrogen receptor Alpha for degradation with PROTACs: A promising approach to overcome endocrine resistance. Eur J Med Chem. 2020 Nov 15;206:112689. doi: 10.1016/j.ejmech.2020.112689. Epub 2020 Aug 2.
Ref 350 Diabetic endothelial dysfunction: the role of poly(ADP-ribose) polymerase activation. Nat Med. 2001 Jan;7(1):108-13. doi: 10.1038/83241.
Ref 351 AST1306, a novel irreversible inhibitor of the epidermal growth factor receptor 1 and 2, exhibits antitumor activity both in vitro and in vivo. PLoS One. 2011;6(7):e21487. doi: 10.1371/journal.pone.0021487. Epub 2011 Jul 18.
Ref 352 US patent application no. 6,867,039, Antisense modulation of dual specific phosphatase 5 expression.
Ref 353 Imatinib mesylate (STI571) is a substrate for the breast cancer resistance protein (BCRP)/ABCG2 drug pump. Blood. 2004 Nov 1;104(9):2940-2. doi: 10.1182/blood-2004-04-1398. Epub 2004 Jul 13.
Ref 354 (R)-PFI-2 is a potent and selective inhibitor of SETD7 methyltransferase activity in cells. Proc Natl Acad Sci U S A. 2014 Sep 2;111(35):12853-8. doi: 10.1073/pnas.1407358111. Epub 2014 Aug 18.
Ref 355 A patent review of arginine methyltransferase inhibitors (2010-2018). Expert Opin Ther Pat. 2019 Feb;29(2):97-114. doi: 10.1080/13543776.2019.1567711.
Ref 356 Interaction of cisapride with the human cytochrome P450 system: metabolism and inhibition studies. Drug Metab Dispos. 2000 Jul;28(7):789-800.
Ref 357 Angiostatic activity of synthetic inhibitors of urokinase type plasminogen activator. Oncol Rep. 1999 May-Jun;6(3):523-6. doi: 10.3892/or.6.3.523.
Ref 358 Assessment of p53 gene transfer and biological activities in a clinical study of adenovirus-p53 gene therapy for recurrent ovarian cancer. Cancer Gene Ther. 2003 Mar;10(3):224-38. doi: 10.1038/sj.cgt.7700562.
Ref 359 Increased m(6)A modification of lncRNA DBH-AS1 suppresses pancreatic cancer growth and gemcitabine resistance via the miR-3163/USP44 axis. Ann Transl Med. 2022 Mar;10(6):304. doi: 10.21037/atm-22-556.
Ref 360 Leukemia-associated antigen-specific T-cell responses following combined PR1 and WT1 peptide vaccination in patients with myeloid malignancies. Blood. 2008 Jan 1;111(1):236-42. doi: 10.1182/blood-2007-08-108241. Epub 2007 Sep 17.
Ref 361 ClinicalTrials.gov (NCT03672305) Clinical Study on the Efficacy and Safety of c-Met/PD-L1 CAR-T Cell Injection in the Treatment of HCC
Ref 362 New developments in immunosuppressive therapy for heart transplantation. Expert Opin Emerg Drugs. 2009 Mar;14(1):1-21. doi: 10.1517/14728210902791605.
Ref 363 M(6)A-mediated up-regulation of LncRNA LIFR-AS1 enhances the progression of pancreatic cancer via miRNA-150-5p/ VEGFA/Akt signaling. Cell Cycle. 2021 Dec;20(23):2507-2518. doi: 10.1080/15384101.2021.1991122. Epub 2021 Oct 17.
Ref 364 A phase 1 dose escalation study of BI 831266, an inhibitor of Aurora kinase B, in patients with advanced solid tumors. Invest New Drugs. 2015 Apr;33(2):409-22. doi: 10.1007/s10637-014-0201-7. Epub 2014 Dec 23.
Ref 365 INGN-225: a dendritic cell-based p53 vaccine (Ad.p53-DC) in small cell lung cancer: observed association between immune response and enhanced chemotherapy effect. Expert Opin Biol Ther. 2010 Jun;10(6):983-91. doi: 10.1517/14712598.2010.484801.
Ref 366 The functions of N6-methyladenosine modification in lncRNAs. Genes Dis. 2020 Mar 19;7(4):598-605. doi: 10.1016/j.gendis.2020.03.005. eCollection 2020 Dec.
Ref 367 Antibody-Dependent Cellular Cytotoxicity Activity of a Novel Anti-PD-L1 Antibody Avelumab (MSB0010718C) on Human Tumor Cells. Cancer Immunol Res. 2015 Oct;3(10):1148-1157. doi: 10.1158/2326-6066.CIR-15-0059. Epub 2015 May 26.
Ref 368 Marine-Sourced Anti-Cancer and Cancer Pain Control Agents in Clinical and Late Preclinical Development. Mar Drugs. 2014 January; 12(1): 255-278.
Ref 369 Recent advances in Hsp90 inhibitors as antitumor agents. Anticancer Agents Med Chem. 2008 Oct;8(7):761-82. doi: 10.2174/187152008785914824.
Ref 370 A phase II study of ABT-510 (thrombospondin-1 analog) for the treatment of metastatic melanoma. Am J Clin Oncol. 2007 Jun;30(3):303-9. doi: 10.1097/01.coc.0000256104.80089.35.
Ref 371 A human ICAM-1 antibody isolated by a function-first approach has potent macrophage-dependent antimyeloma activity in vivo. Cancer Cell. 2013 Apr 15;23(4):502-15. doi: 10.1016/j.ccr.2013.02.026.
Ref 372 Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26. doi: 10.1517/14728214.12.1.113.
Ref 373 METTL3-stabilized lncRNA SNHG7 accelerates glycolysis in prostate cancer via SRSF1/c-Myc axis. Exp Cell Res. 2022 Jul 1;416(1):113149. doi: 10.1016/j.yexcr.2022.113149. Epub 2022 Apr 9.
Ref 374 Diabetes-enhanced tumor necrosis factor-alpha production promotes apoptosis and the loss of retinal microvascular cells in type 1 and type 2 models of diabetic retinopathy. Am J Pathol. 2008 May;172(5):1411-8. doi: 10.2353/ajpath.2008.071070. Epub 2008 Apr 10.
Ref 375 Development of AO-176, a Next-Generation Humanized Anti-CD47 Antibody with Novel Anticancer Properties and Negligible Red Blood Cell Binding. Mol Cancer Ther. 2020 Mar;19(3):835-846. doi: 10.1158/1535-7163.MCT-19-1079. Epub 2019 Dec 26.
Ref 376 Clinical pipeline report, company report or official report of Alphamab Oncology.
Ref 377 Phase I dose-escalation study of VB-111, an antiangiogenic virotherapy, in patients with advanced solid tumors. Clin Cancer Res. 2013 Jul 15;19(14):3996-4007. doi: 10.1158/1078-0432.CCR-12-2079. Epub 2013 Apr 15.
Ref 378 Inhibition of METTL3/m6A/miR126 promotes the migration and invasion of endometrial stromal cells in endometriosis?. Biol Reprod. 2021 Nov 15;105(5):1221-1233. doi: 10.1093/biolre/ioab152.
Ref 379 N(6) -methyladenosine modification of circular RNA circ-ARL3 facilitates Hepatitis B virus-associated hepatocellular carcinoma via sponging miR-1305. IUBMB Life. 2021 Feb;73(2):408-417. doi: 10.1002/iub.2438. Epub 2020 Dec 28.
Ref 380 METTL3 suppresses neuropathic pain via modulating N6-methyladenosine-dependent primary miR-150 processing. Cell Death Discov. 2022 Feb 24;8(1):80. doi: 10.1038/s41420-022-00880-2.
Ref 381 METTL3 mediates Ang-II-induced cardiac hypertrophy through accelerating pri-miR-221/222 maturation in an m6A-dependent manner. Cell Mol Biol Lett. 2022 Jul 14;27(1):55. doi: 10.1186/s11658-022-00349-1.
Ref 382 Excessive miR-25-3p maturation via N(6)-methyladenosine stimulated by cigarette smoke promotes pancreatic cancer progression. Nat Commun. 2019 Apr 23;10(1):1858. doi: 10.1038/s41467-019-09712-x.
