m6A Regulator Information

General Information of the m6A Regulator (ID: REG00013)
Regulator Name Insulin-like growth factor 2 mRNA-binding protein 2 (IGF2BP2)
Synonyms
IGF2 mRNA-binding protein 2; IMP-2; Hepatocellular carcinoma autoantigen p62; IGF-II mRNA-binding protein 2; VICKZ family member 2; IMP2; VICKZ2
    Click to Show/Hide
Gene Name IGF2BP2
Sequence
MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSG
KVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTET
AVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQG
HAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEK
PVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKI
EHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFENDMLAVNQQA
NLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPH
HHSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITG
PPEAQFKAQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTS
AEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK
    Click to Show/Hide
Family RRM IMP/VICKZ family
Function
RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). This transcript 'caging' into mRNPs allows mRNA transport and transient storage. It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation (By similarity). Binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Binding is isoform-specific. Binds to beta-actin/ACTB and MYC transcripts.
    Click to Show/Hide
Gene ID 10644
Uniprot ID
IF2B2_HUMAN
Regulator Type WRITER ERASER READER
Mechanism Diagram Click to View the Original Diagram
Target Genes Click to View Potential Target Genes of This Regulator
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
IGF2BP2 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Browse Target Gene related Drug
Interleukin-1 beta (IL1B)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP2
Cell Line ES-2 cell line Homo sapiens
Treatment: siIGF2BP2 ES-2 cells
Control: siControl ES-2 cells
 GSE109604
Regulation
logFC: 6.90E-01
p-value: 1.24E-02
More Results Click to View More RNA-seq Results
Gangrene or necrosis of lung [ICD-11: CA43]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Gangrene or necrosis of lung [ICD-11: CA43]
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Cell Process Biological regulation
Cell apoptosis
In-vitro Model
 BEAS-2B Normal Homo sapiens CVCL_0168
In-vivo Model After being anesthetized with urethane (i.p.), SD rats were endotracheally intubated and ventilated using an animal ventilator under the conditions: respiratory rate of 70 breaths/min, tidal volume of 20 ml/kg, and inspiratory/expiratory ratio of 1:1.
Response Summary N6-methyladenosine (m6A) methylation modification is implicated in the pathogenesis of lung ischemia-reperfusion injury. YTHDF3 or IGF2BP2 knockdown inhibited hypoxia/reoxygenation-activated p38, ERK1/2, AKT, and NF-Kappa-B pathways in BEAS-2B cells, and inhibited p-p65, Interleukin-1 beta (IL1B) and TNF-alpha secretion.
Krueppel-like factor 12 (KLF12)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP2
Cell Line Liver Mus musculus
Treatment: IMP2 -/- liver
Control: Wild type liver cells
 GSE66440
Regulation
logFC: -7.41E-01
p-value: 4.43E-02
More Results Click to View More RNA-seq Results
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
Target Regulation Up regulation
Pathway Response mRNA surveillance pathway hsa03015
RNA degradation hsa03018
Cell Process RNA stability
In-vitro Model
 THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
PATU-8988 (Human pancreatic adenocarcinoma cell)
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
HEK293T Normal Homo sapiens CVCL_0063
37 (Pancreatic cancer cell)
In-vivo Model BALB/c nude mice which were co-injected with THP-1 cells and PATU-8988 cells subcutaneously.
Response Summary LncRNA-PACERR which bound to IGF2BP2 acts as an m6A-dependent manner to enhance the stability of Krueppel-like factor 12 (KLF12) and c-myc in cytoplasm. This study found that LncRNA-PACERR functions as key regulator of TAMs in PDAC microenvironment and revealed the novel mechanisms in cytoplasm and in nucleus.
NAD-dependent protein deacetylase sirtuin-1 (SIRT1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP2
Cell Line Liver Mus musculus
Treatment: IMP2 -/- liver
Control: Wild type liver cells
 GSE66440
Regulation
logFC: -8.22E-01
p-value: 2.08E-02
More Results Click to View More RNA-seq Results
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Cell Process Cell proliferation
Cell migration
In-vitro Model
 SNU-216 Gastric tubular adenocarcinoma Homo sapiens CVCL_3946
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
GES-1 Normal Homo sapiens CVCL_EQ22
In-vivo Model About 5 × 106 MKN45 cells stably transfected with IGF2BP2 shRNA or sh-NC vectors were subcutaneously injected into flank of nude mice.
Response Summary IGF2BP2 regulated GC the proliferation/migration through recognizing the m6A modification sites of NAD-dependent protein deacetylase sirtuin-1 (SIRT1) mRNA.
Vascular endothelial growth factor A (VEGFA)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP2
Cell Line ES-2 cell line Homo sapiens
Treatment: siIGF2BP2 ES-2 cells
Control: siControl ES-2 cells
 GSE109604
Regulation
logFC: -6.36E-01
p-value: 3.11E-02
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
In-vitro Model
 SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
NCM460 Normal Homo sapiens CVCL_0460
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
In-vivo Model A total of 8 × 106 wild-type (WT) or METTL3-knockdown cells were injected into the dorsal flanks of 6-week-old nude mice. Seven mice were randomly selected to calculate the volume according to the following formula: V = (width2 × length)/2. Mice were euthanized three weeks after injection and tumors removed, weighed, fixed, and embedded for immunohistochemical analysis.
Response Summary EphA2 and Vascular endothelial growth factor A (VEGFA) targeted by METTL3 via different IGF2BP2-dependent mechanisms were found to promote vasculogenic mimicry (VM) formation via PI3K/AKT/mTOR and ERK1/2 signaling in CRC.
High mobility group protein HMG-I/HMG-Y (HMGA1)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and IGF2BP2
Cell Line HEK293T Homo sapiens
Regulation logFC: 1.10E+00 GSE90639
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [5]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response mRNA surveillance pathway hsa03015
Cell Process mRNA stability
Epithelial-mesenchymal transition
In-vitro Model
 DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
FHC Normal Homo sapiens CVCL_3688
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HEK293T Normal Homo sapiens CVCL_0063
HT29 Colon cancer Mus musculus CVCL_A8EZ
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model Groups of HCT116-Luc-shCtrl, HCT116-Luc-shLINC00460, and HCT116-Luc-shLINC00460 + HMGA1 cells (5 × 106) were injected subcutaneously into the flanks of mice correspondingly.