Ref 383 ClinicalTrials.gov (NCT03473457) CAR-T Cells Therapy in Relapsed/Refractory Acute Myeloid Leukemia
Ref 384 Stimulation of Let-7 Maturation by Metformin Improved the Response to Tyrosine Kinase Inhibitor Therapy in an m6A Dependent Manner. Front Oncol. 2022 Jan 6;11:731561. doi: 10.3389/fonc.2021.731561. eCollection 2021.
Ref 385 METTL3-mediated maturation of miR-126-5p promotes ovarian cancer progression via PTEN-mediated PI3K/Akt/mTOR pathway. Cancer Gene Ther. 2021 Apr;28(3-4):335-349. doi: 10.1038/s41417-020-00222-3. Epub 2020 Sep 16.
Ref 386 N6-methyladenosine induced miR-143-3p promotes the brain metastasis of lung cancer via regulation of VASH1. Mol Cancer. 2019 Dec 10;18(1):181. doi: 10.1186/s12943-019-1108-x.
Ref 387 Clinical pipeline report, company report or official report of Roche (2009).
Ref 388 METTL3/N6-methyladenosine/ miR-21-5p promotes obstructive renal fibrosis by regulating inflammation through SPRY1/ERK/NF-KappaB pathway activation. J Cell Mol Med. 2021 Aug;25(16):7660-7674. doi: 10.1111/jcmm.16603. Epub 2021 Jun 24.
Ref 389 Overexpression of METTL3 attenuates high-glucose induced RPE cell pyroptosis by regulating miR-25-3p/PTEN/Akt signaling cascade through DGCR8. Aging (Albany NY). 2020 May 4;12(9):8137-8150. doi: 10.18632/aging.103130. Epub 2020 May 4.
Ref 390 MiR-29a-3p Improves Acute Lung Injury by Reducing Alveolar Epithelial Cell PANoptosis. Aging Dis. 2022 Jun 1;13(3):899-909. doi: 10.14336/AD.2021.1023. eCollection 2022 Jun.
Ref 391 METTL3 Induces AAA Development and Progression by Modulating N6-Methyladenosine-Dependent Primary miR34a Processing. Mol Ther Nucleic Acids. 2020 Sep 4;21:394-411. doi: 10.1016/j.omtn.2020.06.005. Epub 2020 Jun 10.
Ref 392 Silencing METTL3 Stabilizes Atherosclerotic Plaques by Regulating the Phenotypic Transformation of Vascular Smooth Muscle Cells via the miR-375-3p/PDK1 Axis. Cardiovasc Drugs Ther. 2022 Jun 15. doi: 10.1007/s10557-022-07348-6. Online ahead of print.
Ref 393 N(6)-methyladenosine-mediated miR-380-3p maturation and upregulation promotes cancer aggressiveness in pancreatic cancer. Bioengineered. 2022 Jun;13(6):14460-14471. doi: 10.1080/21655979.2022.2088497.
Ref 394 Oxygen glucose deprivation/re-oxygenation-induced neuronal cell death is associated with Lnc-D63785 m6A methylation and miR-422a accumulation. Cell Death Dis. 2020 Sep 30;11(9):816. doi: 10.1038/s41419-020-03021-8.
Ref 395 m(5) C and m(6) A modification of long noncoding NKILA accelerates cholangiocarcinoma progression via the miR-582-3p-YAP1 axis. Liver Int. 2022 May;42(5):1144-1157. doi: 10.1111/liv.15240. Epub 2022 Mar 21.
Ref 396 METTL3-mediated maturation of miR-589-5p promotes the malignant development of liver cancer. J Cell Mol Med. 2022 May;26(9):2505-2519. doi: 10.1111/jcmm.16845. Epub 2022 Mar 29.
Ref 397 METTL3/m(6)A/miRNA-873-5p Attenuated Oxidative Stress and Apoptosis in Colistin-Induced Kidney Injury by Modulating Keap1/Nrf2 Pathway. Front Pharmacol. 2019 May 15;10:517. doi: 10.3389/fphar.2019.00517. eCollection 2019.
Ref 398 Clinical pipeline report, company report or official report of Catabasis Pharmaceuticals Inc.
Ref 399 SUMOylation of methyltransferase-like 3 facilitates colorectal cancer progression by promoting circ_0000677 in an m(6) A-dependent manner. J Gastroenterol Hepatol. 2022 Apr;37(4):700-713. doi: 10.1111/jgh.15775. Epub 2022 Feb 14.
Ref 400 METTL3 regulates inflammatory pain by modulating m(6)A-dependent pri-miR-365-3p processing. FASEB J. 2020 Jan;34(1):122-132. doi: 10.1096/fj.201901555R. Epub 2019 Nov 19.
Ref 401 Methyltransferase-like 3-mediated N6-methyladenosine modification of miR-7212-5p drives osteoblast differentiation and fracture healing. J Cell Mol Med. 2020 Jun;24(11):6385-6396. doi: 10.1111/jcmm.15284. Epub 2020 Apr 19.
Ref 402 Circ0008399 Interaction with WTAP Promotes Assembly and Activity of the m(6)A Methyltransferase Complex and Promotes Cisplatin Resistance in Bladder Cancer. Cancer Res. 2021 Dec 15;81(24):6142-6156. doi: 10.1158/0008-5472.CAN-21-1518. Epub 2021 Oct 26.
Ref 403 Circ_0008542 in osteoblast exosomes promotes osteoclast-induced bone resorption through m6A methylation. Cell Death Dis. 2021 Jun 18;12(7):628. doi: 10.1038/s41419-021-03915-1.
Ref 404 IFN regulatory Factor-1 induced macrophage pyroptosis by modulating m6A modification of circ_0029589 in patients with acute coronary syndrome. Int Immunopharmacol. 2020 Sep;86:106800. doi: 10.1016/j.intimp.2020.106800. Epub 2020 Jul 13.
Ref 405 Methyltransferase-Like 3-Mediated m6A Methylation of Hsa_circ_0058493 Accelerates Hepatocellular Carcinoma Progression by Binding to YTH Domain-Containing Protein 1. Front Cell Dev Biol. 2021 Nov 23;9:762588. doi: 10.3389/fcell.2021.762588. eCollection 2021.
Ref 406 N6-methyladenosine modification of circCUX1 confers radioresistance of hypopharyngeal squamous cell carcinoma through caspase1 pathway. Cell Death Dis. 2021 Mar 19;12(4):298. doi: 10.1038/s41419-021-03558-2.
Ref 407 Leflunomide and its metabolite A771726 are high affinity substrates of BCRP: implications for drug resistance. Ann Rheum Dis. 2009 Jul;68(7):1201-7. doi: 10.1136/ard.2007.086264. Epub 2008 Apr 8.
Ref 408 Clinical pipeline report, company report or official report of Inhibrx.
Ref 409 Clinical pipeline report, company report or official report of Gan & Lee Pharmaceuticals.
Ref 410 Serdemetan antagonizes the Mdm2-HIF1Alpha axis leading to decreased levels of glycolytic enzymes. PLoS One. 2013 Sep 6;8(9):e74741. doi: 10.1371/journal.pone.0074741. eCollection 2013.
Ref 411 P-glycoprotein (ABCB1) and breast cancer resistance protein (ABCG2) restrict brain accumulation of the active sunitinib metabolite N-desethyl sunitinib. J Pharmacol Exp Ther. 2012 Apr;341(1):164-73.
Ref 412 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800012566)
Ref 413 Clinical pipeline report, company report or official report of ImmuneSensor Therapeutics.
Ref 414 Roles of CYP2A6 and CYP2B6 in nicotine C-oxidation by human liver microsomes. Arch Toxicol. 1999 Mar;73(2):65-70. doi: 10.1007/s002040050588.
Ref 415 Targeted immunotherapy for non-small cell lung cancer. World J Clin Oncol. 2014 May 10; 5(2): 39-47.
Ref 416 Apixaban. Hosp Pharm. 2013 Jun;48(6):494-509. doi: 10.1310/hpj4806-494.
Ref 417 ATP-binding cassette transporters as pitfalls in selection of transgenic cells. Anal Biochem. 2010 Apr 15;399(2):246-50.
Ref 418 Molecular determinants of a selective matrix metalloprotease-12 inhibitor: insights from crystallography and thermodynamic studies. J Med Chem. 2013 Feb 14;56(3):1149-59. doi: 10.1021/jm301574d. Epub 2013 Feb 5.
Ref 419 RNA m(6)A regulates transcription via DNA demethylation and chromatin accessibility. Nat Genet. 2022 Sep;54(9):1427-1437. doi: 10.1038/s41588-022-01173-1. Epub 2022 Sep 7.
Ref 420 Clinical pipeline report, company report or official report of Daiichi Sankyo.
Ref 421 CN patent application no. 1882326, Ppar agonists for the treatment of hcv infection.
Ref 422 ClinicalTrials.gov (NCT04839510) A Study of MRG002 in the Treatment of HER2-positive Unresectable Locally Advanced or Metastatic Urothelium Cancer. U.S. National Institutes of Health.
Ref 423 Amino Acid Transporter ATB0,+ as a delivery system for drugs and prodrugs. Curr Drug Targets Immune Endocr Metabol Disord. 2005 Dec;5(4):357-64. doi: 10.2174/156800805774912953.
Ref 424 Clinical pipeline report, company report or official report of GlycoMimetics.
Ref 425 ClinicalTrials.gov (NCT00003847) VX-710, Doxorubicin, and Vincristine for the Treatment of Patients With Recurrent Small Cell Lung Cancer. U.S. National Institutes of Health.
Ref 426 Lysosomes as a therapeutic target. Nat Rev Drug Discov. 2019 Dec;18(12):923-948. doi: 10.1038/s41573-019-0036-1. Epub 2019 Sep 2.
Ref 427 Discovery and characterization of olokizumab: a humanized antibody targeting interleukin-6 and neutralizing gp130-signaling. MAbs. 2014 May-Jun;6(3):774-82. doi: 10.4161/mabs.28612. Epub 2014 Apr 2.
Ref 428 NDA/BLA Multidisciplinary Review and Evaluation of ALUNBRIG (brigatinib) From FDA.
Ref 429 Matrix metalloproteinase-9 reduces islet amyloid formation by degrading islet amyloid polypeptide. J Biol Chem. 2013 Feb 1;288(5):3553-9. doi: 10.1074/jbc.M112.438457. Epub 2012 Dec 10.
Ref 430 High-affinity glutamate transporter GLAST/EAAT1 regulates cell surface expression of glutamine/neutral amino acid transporter ASCT2 in human fetal astrocytes. Neurochem Int. 2006 May-Jun;48(6-7):611-5. doi: 10.1016/j.neuint.2005.12.033. Epub 2006 Mar 3.
Ref 431 US patent application no. 6,498,035, Antisense modulation of MEKK3 expression.
Ref 432 Gevokizumab, an anti-IL-1Beta mAb for the potential treatment of type 1 and 2 diabetes, rheumatoid arthritis and cardiovascular disease. Curr Opin Mol Ther. 2010 Dec;12(6):755-69.
Ref 433 A novel protein encoded by circASK1 ameliorates gefitinib resistance in lung adenocarcinoma by competitively activating ASK1-dependent apoptosis. Cancer Lett. 2021 Nov 1;520:321-331. doi: 10.1016/j.canlet.2021.08.007. Epub 2021 Aug 11.
Ref 434 Identification of small molecule inhibitors of Jumonji AT-rich interactive domain 1B (JARID1B) histone demethylase by a sensitive high throughput screen. J Biol Chem. 2013 Mar 29;288(13):9408-17. doi: 10.1074/jbc.M112.419861. Epub 2013 Feb 13.
Ref 435 Clinical pipeline report, company report or official report of Genentech (2009).
Ref 436 N(6)-methyladenosine-modified circIGF2BP3 inhibits CD8(+) T-cell responses to facilitate tumor immune evasion by promoting the deubiquitination of PD-L1 in non-small cell lung cancer. Mol Cancer. 2021 Aug 20;20(1):105. doi: 10.1186/s12943-021-01398-4.
Ref 437 The selective intravenous inhibitor of the MET tyrosine kinase SAR125844 inhibits tumor growth in MET-amplified cancer. Mol Cancer Ther. 2015 Feb;14(2):384-94. doi: 10.1158/1535-7163.MCT-14-0428. Epub 2014 Dec 10.
Ref 438 Tarloxotinib Is a Hypoxia-Activated Pan-HER Kinase Inhibitor Active Against a Broad Range of HER-Family Oncogenes. Clin Cancer Res. 2021 Mar 1;27(5):1463-1475. doi: 10.1158/1078-0432.CCR-20-3555. Epub 2020 Dec 22.
Ref 439 Molecular mechanisms of resistance to the EGFR monoclonal antibody cetuximab. Cancer Biol Ther. 2011 May 1;11(9):777-92. doi: 10.4161/cbt.11.9.15050. Epub 2011 May 1.
Ref 440 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
Ref 441 US patent application no. 7,098,192, Antisense oligonucleotide modulation of STAT3 expression.
Ref 442 Trichomonas vaginalis thymidine kinase: purification, characterization and search for inhibitors. Biochem J. 1998 Aug 15;334 ( Pt 1)(Pt 1):15-22. doi: 10.1042/bj3340015.
Ref 443 Apalutamide: First Global Approval. Drugs. 2018 Apr;78(6):699-705. doi: 10.1007/s40265-018-0900-z.
Ref 444 Targeted therapies in myelodysplastic syndromes: ASH 2003 review. Semin Hematol. 2004 Apr;41(2 Suppl 4):13-20. doi: 10.1053/j.seminhematol.2004.02.003.
Ref 445 Drug interactions with lipid-lowering drugs: mechanisms and clinical relevance. Clin Pharmacol Ther. 2006 Dec;80(6):565-81. doi: 10.1016/j.clpt.2006.09.003.
Ref 446 Roles of cytochromes P450 1A2, 2A6, and 2C8 in 5-fluorouracil formation from tegafur, an anticancer prodrug, in human liver microsomes. Drug Metab Dispos. 2000 Dec;28(12):1457-63.
Ref 447 Comparative evaluation of CC chemokine-induced migration of murine CD8alpha+ and CD8alpha- dendritic cells and their in vivo trafficking. J Leukoc Biol. 2004 Feb;75(2):275-85. doi: 10.1189/jlb.1202613. Epub 2003 Nov 3.
Ref 448 A peroxisome proliferator-activated receptor alpha/gamma dual agonist with a unique in vitro profile and potent glucose and lipid effects in rodent models of type 2 diabetes and dyslipidemia. Mol Endocrinol. 2005 Jun;19(6):1593-605. doi: 10.1210/me.2005-0015. Epub 2005 Apr 14.
Ref 449 Role of focal adhesion kinase in regulating YB-1-mediated paclitaxel resistance in ovarian cancer. J Natl Cancer Inst. 2013 Oct 2;105(19):1485-95. doi: 10.1093/jnci/djt210. Epub 2013 Sep 23.
Ref 450 TAS6417, A Novel EGFR Inhibitor Targeting Exon 20 Insertion Mutations. Mol Cancer Ther. 2018 Aug;17(8):1648-1658. doi: 10.1158/1535-7163.MCT-17-1206. Epub 2018 May 10.
Ref 451 Inhibition of endothelial cell adhesion molecule expression improves colonic hyperalgaesia. Neurogastroenterol Motil. 2009 Feb;21(2):189-96. doi: 10.1111/j.1365-2982.2008.01222.x. Epub 2008 Dec 5.
Ref 452 ATP-binding cassette transporters in human heart failure. Naunyn Schmiedebergs Arch Pharmacol. 2008 May;377(3):231-43. doi: 10.1007/s00210-008-0279-6. Epub 2008 Apr 8.
Ref 453 A comparison of EGF and MAb 528 labeled with 111In for imaging human breast cancer. J Nucl Med. 2000 May;41(5):903-11.
Ref 454 Photochemical preparation of a pyridone containing tetracycle: a Jak protein kinase inhibitor. Bioorg Med Chem Lett. 2002 Apr 22;12(8):1219-23. doi: 10.1016/s0960-894x(02)00106-3.
Ref 455 Follitropin-alpha (Gonal-F) versus follitropin-beta (Puregon) in controlled ovarian hyperstimulation for in vitro fertilization: is there any difference?. Fertil Steril. 2009 Apr;91(4 Suppl):1522-5. doi: 10.1016/j.fertnstert.2008.08.112. Epub 2008 Oct 11.
Ref 456 Dual-specificity tyrosine phosphorylation-regulated kinase 1A (DYRK1A) inhibitors: a survey of recent patent literature. Expert Opin Ther Pat. 2017 Nov;27(11):1183-1199. doi: 10.1080/13543776.2017.1360285. Epub 2017 Aug 2.