Response Summary LINC00460 is a novel oncogene of colorectal cancer through interacting with IGF2BP2 and DHX9 and bind to the m6A modified High mobility group protein HMG-I/HMG-Y (HMGA1) mRNA to enhance the HMGA1 mRNA stability. The N6-methyladenosine (m6A) modification of HMGA1 mRNA by METTL3 enhanced HMGA1 expression in CRC.
MARCKS-related protein (MARCKSL1)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and IGF2BP2
Cell Line HEK293T Homo sapiens
Regulation logFC: 1.20E+00 GSE90639
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Cell Process RNA decay
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, FSCN1, TK1, and MARCKS-related protein (MARCKSL1), exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Cell Process RNA decay
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, FSCN1, TK1, and MARCKS-related protein (MARCKSL1), exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.
Serine/arginine-rich splicing factor 7 (SRSF7)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and IGF2BP2
Cell Line HEK293T Homo sapiens
Regulation logFC: 1.26E+00 GSE90639
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Pathway Response Spliceosome hsa03040
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
U87MG (Astroblastoma cells from human brain)
LN-229 Glioblastoma Homo sapiens CVCL_0393
A-172 Glioblastoma Homo sapiens CVCL_0131
LN-18 Glioblastoma Homo sapiens CVCL_0392
LN-428 Glioblastoma Homo sapiens CVCL_3959
LN-443 Glioblastoma Homo sapiens CVCL_3960
SNB-19 Astrocytoma Homo sapiens CVCL_0535
T98G Glioblastoma Homo sapiens CVCL_0556
U-118MG Astrocytoma Homo sapiens CVCL_0633
U251 (Fibroblasts or fibroblast like cells)
U-138MG Astrocytoma Homo sapiens CVCL_0020
Response Summary The gene expression of Serine/arginine-rich splicing factor 7 (SRSF7) is positively correlated with glioblastoma (GBM) cell-specific m6A methylation. The two m6A sites on PDZ-binding kinase (PBK) are regulated by SRSF7 and partially mediate the effects of SRSF7 in GBM cells through recognition by IGF2BP2.
Y-box-binding protein 1 (YBX1)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and IGF2BP2
Cell Line HEK293T Homo sapiens
Regulation logFC: 1.14E+00 GSE90639
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Myeloid leukaemia [ICD-11: 2B33.1]
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model
 Leukemia stem cell line (Leukemia stem cell line)
Kasumi-1 Myeloid leukemia with maturation Homo sapiens CVCL_0589
MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
BV-173 Chronic myelogenous leukemia Homo sapiens CVCL_0181
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KG-1a Adult acute myeloid leukemia Homo sapiens CVCL_1824
Response Summary Y-box-binding protein 1 (YBX1) selectively functions in regulating survival of myeloid leukemia cells. YBX1 interacts with insulin-like growth factor 2 messenger RNA (mRNA)-binding proteins (IGF2BPs) and stabilizes m6A-tagged RNA. YBX1 deficiency dysregulates the expression of apoptosis-related genes and promotes mRNA decay of MYC and BCL2 in an m6A-dependent manner, which contributes to the defective survival that results from deletion of YBX1.
Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and IGF2BP2
Cell Line HEK293T Homo sapiens
Regulation logFC: 1.31E+00 GSE90639
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Up regulation
Pathway Response Lysosome hsa04142
Cell Process Cell autophagy
In-vitro Model
 NCI-H157 Lung squamous cell carcinoma Homo sapiens CVCL_0463
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H1703 Lung squamous cell carcinoma Homo sapiens CVCL_1490
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
BEAS-2B Normal Homo sapiens CVCL_0168
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
In-vivo Model Mice (male and 6 weeks old) were subcutaneously injected with NSCLC cells (1.0*106 cells/200 uL). The mice were terminated after 4 weeks of induction, and the tumor volume and tumor weight were measured.
Response Summary IGF2BP2 promotes Metastasis associated lung adenocarcinoma transcript 1 (MALAT1) stability in an m6A-dependent mechanism, thus promoting its downstream target autophagy-related (ATG)12 expression and NSCLC proliferation.
Apoptosis regulator Bcl-2 (BCL2)
 Target Gene 
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Myeloid leukaemia [ICD-11: 2B33.1]
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model
 Leukemia stem cell line (Leukemia stem cell line)
Kasumi-1 Myeloid leukemia with maturation Homo sapiens CVCL_0589
MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
BV-173 Chronic myelogenous leukemia Homo sapiens CVCL_0181
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KG-1a Adult acute myeloid leukemia Homo sapiens CVCL_1824
Response Summary YBX1 selectively functions in regulating survival of myeloid leukemia cells. YBX1 interacts with insulin-like growth factor 2 messenger RNA (mRNA)-binding proteins (IGF2BPs) and stabilizes m6A-tagged RNA. YBX1 deficiency dysregulates the expression of apoptosis-related genes and promotes mRNA decay of MYC and Apoptosis regulator Bcl-2 (BCL2) in an m6A-dependent manner, which contributes to the defective survival that results from deletion of YBX1.
ATP-dependent translocase ABCB1 (ABCB1)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Adriamycin Phase 3
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model The xenograft mouse models were established by injecting MCF-7/ADR cells (1 × 107 in 100 μL RPMI 1640 medium) into the mouse right flank. Tumor size was monitored every week. When the average tumor size reached approximately 100 mm3, 5.0 mg/kg adriamycin were subsequently subjected through tail vein every other day. Mice were sacrificed after 4 weeks, and tumors were excised.