Ref 457 Disposition and metabolism of the cathepsin K inhibitor odanacatib in humans. Drug Metab Dispos. 2014 May;42(5):818-27. doi: 10.1124/dmd.113.056580. Epub 2014 Feb 19.
Ref 458 Phase I and Pharmacokinetic Studies of CYT-6091, a Novel PEGylated Colloidal Gold-rhTNF Nanomedicine. Clin Cancer Res. 2010 December 15; 16(24): 6139-6149.
Ref 459 US patent application no. 6,395,545, Antisense modulation of inhibitor-kappa B kinase-alpha expression.
Ref 460 Selective androgen receptor modulators (SARMs) negatively regulate triple-negative breast cancer growth and epithelial:mesenchymal stem cell signaling. PLoS One. 2014 Jul 29;9(7):e103202. doi: 10.1371/journal.pone.0103202. eCollection 2014.
Ref 461 Discovery of the selective androgen receptor modulator MK-0773 using a rational development strategy based on differential transcriptional requirements for androgenic anabolism versus reproductive physiology. J Biol Chem. 2010 May 28;285(22):17054-64. doi: 10.1074/jbc.M109.099002. Epub 2010 Mar 31.
Ref 462 Substitution of arginine with proline and proline derivatives in melanocyte-stimulating hormones leads to selectivity for human melanocortin 4 receptor. J Med Chem. 2009 Jun 25;52(12):3627-35. doi: 10.1021/jm801300c.
Ref 463 Mechanism-based inactivation of human cytochrome P4502C8 by drugs in vitro. J Pharmacol Exp Ther. 2004 Dec;311(3):996-1007. doi: 10.1124/jpet.104.071803. Epub 2004 Aug 10.
Ref 464 ClinicalTrials.gov (NCT01935843) Treatment of Chemotherapy Refractory Human Epidermalgrowth Factor Receptor-2( HER-2) Positive Advanced Solid Tumors
Ref 465 Clinical pipeline report, company report or official report of Gilead Sciences.
Ref 466 Discovery of tetrahydroisoquinoline (THIQ) derivatives as potent and orally bioavailable LFA-1/ICAM-1 antagonists. Bioorg Med Chem Lett. 2010 Sep 1;20(17):5269-73. doi: 10.1016/j.bmcl.2010.06.145. Epub 2010 Jul 23.
Ref 467 Trimethadione metabolism by human liver cytochrome P450: evidence for the involvement of CYP2E1. Xenobiotica. 1998 Nov;28(11):1041-7. doi: 10.1080/004982598238930.
Ref 468 Characterization of the major metabolites of verapamil as substrates and inhibitors of P-glycoprotein. J Pharmacol Exp Ther. 2000 May;293(2):376-82.
Ref 469 Peroxisome proliferator-activated receptor alpha/gamma dual agonists for the treatment of type 2 diabetes. J Med Chem. 2004 Aug 12;47(17):4118-27. doi: 10.1021/jm030631e.
Ref 470 Structural basis of fatty acid substrate binding to cyclooxygenase-2. J Biol Chem. 2010 Jul 16;285(29):22152-63. doi: 10.1074/jbc.M110.119867. Epub 2010 May 12.
Ref 471 Human liver microsomal diazepam metabolism using cDNA-expressed cytochrome P450s: role of CYP2B6, 2C19 and the 3A subfamily. Xenobiotica. 1996 Nov;26(11):1155-66. doi: 10.3109/00498259609050260.
Ref 472 The transport of nifurtimox, an anti-trypanosomal drug, in an in vitro model of the human blood-brain barrier: evidence for involvement of breast cancer resistance protein. Brain Res. 2012 Feb 3;1436:111-21.
Ref 473 An integrated computational approach to the phenomenon of potent and selective inhibition of aurora kinases B and C by a series of 7-substituted indirubins. J Med Chem. 2007 Aug 23;50(17):4027-37. doi: 10.1021/jm070077z. Epub 2007 Aug 1.
Ref 474 Clinical pipeline report, company report or official report of Ichnos Sciences.
Ref 475 Clinical pipeline report, company report or official report of Glenmark Pharmaceuticals.
Ref 476 Clinical pipeline report, company report or official report of Neuronova.
Ref 477 Phase I and biomarker study of OPB-51602, a novel signal transducer and activator of transcription (STAT) 3 inhibitor, in patients with refractory solid malignancies. Ann Oncol. 2015 May;26(5):998-1005. doi: 10.1093/annonc/mdv026. Epub 2015 Jan 21.
Ref 478 Clinical pipeline report, company report or official report of CureVac.
Ref 479 Docking and molecular dynamics simulations of peroxisome proliferator activated receptors interacting with pan agonist sodelglitazar. Protein Pept Lett. 2011 Oct;18(10):1021-7. doi: 10.2174/092986611796378701.
Ref 480 Clinical pipeline report, company report or official report of ESSA Pharma.
Ref 481 National Cancer Institute Drug Dictionary (drug id 577812).
Ref 482 Pharmacokinetic effect of AMD070, an Oral CXCR4 antagonist, on CYP3A4 and CYP2D6 substrates midazolam and dextromethorphan in healthy volunteers. J Acquir Immune Defic Syndr. 2008 Apr 15;47(5):559-65. doi: 10.1097/QAI.0b013e3181627566.
Ref 483 ClinicalTrials.gov (NCT03403777) Avelumab in Refractory Testicular Germ Cell Cancer.. U.S. National Institutes of Health.
Ref 484 Differential inhibition of murine Bcrp1/Abcg2 and human BCRP/ABCG2 by the mycotoxin fumitremorgin C. Eur J Pharmacol. 2010 Oct 10;644(1-3):41-8. doi: 10.1016/j.ejphar.2010.07.016. Epub 2010 Jul 22.
Ref 485 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 253).
Ref 486 Phase II randomised proof-of-concept study of the urokinase inhibitor upamostat (WX-671) in combination with gemcitabine compared with gemcitabine alone in patients with non-resectable, locally advanced pancreatic cancer. Br J Cancer. 2013 Mar 5;108(4):766-70. doi: 10.1038/bjc.2013.62. Epub 2013 Feb 14.
Ref 487 Anti-tumor activity and toxicokinetics analysis of MGAH22, an anti-HER2 monoclonal antibody with enhanced Fcgamma receptor binding properties. Breast Cancer Res. 2011; 13(6): R123.
Ref 488 Modulation of Anti-Tumor Necrosis Factor Alpha (TNF-alpha) Antibody Secretion in Mice Immunized with TNF-alpha Kinoid. Clin Vaccine Immunol. 2012 May; 19(5): 699-703.
Ref 489 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1728).
Ref 490 N(6)-methyladenosine-dependent pri-miR-17-92 maturation suppresses PTEN/TMEM127 and promotes sensitivity to everolimus in gastric cancer. Cell Death Dis. 2020 Oct 9;11(10):836. doi: 10.1038/s41419-020-03049-w.
Ref 491 Generation and characterization of ABT-981, a dual variable domain immunoglobulin (DVD-Ig(TM)) molecule that specifically and potently neutralizes both IL-1Alpha and IL-1Beta. MAbs. 2015;7(3):605-19. doi: 10.1080/19420862.2015.1026501.
Ref 492 Pharmacokinetics, pharmacodynamics, safety and tolerability of APG101, a CD95-Fc fusion protein, in healthy volunteers and two glioma patients. Int Immunopharmacol. 2012 May;13(1):93-100. doi: 10.1016/j.intimp.2012.03.004. Epub 2012 Mar 21.
Ref 493 The novel Nrf2 inducer TFM-735 ameliorates experimental autoimmune encephalomyelitis in mice. Eur J Pharmacol. 2017 May 5;802:76-84. doi: 10.1016/j.ejphar.2017.02.044. Epub 2017 Feb 27.
Ref 494 The application of target information and preclinical pharmacokinetic/pharmacodynamic modeling in predicting clinical doses of a Dickkopf-1 antibody for osteoporosis. J Pharmacol Exp Ther. 2010 Apr;333(1):2-13. doi: 10.1124/jpet.109.164129. Epub 2010 Jan 20.
Ref 495 The manganese superoxide dismutase mimetic, M40403, protects adult mice from lethal total body irradiation. Free Radic Res. 2010 May;44(5):529-40. doi: 10.3109/10715761003649578.