Cellular tumor antigen p53 (TP53/p53)
 Target Gene 
Vascular disorders of the liver [ICD-11: DB98]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Vascular disorders of the liver [ICD-11: DB98.8]
Target Regulation Up regulation
Complex I-AGGG (NDUFB2)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Down regulation
Pathway Response Ubiquitin mediated proteolysis hsa04120
Cell Process Tumour immunology
Ubiquitination degradation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1650 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1483
NCI-H1703 Lung squamous cell carcinoma Homo sapiens CVCL_1490
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
LL/2 (LLC1) Malignant tumors Mus musculus CVCL_4358
In-vivo Model A549 cells were transfected with the pZW1-FCS-circNDUFB2 plasmid or pZW1-FCS-Vector plasmid, and selected with G418 (800 ug/ml) for 4 weeks, and then 2 × 106 A549 cells were subcutaneously injected into the right flank of each mouse.
Response Summary Complex I-AGGG (NDUFB2) interacts with IGF2BP1/2/3 in NSCLC cells. circNDUFB2 participates in the degradation of IGF2BPs and activation of anti-tumor immunity during NSCLC progression via the modulation of both protein ubiquitination and degradation, as well as cellular immune responses.
Cyclin-dependent kinase 6 (CDK6)
 Target Gene 
Laryngeal cancer [ICD-11: 2C23]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [13]
Responsed Disease Laryngeal squamous cell carcinoma [ICD-11: 2C23.Z]
Target Regulation Up regulation
In-vitro Model
 16HBE14o- Normal Homo sapiens CVCL_0112
In-vivo Model Six-week-old male BALB/c nude mice were randomly assigned to three groups (n = 6 in each group): Lv-sh-NC, Lv-sh-IGF2BP2#1, and Lv-sh-IGF2BP2#2. Mice in each group received the subcutaneous injection of 1 × 106 cells (0.1 mL) into the upper right flanks of mice. Cells were pre-transduced with sh-NC, sh-IGF2BP2#1, or sh-IGF2BP2#2 for 48 h before the injection. Starting from day 10 of the injection, the tumor volume was measured every 3 days. Mice were anesthetized and euthanized at day 25 of the injection, tumors were removed and collected, tumor weight was determined in a blind manner.
Cyclin-dependent kinase inhibitor 2A (CDKN2A)
 Target Gene 
Mature T-cell lymphoma [ICD-11: 2A90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [14]
Responsed Disease Mature T-cell lymphoma [ICD-11: 2A90]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
Response Summary The decline in METTL3 levels was responsible for CTCL cell proliferation and migration,Cyclin-dependent kinase inhibitor 2A (CDKN2A) was a key regulator during this process in vitro and in vivo, and insufficient methylation modification blocked the interaction between CDKN2A and m6A reader IGF2BP2, resulting in mRNA degradation.
Differentiation antagonizing non-protein coding RNA (DANCR)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [15]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Up regulation
Cell Process Cell proliferation
In-vitro Model
 BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
In-vivo Model DANCR KO or empty vector control were harvested and then mixed with matrigel (1:1) (BD Biosciences). Three different numbers of cells (1 × 104, 1 × 105, and 5 × 105 cells) were subcutaneously injected into nude mice, five animals per group.
Response Summary IGF2BP2 functions in partnerships with Putative uncharacterized protein DANCR (DANCR) to regulate its stability. In tumor cells, IGF2BP2 is upregulated, which increases the chance of IGF2PB2 to interact with and stabilize DANCR.DANCR is a novel target for IGF2BP2 through m6A modification, and IGF2BP2 and DANCR work together to promote cancer stemness-like properties and pancreatic cancer pathogenesis.
Ephrin type-A receptor 2 (EphA2)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
In-vitro Model
 SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
NCM460 Normal Homo sapiens CVCL_0460
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
In-vivo Model A total of 8 × 106 wild-type (WT) or METTL3-knockdown cells were injected into the dorsal flanks of 6-week-old nude mice. Seven mice were randomly selected to calculate the volume according to the following formula: V = (width2 × length)/2. Mice were euthanized three weeks after injection and tumors removed, weighed, fixed, and embedded for immunohistochemical analysis.
Response Summary Ephrin type-A receptor 2 (EphA2) and VEGFA targeted by METTL3 via different IGF2BP2-dependent mechanisms were found to promote vasculogenic mimicry (VM) formation via PI3K/AKT/mTOR and ERK1/2 signaling in CRC.
Fascin (FSCN1)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Cell Process RNA decay
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, Fascin (FSCN1), TK1, and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Cell Process RNA decay
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, Fascin (FSCN1), TK1, and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.
Flap endonuclease 1 (FEN1)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [16]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
In-vitro Model
 PLC/PRF/5 Adult hepatocellular carcinoma Homo sapiens CVCL_0485
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model A total of 40 BALB/c nude mice were chosen and assigned to two groups: shCtrl group (injected with HepG2 cells) and shIGF2BP2 group (injected with HepG2 cells with IGF2BP2 knockdown). 200 ul of the above cell suspension containing 2 × 105 cells was injected into the left or right back of each mice.
Response Summary IGF2BP2 overexpression promoted HCC proliferation in vitro and in vivo, IGF2BP2 directly recognized and bound to the m6A site on FEN1 mRNA and enhanced Flap endonuclease 1 (FEN1) mRNA stability.
Forkhead box protein M1 (FOXM1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [17]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 HCoEpiC (Healthy colon epithelial HCoEpiC cells)
HEK293T Normal Homo sapiens CVCL_0063
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HT-29 Colon adenocarcinoma Homo sapiens CVCL_0320
In-vivo Model Harvested cells were resuspended in PBS and each side of mouse was injected about 1 × 106 cells. Tumor volume was estimated every four days and calculated as 0.5 × length × width2.
G1/S-specific cyclin-D1 (CCND1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT-29 Colon adenocarcinoma Homo sapiens CVCL_0320
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HUVEC-C Normal Homo sapiens CVCL_2959
HCoEpiC (Healthy colon epithelial HCoEpiC cells)
In-vivo Model Ten BALB/C nude mice (4 weeks old, female) were injected in 1 × 106 HCT116 cells in 100 uL PBS at each side. The tumor size was detected every four days after the injection of cells and calculated according to the formula.
Glucose transporter type 1 (GLUT1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Glycolysis / Gluconeogenesis hsa00010
Cell Process Glucose metabolism
Response Summary METTL3 stabilizes HK2 and Glucose transporter type 1 (SLC2A1) (GLUT1) expression in colorectal cancer through an m6A-IGF2BP2/3- dependent mechanism.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [21]
Responsed Disease Liver cancer [ICD-11: 2C12]
Target Regulation Up regulation
In-vitro Model
 Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
BEL-7402 Endocervical adenocarcinoma Homo sapiens CVCL_5492
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
SMMC-7721 Endocervical adenocarcinoma Homo sapiens CVCL_0534
In-vivo Model BEL-7404 cells or BEL-7404 miR4458HG-KO cells were infused in the right flank of randomly selected 4-week-old male BALB/c mice.
Hepatocyte nuclear factor 1-alpha (HNF1A/TCF1)
 Target Gene 
Thyroid Cancer [ICD-11: 2D10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [22]
Responsed Disease Thyroid Cancer [ICD-11: 2D10]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Cell migratory
In-vitro Model
 B-CPAP Thyroid gland carcinoma Homo sapiens CVCL_0153
Nthy-ori 3-1 Normal Homo sapiens CVCL_2659
TPC-1 Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
Response Summary Silence of METTL3 inhibited migratory ability and Wnt activity in TPC-1 cells. METTL3 positively regulated the enrichment abundance of Hepatocyte nuclear factor 1-alpha (HNF1A/TCF1) in anti-IGF2BP2. TCF1 was responsible for METTL3-regulated thyroid carcinoma progression via the m6A methylation.
Hexokinase-2 (HK2)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Glycolysis / Gluconeogenesis hsa00010
Cell Process Glucose metabolism
Response Summary METTL3 stabilizes Hexokinase-2 (HK2) and SLC2A1 (GLUT1) expression in colorectal cancer through an m6A-IGF2BP2/3- dependent mechanism.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [21]
Responsed Disease Liver cancer [ICD-11: 2C12]
Target Regulation Up regulation
In-vitro Model
 Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
BEL-7402 Endocervical adenocarcinoma Homo sapiens CVCL_5492
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
SMMC-7721 Endocervical adenocarcinoma Homo sapiens CVCL_0534
In-vivo Model BEL-7404 cells or BEL-7404 miR4458HG-KO cells were infused in the right flank of randomly selected 4-week-old male BALB/c mice.
High mobility group protein HMGI-C (HMGA2)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [5]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A)
 Target Gene 
Injury of other or unspecified intrathoracic organs [ICD-11: NB32]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [25]
Responsed Disease Injury of other or unspecified intrathoracic organs [ICD-11: NB32.3]
Target Regulation Up regulation
Insulin-like growth factor 1 receptor (IGF1R)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [26]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
In-vitro Model
 SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
MKN1 Gastric adenosquamous carcinoma Homo sapiens CVCL_1415
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
GES-1 Normal Homo sapiens CVCL_EQ22
In-vivo Model A total of 30 BALB/c nude mice were chosen and assigned to three groups: (1) control (injected with 0.2 mL PBS), (2) si-NC (injected with si-NC transfected SGC7901 cells) and (3) si-IGF2BP2 (injected with si-IGF2BP2 transfected SGC7901 cells (n = 5 per group). 2 × 106 SGC7901 cells were injected into the left right back of each mouse through subcutaneous injection. Tumor sizes were recorded once per week. After 28 days, the mice were euthanized, and tumor tissues were weighted.
Response Summary IGF2BP2, as a m6A reader, was proved to increase the expression of Insulin-like growth factor 1 receptor (IGF1R) by identifying m6A methylation modification sites in IGF1R mRNA, thus activating RhoA-ROCK pathway. The oncogenic role of IGF2BP2 in gastric cancer carcinogenesis and confirmed its activation is partly due to the activation of IGF1R-RhoA-ROCK signaling pathway.
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [27]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
Cell Process RNA stability
In-vitro Model
 PC-3 Prostate carcinoma Homo sapiens CVCL_0035
LNCaP C4-2B Prostate carcinoma Homo sapiens CVCL_4784
In-vivo Model At 1 week post-injection with PC-3 cells, mice were randomly assigned to three groups (n = 8 per group): the ASO-NC group (injection with ASO negative control targeting unknown sequence, 5 nmol in 100 uL PBS for each mouse), the ASO-L group (injection with low-dose ASO targeting PCAT6, 5 nmol in 100 uL PBS for each mouse), and the ASO-H group (injection with high-dose ASO targeting PCAT6, 10 nmol in 100 uL PBS for each mouse).
Response Summary METTL3-mediated m6A modification contributed to PCAT6 upregulation in an IGF2BP2-dependent manner. Furthermore, PCAT6 upregulated Insulin-like growth factor 1 receptor (IGF1R) expression by enhancing IGF1R mRNA stability through the PCAT6/IGF2BP2/IGF1R RNA-protein three-dimensional complex. The m6 A-induced PCAT6/IGF2BP2/IGF1R axis promotes PCa bone metastasis and tumor growth, suggesting that PCAT6 serves as a promising prognostic marker and therapeutic target against bone-metastatic PCa.
LIM and SH3 domain protein 1 (LASP1)
 Target Gene 
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [28]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
Response Summary WTAP-mediated m6A modification of LIM and SH3 domain protein 1 (LASP1) enhanced its stability relying on the m6A reader IGF2BP2-dependent pathway. Furthermore, DIAPH1-AS1 acted as a molecular adaptor that promoted MTDH-LASP1 complex formation and upregulated LASP1 expression, ultimately facilitating NPC growth and metastasis.
Metastasis-associated protein MTA1 (MTA1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [29]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response mRNA surveillance pathway hsa03015
RNA degradation hsa03018
Cell Process RNA stability
In-vitro Model
 SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
RKO Colon carcinoma Homo sapiens CVCL_0504
LS174T Colon adenocarcinoma Homo sapiens CVCL_1384
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
HCT 15 Colon adenocarcinoma Homo sapiens CVCL_0292
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
CW-2 Colon adenocarcinoma Homo sapiens CVCL_1151
In-vivo Model FTO-overexpressing and control cells (2 × 106 suspended in 100 ul PBS) were subcutaneously injected into each mouse.