Ref 496 Antisense oligonucleotides demonstrate a dominant role of c-Ki-RAS proteins in regulating the proliferation of diploid human fibroblasts. J Biol Chem. 1996 Nov 8;271(45):28259-65. doi: 10.1074/jbc.271.45.28259.
Ref 497 Boehringer Ingelheim. Product Development Pipeline. June 2 2009.
Ref 498 Bioactivities of simplified adociaquinone B and naphthoquinone derivatives against Cdc25B, MKP-1, and MKP-3 phosphatases. Bioorg Med Chem. 2009 Mar 15;17(6):2276-81. doi: 10.1016/j.bmc.2008.10.090. Epub 2008 Nov 8.
Ref 499 Fingerprint-based in silico models for the prediction of P-glycoprotein substrates and inhibitors. Bioorg Med Chem. 2012 Sep 15;20(18):5388-95.
Ref 500 Co-administration of proton pump inhibitors delays elimination of plasma methotrexate in high-dose methotrexate therapy. Br J Clin Pharmacol. 2009 Jan;67(1):44-9. doi: 10.1111/j.1365-2125.2008.03303.x. Epub 2008 Nov 17.
Ref 501 Interplay of m(6)A and H3K27 trimethylation restrains inflammation during bacterial infection. Sci Adv. 2020 Aug 19;6(34):eaba0647. doi: 10.1126/sciadv.aba0647. eCollection 2020 Aug.
Ref 502 Further Characterization of the Metabolism of Desloratadine and Its Cytochrome P450 and UDP-glucuronosyltransferase Inhibition Potential: Identification of Desloratadine as a Relatively Selective UGT2B10 Inhibitor. Drug Metab Dispos. 2015 Sep;43(9):1294-302. doi: 10.1124/dmd.115.065011. Epub 2015 Jul 1.
Ref 503 Retinoic acid biosynthesis catalyzed by retinal dehydrogenases relies on a rate-limiting conformational transition associated with substrate recognition. Chem Biol Interact. 2013 Feb 25;202(1-3):78-84. doi: 10.1016/j.cbi.2012.11.019. Epub 2012 Dec 7.
Ref 504 Beneficial effect of a CXCR4 agonist in murine models of systemic inflammation. Inflammation. 2012 Feb;35(1):130-7. doi: 10.1007/s10753-011-9297-5.
Ref 505 Multi-drug-resistance-reverting agents: 2-aryloxazole and 2-arylthiazole derivatives as potent BCRP or MRP1 inhibitors. ChemMedChem. 2009 Feb;4(2):188-95.
Ref 506 The Role of Levomilnacipran in the Management of Major Depressive Disorder: A Comprehensive Review. Curr Neuropharmacol. 2016;14(2):191-9. doi: 10.2174/1570159x14666151117122458.
Ref 507 Metabolism of capsaicin by cytochrome P450 produces novel dehydrogenated metabolites and decreases cytotoxicity to lung and liver cells. Chem Res Toxicol. 2003 Mar;16(3):336-49. doi: 10.1021/tx025599q.
Ref 508 Antitumor Activity of Amivantamab (JNJ-61186372), an EGFR-MET Bispecific Antibody, in Diverse Models of EGFR Exon 20 Insertion-Driven NSCLC. Cancer Discov. 2020 Aug;10(8):1194-1209. doi: 10.1158/2159-8290.CD-20-0116. Epub 2020 May 15.
Ref 509 Intravenous hydrophobic drug delivery: a porous particle formulation of paclitaxel (AI-850). Pharm Res. 2005 Mar;22(3):347-55. doi: 10.1007/s11095-004-1871-1.
Ref 510 Clinical pipeline report, company report or official report of Ono Pharmaceutical.
Ref 511 Discovery and Development of Potent LFA-1/ICAM-1 Antagonist SAR 1118 as an Ophthalmic Solution for Treating Dry Eye. ACS Med Chem Lett. 2012 Jan 31;3(3):203-6. doi: 10.1021/ml2002482. eCollection 2012 Mar 8.
Ref 512 Inhibition of experimental periodontitis by a topical boron-based antimicrobial. J Dent Res. 2008 Feb;87(2):148-52. doi: 10.1177/154405910808700208.
Ref 513 Mechanism of action of fibrates on lipid and lipoprotein metabolism. Circulation. 1998 Nov 10;98(19):2088-93. doi: 10.1161/01.cir.98.19.2088.
Ref 514 Possible involvement of multiple human cytochrome P450 isoforms in the liver metabolism of propofol. Br J Anaesth. 1998 Jun;80(6):788-95. doi: 10.1093/bja/80.6.788.
Ref 515 Drug evaluation: TG-1042, an adenovirus-mediated IFNgamma gene delivery for the intratumoral therapy of primary cutaneous lymphomas. Curr Opin Investig Drugs. 2007 Jun;8(6):493-8.
Ref 516 AGIX-4207 [2-[4-[[1-[[3,5-bis(1,1-dimethylethyl)-4-hydroxyphenyl]thio]-1-methylethyl]thio]-2,6-bis(1,1-dimethylethyl)phenoxy]acetic acid], a novel antioxidant and anti-inflammatory compound: cellular and biochemical characterization of antioxidant activity and inhibition of redox-sensitive inflammatory gene expression. J Pharmacol Exp Ther. 2005 May;313(2):492-501. doi: 10.1124/jpet.104.080804. Epub 2005 Feb 8.
Ref 517 Phosphorylation of the immunomodulatory drug FTY720 by sphingosine kinases. J Biol Chem. 2003 Nov 28;278(48):47408-15. doi: 10.1074/jbc.M307687200. Epub 2003 Sep 16.
Ref 518 Her2/neu is not a commonly expressed therapeutic target in melanoma -- a large cohort tissue microarray study. Melanoma Res. 2004 Jun;14(3):207-10. doi: 10.1097/01.cmr.0000130874.33504.2f.
Ref 519 Designing drugs for the treatment of female sexual dysfunction. Drug Discov Today. 2007 Sep;12(17-18):757-66. doi: 10.1016/j.drudis.2007.07.007. Epub 2007 Aug 27.
Ref 520 Clinical pipeline report, company report or official report of vTv Therapeutics.
Ref 521 NMS-P293, a PARP-1 selective inhibitor with no trapping activity and high CNS penetration, possesses potent in vivo efficacy and represents a novel therapeutic option for brain localized metastases and glioblastoma. Cancer Res 2018;78(13 Suppl):Abstract nr 4843.
Ref 522 AZD9291, an irreversible EGFR TKI, overcomes T790M-mediated resistance to EGFR inhibitors in lung cancer. Cancer Discov. 2014 Sep;4(9):1046-61. doi: 10.1158/2159-8290.CD-14-0337. Epub 2014 Jun 3.
Ref 523 Pazopanib, a new therapy for metastatic soft tissue sarcoma. Expert Opin Pharmacother. 2013 May;14(7):929-35. doi: 10.1517/14656566.2013.780030. Epub 2013 Mar 14.
Ref 524 Extra-renal elimination of uric acid via intestinal efflux transporter BCRP/ABCG2. PLoS One. 2012;7(2):e30456.
Ref 525 Clinical pipeline report, company report or official report of PsiOxus Therapeutics.
Ref 526 ClinicalTrials.gov (NCT01686334) Efficacy Study of Dendritic Cell Vaccination in Patients With Acute Myeloid Leukemia in Remission. U.S. National Institutes of Health.
Ref 527 US patent application no. 6,159,734, Antisense modulation of peroxisome proliferator-activated receptor gamma expression.
Ref 528 Evaluation of in vitro drug interactions with karenitecin, a novel, highly lipophilic camptothecin derivative in phase II clinical development. J Clin Pharmacol. 2003 Sep;43(9):1008-14. doi: 10.1177/0091270003255921.
Ref 529 National Cancer Institute Drug Dictionary (drug name PF-06939999).
Ref 530 Drug efflux transporters, MRP1 and BCRP, affect the outcome of hypericin-mediated photodynamic therapy in HT-29 adenocarcinoma cells. Photochem Photobiol Sci. 2009 Dec;8(12):1716-23.
Ref 531 ClinicalTrials.gov (NCT02541370) Treatment of Relapsed and/or Chemotherapy Refractory Advanced Malignancies by CART133
Ref 532 Clinical pipeline report, company report or official report of Boehringer Ingelheim.