Response Summary FTO inhibited CRC metastasis both in vitro and in vivo. FTO exerted a tumor suppressive role by inhibiting Metastasis-associated protein MTA1 (MTA1) expression in an m6A-dependent manner. Methylated MTA1 transcripts were recognized by an m6A "reader", insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2), which then stabilized its mRNA.
Mitogen-activated protein kinase 1 (MAPK/ERK2/MAPK1)
 Target Gene 
Gangrene or necrosis of lung [ICD-11: CA43]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Gangrene or necrosis of lung [ICD-11: CA43]
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Apoptosis hsa04210
Cell Process Biological regulation
Cell apoptosis
In-vitro Model
 BEAS-2B Normal Homo sapiens CVCL_0168
In-vivo Model After being anesthetized with urethane (i.p.), SD rats were endotracheally intubated and ventilated using an animal ventilator under the conditions: respiratory rate of 70 breaths/min, tidal volume of 20 ml/kg, and inspiratory/expiratory ratio of 1:1.
Response Summary N6-methyladenosine (m6A) methylation modification is implicated in the pathogenesis of lung ischemia-reperfusion injury. YTHDF3 or IGF2BP2 knockdown inhibited hypoxia/reoxygenation-activated p38, Mitogen-activated protein kinase 1 (MAPK/ERK2/MAPK1), AKT, and NF-Kappa-B pathways in BEAS-2B cells, and inhibited p-p65, IL-1-beta and TNF-alpha secretion.
Mitogen-activated protein kinase 14 (p38/MAPK14)
 Target Gene 
Gangrene or necrosis of lung [ICD-11: CA43]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Gangrene or necrosis of lung [ICD-11: CA43]
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Cell Process Biological regulation
Cell apoptosis
In-vitro Model
 BEAS-2B Normal Homo sapiens CVCL_0168
In-vivo Model After being anesthetized with urethane (i.p.), SD rats were endotracheally intubated and ventilated using an animal ventilator under the conditions: respiratory rate of 70 breaths/min, tidal volume of 20 ml/kg, and inspiratory/expiratory ratio of 1:1.
Response Summary N6-methyladenosine (m6A) methylation modification is implicated in the pathogenesis of lung ischemia-reperfusion injury. YTHDF3 or IGF2BP2 knockdown inhibited hypoxia/reoxygenation-activated Mitogen-activated protein kinase 14 (p38/MAPK14), ERK1/2, AKT, and NF-Kappa-B pathways in BEAS-2B cells, and inhibited p-p65, IL-1-beta and TNF-alpha secretion.
Mitogen-activated protein kinase 3 (ERK1/MAPK3)
 Target Gene 
Gangrene or necrosis of lung [ICD-11: CA43]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Gangrene or necrosis of lung [ICD-11: CA43]
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Apoptosis hsa04210
Cell Process Biological regulation
Cell apoptosis
In-vitro Model
 BEAS-2B Normal Homo sapiens CVCL_0168
In-vivo Model After being anesthetized with urethane (i.p.), SD rats were endotracheally intubated and ventilated using an animal ventilator under the conditions: respiratory rate of 70 breaths/min, tidal volume of 20 ml/kg, and inspiratory/expiratory ratio of 1:1.
Response Summary N6-methyladenosine (m6A) methylation modification is implicated in the pathogenesis of lung ischemia-reperfusion injury. YTHDF3 or IGF2BP2 knockdown inhibited hypoxia/reoxygenation-activated p38, Mitogen-activated protein kinase 3 (ERK1/MAPK3), AKT, and NF-Kappa-B pathways in BEAS-2B cells, and inhibited p-p65, IL-1-beta and TNF-alpha secretion.
Myc proto-oncogene protein (MYC)
 Target Gene 
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Myeloid leukaemia [ICD-11: 2B33.1]
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model
 Leukemia stem cell line (Leukemia stem cell line)
Kasumi-1 Myeloid leukemia with maturation Homo sapiens CVCL_0589
MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
BV-173 Chronic myelogenous leukemia Homo sapiens CVCL_0181
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KG-1a Adult acute myeloid leukemia Homo sapiens CVCL_1824
Response Summary YBX1 selectively functions in regulating survival of myeloid leukemia cells. YBX1 interacts with insulin-like growth factor 2 messenger RNA (mRNA)-binding proteins (IGF2BPs) and stabilizes m6A-tagged RNA. YBX1 deficiency dysregulates the expression of apoptosis-related genes and promotes mRNA decay of Myc proto-oncogene protein (MYC) and BCL2 in an m6A-dependent manner, which contributes to the defective survival that results from deletion of YBX1.
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [30]
Responsed Disease Esophageal cancer [ICD-11: 2B70]
Target Regulation Up regulation
In-vitro Model
 TE-1 Esophageal squamous cell carcinoma Homo sapiens CVCL_1759
Eca-109 Esophageal squamous cell carcinoma Homo sapiens CVCL_6898
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
TE-10 Esophageal squamous cell carcinoma Homo sapiens CVCL_1760
In-vivo Model The mice were acclimatized and fed for one week. Then, they were randomly divided into two groups: sh-NC group and sh-SHMT2 group. Cells transfected with sh-NC or sh-SHMT2 were subsequently cultured routinely. Next, cells with logarithmic growth phase (1 ×106) were taken and injected to the right axilla of nude mice. After subcutaneous inoculation, the mice were observed for their mental status, activity, and tumor formation. The tumor volume was monitored every 4 days, and the mice were euthanized after 28 days. Tumor tissues were separated and weighed from nude mice. A portion of the dissected tumor tissue was fixed overnight in 4% paraformaldehyde, embedded in paraffin blocks and sectioned.
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [31]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Ubiquitin mediated proteolysis hsa04120
Glycolysis / Gluconeogenesis hsa00010
Cell Process Autophagy-lysosome pathway
Ubiquitination
Glycolysis
In-vitro Model
 DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
In-vivo Model For the orthotopic models, 2 × 106 cells with negative control (NC, sh-NC), sh-1 or sh-2 in 0.5 mL of PBS were subcutaneously injected into the dorsal flank of 2 mice respectively. Then 15 mice were separated into 3 groups (sh-NC, sh-1 and sh-2), of which the tumor pieces were tied to the base of the ceca. The growth of the tumors was monitored every 2 weeks after intraperitoneal injection of D-luciferin with a Xenogen IVIS 100 Bioluminescent Imaging System.
Response Summary LINRIS blocked K139 ubiquitination of IGF2BP2, maintaining its stability. This process prevented the degradation of IGF2BP2 through the autophagy-lysosome pathway (ALP). The LINRIS-IGF2BP2-Myc proto-oncogene protein (MYC) axis promotes the progression of Colorectal cancer and is a promising therapeutic target. MYC-mediated glycolysis was influenced by the interaction between LINRIS and IGF2BP2.
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
Target Regulation Up regulation
Pathway Response mRNA surveillance pathway hsa03015
RNA degradation hsa03018
Cell Process RNA stability
In-vitro Model
 THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
PATU-8988 (Human pancreatic adenocarcinoma cell)
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
HEK293T Normal Homo sapiens CVCL_0063
37 (Pancreatic cancer cell)
In-vivo Model BALB/c nude mice which were co-injected with THP-1 cells and PATU-8988 cells subcutaneously.
Response Summary LncRNA-PACERR which bound to IGF2BP2 acts as an m6A-dependent manner to enhance the stability of KLF12 and Myc proto-oncogene protein (MYC) in cytoplasm. This study found that LncRNA-PACERR functions as key regulator of TAMs in PDAC microenvironment and revealed the novel mechanisms in cytoplasm and in nucleus.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Cell Process RNA decay
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including Myc proto-oncogene protein (MYC), FSCN1, TK1, and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Cell Process RNA decay
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including Myc proto-oncogene protein (MYC), FSCN1, TK1, and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.
Obg-like ATPase 1 (OLA1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [34]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Cell Process Warburg effect
Mitochondrial energy metabolism
In-vitro Model
 Caco-2 Colon adenocarcinoma Homo sapiens CVCL_0025
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HIEC (Normal intestinal epithelial cells)
HT29 Colon cancer Mus musculus CVCL_A8EZ
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
RKO Colon carcinoma Homo sapiens CVCL_0504
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
Response Summary The critical modulation network underlying m6A readers stabilizes lncRNAs, and they jointly promote mitochondrial energy metabolism in the pathogenesis of colorectal cancer. N6-methyladenosine reader stabilizes the ZFAS1/OLA1 axis. Thus, direct interaction between the KH3-4 domain of IMP2 and ZFAS1 where IMP2 serves as a reader for m6A-modified ZFAS1 and promotes the RNA stability of ZFAS1 is critical for CRC development.
POU domain, class 5, transcription factor 1 (POU5F1)
 Target Gene 
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [35]
Responsed Disease Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
Target Regulation Up regulation
In-vitro Model
 YES-2 Esophageal squamous cell carcinoma Homo sapiens CVCL_E322
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
KYSE-70 Esophageal squamous cell carcinoma Homo sapiens CVCL_1356
KYSE-140 Esophageal squamous cell carcinoma Homo sapiens CVCL_1347
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
KYSE-180 Esophageal squamous cell carcinoma Homo sapiens CVCL_1349
KYSE-410 Esophageal squamous cell carcinoma Homo sapiens CVCL_1352
KYSE-450 Esophageal squamous cell carcinoma Homo sapiens CVCL_1353
KYSE-510 Esophageal squamous cell carcinoma Homo sapiens CVCL_1354
COLO 680N Esophageal squamous cell carcinoma Homo sapiens CVCL_1131
Ne2/1b4.14
 N.A. Mus musculus CVCL_0E04
Programmed cell death 1 ligand 1 (CD274/PD-L1)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [36]
Responsed Disease Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
Target Regulation Up regulation
In-vitro Model
 PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
Capan-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0026
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
In-vivo Model Male BALB/c nude mice (5-6 weeks) were obtained from Slac Laboratory Animal Center (Shanghai, China) and maintained under pathogen-free conditions. PANC-1 cells (2 × 106 cells suspended in 100 μl PBS) transfected with circMYO1C knockdown (sh-circMYO1C) or controls (sh-NC) were subcutaneously injected into the flank of nude mice. One week later, the tumor size was measured every three days.
Putative pituitary tumor-transforming gene 3 protein (PTTG3P)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [37]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Hippo signaling pathway hsa04390
Cell Process Cell proliferation and suppression of apoptosis
In-vitro Model
 FHC Normal Homo sapiens CVCL_3688
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
HT29 Colon cancer Mus musculus CVCL_A8EZ
NCM460 Normal Homo sapiens CVCL_0460
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model Indicated cells (1 × 107) were subcutaneously injected into 4-week-old male nude mice. Tumor volume was measured every 5 days.
Response Summary In colorectal cancer, n6-methyladenosine (m6A) subunit METTL3 increased PTTG3P expression by influencing its stability, while insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2) could identify Putative pituitary tumor-transforming gene 3 protein (PTTG3P) m6A methylation status and bind to it.
RAC-alpha serine/threonine-protein kinase (AKT1)
 Target Gene 
Gangrene or necrosis of lung [ICD-11: CA43]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Gangrene or necrosis of lung [ICD-11: CA43]
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Apoptosis hsa04210
Cell Process Biological regulation
Cell apoptosis
In-vitro Model
 BEAS-2B Normal Homo sapiens CVCL_0168
In-vivo Model After being anesthetized with urethane (i.p.), SD rats were endotracheally intubated and ventilated using an animal ventilator under the conditions: respiratory rate of 70 breaths/min, tidal volume of 20 ml/kg, and inspiratory/expiratory ratio of 1:1.