Ref 533 Body weight, gender and pregnancy affect enantiomer-specific ketorolac pharmacokinetics. Br J Clin Pharmacol. 2017 Sep;83(9):1966-1975. doi: 10.1111/bcp.13311. Epub 2017 May 14.
Ref 534 The design, synthesis, and biological evaluation of potent receptor tyrosine kinase inhibitors. Bioorg Med Chem Lett. 2012 Aug 1;22(15):4979-85. doi: 10.1016/j.bmcl.2012.06.029. Epub 2012 Jun 16.
Ref 535 Potent and selective PPAR-alpha agonist LY518674 upregulates both ApoA-I production and catabolism in human subjects with the metabolic syndrome. Arterioscler Thromb Vasc Biol. 2009 Jan;29(1):140-6. doi: 10.1161/ATVBAHA.108.171223. Epub 2008 Nov 6.
Ref 536 AZD3514: a small molecule that modulates androgen receptor signaling and function in vitro and in vivo. Mol Cancer Ther. 2013 Sep;12(9):1715-27. doi: 10.1158/1535-7163.MCT-12-1174. Epub 2013 Jul 16.
Ref 537 Lipid dependence of ABC transporter localization and function. Chem Phys Lipids. 2009 Oct;161(2):57-64.
Ref 538 Clinical pipeline report, company report or official report of BeiGene.
Ref 539 US patent application no. 7,427,470, Antisense modulation of helicase-moi expression.
Ref 540 Long noncoding RNA pncRNA-D reduces cyclin D1 gene expression and arrests cell cycle through RNA m(6)A modification. J Biol Chem. 2020 Apr 24;295(17):5626-5639. doi: 10.1074/jbc.RA119.011556. Epub 2020 Mar 12.
Ref 541 A novel arginine methyltransferase inhibitor with cellular activity. Bioorg Med Chem Lett. 2007 Aug 1;17(15):4150-3. doi: 10.1016/j.bmcl.2007.05.088. Epub 2007 Jun 3.
Ref 542 Loss of m(6)A methyltransferase METTL3 promotes heart regeneration and repair after myocardial injury. Pharmacol Res. 2021 Dec;174:105845. doi: 10.1016/j.phrs.2021.105845. Epub 2021 Aug 21.
Ref 543 Emerging therapies targeting the ubiquitin proteasome system in cancer. J Clin Invest. 2014 Jan;124(1):6-12. doi: 10.1172/JCI71602. Epub 2014 Jan 2.
Ref 544 Biological evaluation of a multi-targeted small molecule inhibitor of tumor-induced angiogenesis. Bioorg Med Chem Lett. 2006 Apr 1;16(7):1950-3. doi: 10.1016/j.bmcl.2005.12.092. Epub 2006 Feb 3.
Ref 545 2,3,5-Trisubstituted pyridines as selective AKT inhibitors. Part II: Improved drug-like properties and kinase selectivity from azaindazoles. Bioorg Med Chem Lett. 2010 Jan 15;20(2):679-83. doi: 10.1016/j.bmcl.2009.11.060. Epub 2009 Nov 20.
Ref 546 Efficacy of piroxicam for postoperative pain after lower third molar surgery associated with CYP2C8*3 and CYP2C9. J Pain Res. 2017 Jul 6;10:1581-1589. doi: 10.2147/JPR.S138147. eCollection 2017.
Ref 547 Overexpression of m6A-factors METTL3, ALKBH5, and YTHDC1 alters HPV16 mRNA splicing. Virus Genes. 2022 Apr;58(2):98-112. doi: 10.1007/s11262-022-01889-6. Epub 2022 Feb 21.
Ref 548 ClinicalTrials.gov (NCT02575261) CAR-T Cell Immunotherapy for EphA2 Positive Malignant Glioma Patients
Ref 549 Potential role of drug transporters in the pathogenesis of medically intractable epilepsy. Epilepsia. 2005 Feb;46(2):224-35.
Ref 550 131I-anti-CD45 antibody plus busulfan and cyclophosphamide before allogeneic hematopoietic cell transplantation for treatment of acute myeloid leukemia in first remission. Blood. 2006 Mar 1;107(5):2184-91. doi: 10.1182/blood-2005-06-2317. Epub 2005 Oct 27.
Ref 551 Effects of gemfibrozil, itraconazole, and their combination on the pharmacokinetics of pioglitazone. Clin Pharmacol Ther. 2005 May;77(5):404-14. doi: 10.1016/j.clpt.2004.12.266.
Ref 552 Novel and selective DNA methyltransferase inhibitors: Docking-based virtual screening and experimental evaluation. Bioorg Med Chem. 2010 Jan 15;18(2):822-9. doi: 10.1016/j.bmc.2009.11.050. Epub 2009 Nov 27.
Ref 553 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1875).
Ref 554 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2049).
Ref 555 Protein lysine methyltransferase G9a inhibitors: design, synthesis, and structure activity relationships of 2,4-diamino-7-aminoalkoxy-quinazolines. J Med Chem. 2010 Aug 12;53(15):5844-57. doi: 10.1021/jm100478y.
Ref 556 US patent application no. 5,968,748, Antisense oligonucleotide modulation of human HER-2 expression.
Ref 557 EP patent application no. 2275103, Mtor inhibitors in the treatment of endocrine tumors.
Ref 558 Nuclear export of chimeric mRNAs depends on an lncRNA-triggered autoregulatory loop in blood malignancies. Cell Death Dis. 2020 Jul 23;11(7):566. doi: 10.1038/s41419-020-02795-1.
Ref 559 The B-cell lymphoma 2 (BCL2)-inhibitors, ABT-737 and ABT-263, are substrates for P-glycoprotein. Biochem Biophys Res Commun. 2011 May 6;408(2):344-9.
Ref 560 US patent application no. 6,187,586, Antisense modulation of AKT-3 expression.
Ref 561 Melanocortin Receptor Agonists Facilitate Oxytocin-Dependent Partner Preference Formation in the Prairie Vole. Neuropsychopharmacology. 2015 Jul;40(8):1856-65. doi: 10.1038/npp.2015.35. Epub 2015 Feb 5.
Ref 562 Clinical pipeline report, company report or official report of Oncotelic.
Ref 563 Identification of compounds that correlate with ABCG2 transporter function in the National Cancer Institute Anticancer Drug Screen. Mol Pharmacol. 2009 Nov;76(5):946-56.
Ref 564 Triple negative breast cancer--current status and prospective targeted treatment based on HER1 (EGFR), TOP2A and C-MYC gene assessment. Biomed Pap Med Fac Univ Palacky Olomouc Czech Repub. 2009 Mar;153(1):13-7. doi: 10.5507/bp.2009.002.
Ref 565 Catalytic properties of polymorphic human cytochrome P450 1B1 variants. Carcinogenesis. 1999 Aug;20(8):1607-13. doi: 10.1093/carcin/20.8.1607.
Ref 566 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2844).
Ref 567 Alectinib (CH5424802) antagonizes ABCB1- and ABCG2-mediated multidrug resistance in vitro, in vivo and ex vivo. Exp Mol Med. 2017 Mar 17;49(3):e303. doi: 10.1038/emm.2016.168.
Ref 568 Contribution of P-glycoprotein to bunitrolol efflux across blood-brain barrier. Biopharm Drug Dispos. 1999 Mar;20(2):85-90.
Ref 569 P-glycoprotein and breast cancer resistance protein in acute myeloid leukaemia cells treated with the aurora-B kinase inhibitor barasertib-hQPA. BMC Cancer. 2011 Jun 16;11:254.
Ref 570 AXL receptor tyrosine kinase as a promising anti-cancer approach: functions, molecular mechanisms and clinical applications. Mol Cancer. 2019 Nov 4;18(1):153. doi: 10.1186/s12943-019-1090-3.
Ref 571 The novel BCR-ABL and FLT3 inhibitor ponatinib is a potent inhibitor of the MDR-associated ATP-binding cassette transporter ABCG2. Mol Cancer Ther. 2012 Sep;11(9):2033-44. doi: 10.1158/1535-7163.MCT-12-0302. Epub 2012 Jul 9.
Ref 572 EPI-001 is a selective peroxisome proliferator-activated receptor-gamma modulator with inhibitory effects on androgen receptor expression and activity in prostate cancer. Oncotarget. 2015 Feb 28;6(6):3811-24. doi: 10.18632/oncotarget.2924.