Response Summary N6-methyladenosine (m6A) methylation modification is implicated in the pathogenesis of lung ischemia-reperfusion injury. YTHDF3 or IGF2BP2 knockdown inhibited hypoxia/reoxygenation-activated p38, ERK1/2, RAC-alpha serine/threonine-protein kinase (AKT1), and NF-Kappa-B pathways in BEAS-2B cells, and inhibited p-p65, IL-1-beta and TNF-alpha secretion.
RB1-inducible coiled-coil protein 1 (RB1CC1/FIP200)
 Target Gene 
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [38]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Target Regulation Up regulation
In-vitro Model
 CAL-33 Tongue squamous cell carcinoma Homo sapiens CVCL_1108
In-vivo Model Thirty-six specific pathogen-free male BALB/c-nude mice (age, 5-6 weeks) were randomly assigned to the groups: CAL33/shMETTL14#2, CAL33/shMETTL14#3, CAL33/shNC and HSC3/shMETTL14#2, HSC3/shMETTL14#3, HSC3/shNC (n = 6 per group). Fifty microliters of PBS buffer containing approximately 1 × 106 cells was injected into the left tongue under 2% pentobarbital sodium intraperitoneal injection anesthesia to establish a tumor xenograft. The weight of the mice was measured every 3 days after one week until they lost more than 15% of their body weight in a short period of time.
Receptor tyrosine-protein kinase erbB-2 (ERBB2)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [39]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Temozolomide Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Hippo signaling pathway hsa04390
Cell Process Cell apoptosis
In-vitro Model
 HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model IGF2BP2 activates the expression of ErbB2 by recognizing the m6A of YAP, thus affecting the cell cycle of CRC, inhibiting cell apoptosis, and promoting proliferation.
Response Summary IGF2BP2 activates the expression of Receptor tyrosine-protein kinase erbB-2 (ERBB2) by recognizing the m6A of YAP, thus affecting the cell cycle of colorectal cancer, inhibiting cell apoptosis, and promoting proliferation.
RNA cytosine C(5)-methyltransferase NSUN2 (NSUN2)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [40]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Cell Process Cells invasion
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
SW1116 Colon adenocarcinoma Homo sapiens CVCL_0544
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model 2 × 106 cells suspended in 40 uL PBS were injected into the inferior hemispleen into each 6-week-old BALB/c nude mouse.
Response Summary N6-methyladenosine modification of RNA cytosine C(5)-methyltransferase NSUN2 (NSUN2) modulates cytoplasmic export and stabilizes HMGA2 to promote Colorectal carcinoma LM. By forming a circNSUN2/IGF2BP2/HMGA2 RNA-protein ternary complex in the cytoplasm, circNSUN2 enhances the stability of HMGA2 mRNA to promote CRC metastasis progression.
Stimulator of interferon genes protein (STING1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [41]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 FHC Normal Homo sapiens CVCL_3688
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HT-29 Colon adenocarcinoma Homo sapiens CVCL_0320
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
Thymidine kinase, cytosolic (TK1)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Cell Process RNA decay
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, FSCN1, Thymidine kinase, cytosolic (TK1), and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [42]
Responsed Disease Lung cancer [ICD-11: 2C25]
Target Regulation Up regulation
In-vitro Model
 NHBE (Normal bronchial epithelial cells)
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
In-vivo Model Suspension of H1299 cells (5.0 × 105) was subcutaneously injected into the right flanks of the mice.
Response Summary In lung cancer, IGF2BP2 modified m6A to increase the expression of Thymidine kinase, cytosolic (TK1), thus promoting angiogenesis.
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Cell Process RNA decay
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, FSCN1, Thymidine kinase, cytosolic (TK1), and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.
Transcription factor E2F3 (E2F3)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [43]
Responsed Disease Liver cancer [ICD-11: 2C12]
Target Regulation Up regulation
Transcription factor p65 (RELA)
 Target Gene 
Gangrene or necrosis of lung [ICD-11: CA43]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Gangrene or necrosis of lung [ICD-11: CA43]
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Cell Process Biological regulation
Cell apoptosis
In-vitro Model
 BEAS-2B Normal Homo sapiens CVCL_0168
In-vivo Model After being anesthetized with urethane (i.p.), SD rats were endotracheally intubated and ventilated using an animal ventilator under the conditions: respiratory rate of 70 breaths/min, tidal volume of 20 ml/kg, and inspiratory/expiratory ratio of 1:1.
Response Summary N6-methyladenosine (m6A) methylation modification is implicated in the pathogenesis of lung ischemia-reperfusion injury. YTHDF3 or IGF2BP2 knockdown inhibited hypoxia/reoxygenation-activated p38, ERK1/2, AKT, and NF-Kappa-B pathways in BEAS-2B cells, and inhibited Transcription factor p65 (RELA), IL-1-beta and TNF-alpha secretion.
Transcription factor SOX-2 (SOX2)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [44]
Responsed Disease Glioma [ICD-11: 2A00.0]
Target Regulation Up regulation
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [45]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Signaling pathways regulating pluripotency of stem cells hsa04550
Cell Process Cell self-renewal
Stem cell frequency
Cell migration
In-vitro Model
 CCD-112CoN Normal Homo sapiens CVCL_6382
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HCT 15 Colon adenocarcinoma Homo sapiens CVCL_0292
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
LS174T Colon adenocarcinoma Homo sapiens CVCL_1384
RKO Colon carcinoma Homo sapiens CVCL_0504
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
Response Summary METTL3, acting as an oncogene, maintained Transcription factor SOX-2 (SOX2) expression through an m6A-IGF2BP2-dependent mechanism in CRC cells, and indicated a potential biomarker panel for prognostic prediction in Colorectal carcinoma.
Transcriptional coactivator YAP1 (YAP1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [39]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Temozolomide Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Hippo signaling pathway hsa04390
Cell Process Cell apoptosis
In-vitro Model
 HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model IGF2BP2 activates the expression of ErbB2 by recognizing the m6A of YAP, thus affecting the cell cycle of CRC, inhibiting cell apoptosis, and promoting proliferation.