Ref 573 P-glycoprotein efflux at the blood-brain barrier mediates differences in brain disposition and pharmacodynamics between two structurally related neurokinin-1 receptor antagonists. J Pharmacol Exp Ther. 2001 Sep;298(3):1252-9.
Ref 574 Metabolism and bioactivation of famitinib, a novel inhibitor of receptor tyrosine kinase, in cancer patients. Br J Pharmacol. 2013 Apr;168(7):1687-706. doi: 10.1111/bph.12047.
Ref 575 The Ryanodine Receptor Stabilizer S44121 / Arm036 Improves Peripheral and Respiratory Muscle Function in a Mouse Model of Heart Failure. Circulation. 2014; 130: A13726.
Ref 576 In?vitro metabolism of fenofibric acid by carbonyl reducing enzymes. Chem Biol Interact. 2016 Oct 25;258:153-8. doi: 10.1016/j.cbi.2016.09.001. Epub 2016 Sep 4.
Ref 577 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1496).
Ref 578 Interaction of nilotinib, dasatinib and bosutinib with ABCB1 and ABCG2: implications for altered anti-cancer effects and pharmacological properties. Br J Pharmacol. 2009 Oct;158(4):1153-64. doi: 10.1111/j.1476-5381.2009.00383.x. Epub 2009 Sep 28.
Ref 579 Pharmacokinetics, safety, and tolerability of saroglitazar (ZYH1), a predominantly PPARAlpha agonist with moderate PPARGamma agonist activity in healthy human subjects. Clin Drug Investig. 2013 Nov;33(11):809-16. doi: 10.1007/s40261-013-0128-3.
Ref 580 The m6A writers regulated by the IL-6/STAT3 inflammatory pathway facilitate cancer cell stemness in cholangiocarcinoma. Cancer Biol Med. 2021 Aug 4;19(3):343-57. doi: 10.20892/j.issn.2095-3941.2020.0661. Online ahead of print.
Ref 581 MBX-102/JNJ39659100, a novel peroxisome proliferator-activated receptor-ligand with weak transactivation activity retains antidiabetic properties in the absence of weight gain and edema. Mol Endocrinol. 2009 Jul;23(7):975-88. doi: 10.1210/me.2008-0473. Epub 2009 Apr 23.
Ref 582 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2771).
Ref 583 The mannose-6-phosphate analogue, PXS64, inhibits fibrosis via TGF-Beta1 pathway in human lung fibroblasts. Immunol Lett. 2015 Jun;165(2):90-101. doi: 10.1016/j.imlet.2015.04.003. Epub 2015 Apr 27.
Ref 584 Tyrosine kinase inhibitors. 9. Synthesis and evaluation of fused tricyclic quinazoline analogues as ATP site inhibitors of the tyrosine kinase activity of the epidermal growth factor receptor. J Med Chem. 1996 Feb 16;39(4):918-28. doi: 10.1021/jm950692f.
Ref 585 Structural basis for inhibitor specificity in human poly(ADP-ribose) polymerase-3. J Med Chem. 2009 May 14;52(9):3108-11. doi: 10.1021/jm900052j.
Ref 586 Metabolism, excretion and pharmacokinetics of [(14)C]glasdegib (PF-04449913) in healthy volunteers following oral administration. Xenobiotica. 2017 Dec;47(12):1064-1076. doi: 10.1080/00498254.2016.1261307. Epub 2017 Jan 3.
Ref 587 A RNA antagonist of hypoxia-inducible factor-1alpha, EZN-2968, inhibits tumor cell growth. Mol Cancer Ther. 2008 Nov;7(11):3598-608. doi: 10.1158/1535-7163.MCT-08-0510. Epub 2008 Oct 30.
Ref 588 National Cancer Institute Drug Dictionary (drug id 740856).
Ref 589 PharmGKB summary: mycophenolic acid pathway. Pharmacogenet Genomics. 2014 Jan;24(1):73-9. doi: 10.1097/FPC.0000000000000010.
Ref 590 N(6)-methyladenosine mediates the cellular proliferation and apoptosis via microRNAs in arsenite-transformed cells. Toxicol Lett. 2018 Aug;292:1-11. doi: 10.1016/j.toxlet.2018.04.018. Epub 2018 Apr 20.
Ref 591 N(6) -Methyladenosine Negatively Regulates Human Respiratory Syncytial Virus Replication. Front Cell Dev Biol. 2021 Oct 4;9:739445. doi: 10.3389/fcell.2021.739445. eCollection 2021.
Ref 592 Targeting m6A modification inhibits herpes virus 1 infection. Genes Dis. 2021 Feb 22;9(4):1114-1128. doi: 10.1016/j.gendis.2021.02.004. eCollection 2022 Jul.
Ref 593 N?-Methyladenosine Landscape of Glioma Stem-Like Cells: METTL3 Is Essential for the Expression of Actively Transcribed Genes and Sustenance of the Oncogenic Signaling. Genes (Basel). 2019 Feb 13;10(2):141. doi: 10.3390/genes10020141.
Ref 594 Association between METTL3 gene polymorphisms and neuroblastoma susceptibility: A nine-centre case-control study. J Cell Mol Med. 2020 Aug;24(16):9280-9286. doi: 10.1111/jcmm.15576. Epub 2020 Jul 2.
Ref 595 Small-molecule inhibition of METTL3 as a strategy against myeloid leukaemia. Nature. 2021 May;593(7860):597-601. doi: 10.1038/s41586-021-03536-w. Epub 2021 Apr 26.
Ref 596 Overexpression of methyltransferase-like 3 and 14 in oral squamous cell carcinoma. J Oral Pathol Med. 2022 Feb;51(2):134-145. doi: 10.1111/jop.13256. Epub 2021 Nov 3.
Ref 597 2005 approvals: Safety first. Nature Reviews Drug Discovery 5, 92-93 (February 2006).
Ref 598 RNA methylation-mediated LINC01559 suppresses colorectal cancer progression by regulating the miR-106b-5p/PTEN axis. Int J Biol Sci. 2022 Apr 24;18(7):3048-3065. doi: 10.7150/ijbs.70630. eCollection 2022.
Ref 599 Gene Signature and Identification of Clinical Trait-Related m(6) A Regulators in Pancreatic Cancer. Front Genet. 2020 Jul 10;11:522. doi: 10.3389/fgene.2020.00522. eCollection 2020.
Ref 600 The epitranscriptome m6A writer METTL3 promotes chemo- and radioresistance in pancreatic cancer cells. Int J Oncol. 2018 Feb;52(2):621-629. doi: 10.3892/ijo.2017.4219. Epub 2017 Dec 7.
Ref 601 The RNA m6A methyltransferase METTL3 promotes pancreatic cancer cell proliferation and invasion. Pathol Res Pract. 2019 Nov;215(11):152666. doi: 10.1016/j.prp.2019.152666. Epub 2019 Sep 24.
Ref 602 The effect of ABCG2 V12M, Q141K and Q126X, known functional variants in vitro, on the disposition of lamivudine. Br J Clin Pharmacol. 2007 Nov;64(5):645-54. doi: 10.1111/j.1365-2125.2007.02944.x. Epub 2007 May 17.
Ref 603 Contributions and Prognostic Values of N6-Methyladenosine RNA Methylation Regulators in Hepatocellular Carcinoma. Front Genet. 2021 Jan 15;11:614566. doi: 10.3389/fgene.2020.614566. eCollection 2020.
Ref 604 The Role of RNA Methyltransferase METTL3 in Hepatocellular Carcinoma: Results and Perspectives. Front Cell Dev Biol. 2021 May 11;9:674919. doi: 10.3389/fcell.2021.674919. eCollection 2021.
Ref 605 The cancer-testis lncRNA lnc-CTHCC promotes hepatocellular carcinogenesis by binding hnRNP K and activating YAP1 transcription. Nat Cancer. 2022 Feb;3(2):203-218. doi: 10.1038/s43018-021-00315-4. Epub 2022 Jan 10.
Ref 606 miR-302a-3p suppresses melanoma cell progression via targeting METTL3. J Chemother. 2022 Feb;34(1):55-66. doi: 10.1080/1120009X.2021.1953886. Epub 2021 Jul 21.
Ref 607 METTL3 regulates m6A in endometrioid epithelial ovarian cancer independently of METTl14 and WTAP. Cell Biol Int. 2020 Dec;44(12):2524-2531. doi: 10.1002/cbin.11459. Epub 2020 Sep 11.
Ref 608 Connecting METTL3 and intratumoural CD33(+) MDSCs in predicting clinical outcome in cervical cancer. J Transl Med. 2020 Oct 15;18(1):393. doi: 10.1186/s12967-020-02553-z.
Ref 609 Gene signatures and prognostic values of m6A regulators in clear cell renal cell carcinoma - a retrospective study using TCGA database. Aging (Albany NY). 2019 Mar 15;11(6):1633-1647. doi: 10.18632/aging.101856.
Ref 610 Interplay between RNA Methylation Eraser FTO and Writer METTL3 in Renal Clear Cell Carcinoma Patient Survival. Recent Pat Anticancer Drug Discov. 2021;16(3):363-376. doi: 10.2174/1574892816666210204125155.
Ref 611 RNA N (6)-Methyladenosine Modification in Normal and Malignant Hematopoiesis. Adv Exp Med Biol. 2019;1143:75-93. doi: 10.1007/978-981-13-7342-8_4.
Ref 612 The RNA Methyltransferase Complex of WTAP, METTL3, and METTL14 Regulates Mitotic Clonal Expansion in Adipogenesis. Mol Cell Biol. 2018 Jul 30;38(16):e00116-18. doi: 10.1128/MCB.00116-18. Print 2018 Aug 15.
Ref 613 Abnormality of m6A mRNA Methylation Is Involved in Alzheimer's Disease. Front Neurosci. 2020 Feb 28;14:98. doi: 10.3389/fnins.2020.00098. eCollection 2020.
Ref 614 METTL3-dependent RNA m(6)A dysregulation contributes to neurodegeneration in Alzheimer's disease through aberrant cell cycle events. Mol Neurodegener. 2021 Sep 30;16(1):70. doi: 10.1186/s13024-021-00484-x.
Ref 615 Altered Expression of the m6A Methyltransferase METTL3 in Alzheimer's Disease. eNeuro. 2020 Sep 8;7(5):ENEURO.0125-20.2020. doi: 10.1523/ENEURO.0125-20.2020. Print 2020 Sep/Oct.
Ref 616 Estradiol induces export of sphingosine 1-phosphate from breast cancer cells via ABCC1 and ABCG2. J Biol Chem. 2010 Apr 2;285(14):10477-86. doi: 10.1074/jbc.M109.064162. Epub 2010 Jan 28.
Ref 617 N6-methyladenosine methyltransferase METTL3 affects the phenotype of cerebral arteriovenous malformation via modulating Notch signaling pathway. J Biomed Sci. 2020 May 9;27(1):62. doi: 10.1186/s12929-020-00655-w.
Ref 618 METTL3 regulates skeletal muscle specific miRNAs at both transcriptional and post-transcriptional levels. Biochem Biophys Res Commun. 2021 May 7;552:52-58. doi: 10.1016/j.bbrc.2021.03.035. Epub 2021 Mar 17.
Ref 619 Distinct roles of Fto and Mettl3 in controlling development of the cerebral cortex through transcriptional and translational regulations. Cell Death Dis. 2021 Jul 14;12(7):700. doi: 10.1038/s41419-021-03992-2.
Ref 620 METTL3 attenuates proliferative vitreoretinopathy and epithelial-mesenchymal transition of retinal pigment epithelial cells via wnt/Beta-catenin pathway. J Cell Mol Med. 2021 May;25(9):4220-4234. doi: 10.1111/jcmm.16476. Epub 2021 Mar 23.
Ref 621 Role of METTL3-Dependent N(6)-Methyladenosine mRNA Modification in the Promotion of Angiogenesis. Mol Ther. 2020 Oct 7;28(10):2191-2202. doi: 10.1016/j.ymthe.2020.07.022. Epub 2020 Jul 25.
Ref 622 The effect of intravenous interferon-beta-1a (FP-1201) on lung CD73 expression and on acute respiratory distress syndrome mortality: an open-label study. Lancet Respir Med. 2014 Feb;2(2):98-107. doi: 10.1016/S2213-2600(13)70259-5. Epub 2013 Dec 23.
Ref 623 Follicle-stimulating hormone in clinical practice: an update. Treat Endocrinol. 2004;3(3):161-71. doi: 10.2165/00024677-200403030-00004.
Ref 624 The N(6)-Methyladenosine mRNA Methylase METTL3 Controls Cardiac Homeostasis and Hypertrophy. Circulation. 2019 Jan 22;139(4):533-545. doi: 10.1161/CIRCULATIONAHA.118.036146.
Ref 625 Transport of butyryl-L-carnitine, a potential prodrug, via the carnitine transporter OCTN2 and the amino acid transporter ATB(0,+). Am J Physiol Gastrointest Liver Physiol. 2007 Nov;293(5):G1046-53. doi: 10.1152/ajpgi.00233.2007. Epub 2007 Sep 13.
Ref 626 Resveratrol Attenuates High-Fat Diet Induced Hepatic Lipid Homeostasis Disorder and Decreases m(6)A RNA Methylation. Front Pharmacol. 2020 Dec 18;11:568006. doi: 10.3389/fphar.2020.568006. eCollection 2020.
Ref 627 Elucidation of the Impact of P-glycoprotein and Breast Cancer Resistance Protein on the Brain Distribution of Catechol-O-Methyltransferase Inhibitors. Drug Metab Dispos. 2017 Dec;45(12):1282-1291. doi: 10.1124/dmd.117.077883. Epub 2017 Sep 15.
Ref 628 METTL3 Attenuates LPS-Induced Inflammatory Response in Macrophages via NF-KappaB Signaling Pathway. Mediators Inflamm. 2019 Oct 24;2019:3120391. doi: 10.1155/2019/3120391. eCollection 2019.
Ref 629 METTL3-m(6) A methylase regulates the osteogenic potential of bone marrow mesenchymal stem cells in osteoporotic rats via the Wnt signalling pathway. Cell Prolif. 2022 May;55(5):e13234. doi: 10.1111/cpr.13234. Epub 2022 Apr 25.
Ref 630 Meclofenamic acid represses spermatogonial proliferation through modulating m(6)A RNA modification. J Anim Sci Biotechnol. 2019 Jul 11;10:63. doi: 10.1186/s40104-019-0361-6. eCollection 2019.
Ref 631 Mettl3-/Mettl14-mediated mRNA N(6)-methyladenosine modulates murine spermatogenesis. Cell Res. 2017 Oct;27(10):1216-1230. doi: 10.1038/cr.2017.117. Epub 2017 Sep 15.
Ref 632 Clinical pipeline report, company report or official report of GeneQuantum Healthcare.
Ref 633 METTL3-mediated m6A modification is required for cerebellar development. PLoS Biol. 2018 Jun 7;16(6):e2004880. doi: 10.1371/journal.pbio.2004880. eCollection 2018 Jun.
Ref 634 Pegylated interferon Beta-1a for relapsing-remitting multiple sclerosis (ADVANCE): a randomised, phase 3, double-blind study. Lancet Neurol. 2014 Jul;13(7):657-65. doi: 10.1016/S1474-4422(14)70068-7. Epub 2014 Apr 30.
Ref 635 SNX-2112, a selective Hsp90 inhibitor, potently inhibits tumor cell growth, angiogenesis, and osteoclastogenesis in multiple myeloma and other hematologic tumors by abrogating signaling via Akt and ERK. Blood. 2009 Jan 22;113(4):846-55. doi: 10.1182/blood-2008-04-151928. Epub 2008 Oct 23.
Ref 636 Multi-omic analysis of altered transcriptome and epigenetic signatures in the UV-induced DNA damage response. DNA Repair (Amst). 2021 Oct;106:103172. doi: 10.1016/j.dnarep.2021.103172. Epub 2021 Jul 15.
Ref 637 Targeting the m(6)A RNA modification pathway blocks SARS-CoV-2 and HCoV-OC43 replication. Genes Dev. 2021 Jul 1;35(13-14):1005-1019. doi: 10.1101/gad.348320.121. Epub 2021 Jun 24.
Ref 638 Discovery of Potent and Selective Inhibitors for G9a-Like Protein (GLP) Lysine Methyltransferase. J Med Chem. 2017 Mar 9;60(5):1876-1891. doi: 10.1021/acs.jmedchem.6b01645. Epub 2017 Feb 14.