Response Summary IGF2BP2 activates the expression of ErbB2 by recognizing the m6A of Transcriptional coactivator YAP1 (YAP1), thus affecting the cell cycle of colorectal cancer, inhibiting cell apoptosis, and promoting proliferation.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [46]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Responsed Drug Trans-3,5,4'-trimethoxystilbene Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 16HBE14o- Normal Homo sapiens CVCL_0112
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Triple-negative breast cancer [ICD-11: 2C6Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [47]
Responsed Disease Triple-negative breast cancer [ICD-11: 2C6Z]
Target Regulation Up regulation
In-vitro Model
 U2OS Osteosarcoma Homo sapiens CVCL_0042
WI-38 VA13 subline 2RA
 N.A. Homo sapiens CVCL_2759
CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
HEK293T Normal Homo sapiens CVCL_0063
Injuries of spine or trunk [ICD-11: ND51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [48]
Responsed Disease Spinal cord injury [ICD-11: ND51.2]
Target Regulation Up regulation
Tumor necrosis factor (TNF/TNF-alpha)
 Target Gene 
Gangrene or necrosis of lung [ICD-11: CA43]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Gangrene or necrosis of lung [ICD-11: CA43]
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Apoptosis hsa04210
Cell Process Biological regulation
Cell apoptosis
In-vitro Model
 BEAS-2B Normal Homo sapiens CVCL_0168
In-vivo Model After being anesthetized with urethane (i.p.), SD rats were endotracheally intubated and ventilated using an animal ventilator under the conditions: respiratory rate of 70 breaths/min, tidal volume of 20 ml/kg, and inspiratory/expiratory ratio of 1:1.
Response Summary N6-methyladenosine (m6A) methylation modification is implicated in the pathogenesis of lung ischemia-reperfusion injury. YTHDF3 or IGF2BP2 knockdown inhibited hypoxia/reoxygenation-activated p38, ERK1/2, AKT, and NF-Kappa-B pathways in BEAS-2B cells, and inhibited p-p65, IL-1-beta and Tumor necrosis factor (TNF/TNF-alpha) secretion.
Vang-like protein 1 (VANGL1)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [49]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Up regulation
Pathway Response Nucleotide excision repair hsa03420
Cell Process DNA repair
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
In-vivo Model Two hundred milliliters of A549 cells (1 × 106) were injected into the left flank of the back of each mouse.
Response Summary Up-regulation of Vang-like protein 1 (VANGL1) by IGF2BPs and miR-29b-3p attenuates the detrimental effect of irradiation on lung adenocarcinoma. Increased m6A level of VANGL1 and reduced miR-29b-3p took the responsibility of VANGL1 overexpression upon irradiation.
Zinc finger protein SNAI1 (SNAI1)
 Target Gene 
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [50]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 SUNE1 Nasopharyngeal carcinoma Homo sapiens CVCL_6946
Response Summary Overexpression of Zinc finger protein SNAI1 (SNAI1) partially reversed the regulatory effects of METTL3 on EMT-related gene expressions and metastatic abilities in nasopharyngeal carcinoma. Knockdown of METTL3 decreased the enrichment abundance of Snail in anti-IGF2BP2.
Zinc finger protein SNAI2 (Slug)
 Target Gene 
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [51]
Responsed Disease Head and neck squamous carcinoma [ICD-11: 2B6E]
Target Regulation Up regulation
Pathway Response Adherens junction hsa04520
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 SCC-15 Tongue squamous cell carcinoma Homo sapiens CVCL_1681
FaDu Hypopharyngeal squamous cell carcinoma Homo sapiens CVCL_1218
In-vivo Model To construct the metastasis model, 5 × 106 FaDu cells were transfected with sh-IGF2BP2-luc and sh-NC-luc, suspended in 60 uL PBS, and then injected into the footpads of the mice. Six weeks after injection, mice were subjected to bioluminescence imaging to evaluate lymphatic metastasis. For bioluminescence imaging, mice were anesthetized by inhaling 2% isoflurane for approximately 5 min, injected intraperitoneally with D-Luciferin potassium salt (200 uL, 150 ug/ml, ST196, Beyotime, Shanghai, China), and imaged with a bioluminescence system (NightOwl II LB983, Berthold Technologies, Germany).
Response Summary Mechanistic investigations revealed that Zinc finger protein SNAI2 (Slug), a key EMT-related transcriptional factor, is the direct target of IGF2BP2, and essential for IGF2BP2-regulated EMT and metastasis in HNSCC.
Cancer susceptibility 9 (CASC9)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [52]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Target Regulation Up regulation
Pathway Response Glycolysis / Gluconeogenesis hsa00010
Cell Process Aerobic glycolysis
In-vitro Model
 NHA (Normal human astrocytes)
U251 (Fibroblasts or fibroblast like cells)
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
Response Summary Cancer susceptibility 9 (CASC9)/IGF2BP2/HK2 axis promotes the aerobic glycolysis of glioblastoma multiforme.
DIAPH1 antisense RNA 1 (DIAPH1-AS1)
 Target Gene 
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [28]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
Response Summary WTAP-mediated m6A modification of DIAPH1 antisense RNA 1 (DIAPH1-AS1) enhanced its stability relying on the m6A reader IGF2BP2-dependent pathway. Furthermore, DIAPH1-AS1 acted as a molecular adaptor that promoted MTDH-LASP1 complex formation and upregulated LASP1 expression, ultimately facilitating NPC growth and metastasis.
HLA complex group 11 (HCG11)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [53]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Up regulation
Pathway Response Nucleotide excision repair hsa03420
Cell Process RNA stabilization
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
HBE (Human bronchial epithelial cell line)
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H522 Lung adenocarcinoma Homo sapiens CVCL_1567
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model LUAD cells stably HCG11 and/or LATS1 overexpressed or silenced were subcutaneously injected into the flank of the BALB/c nude mice (male, 4 weeks old).
Response Summary HLA complex group 11 (HCG11) mediated by METTL14 inhibited the growth of lung adenocarcinoma via IGF2BP2/LATS1. The m6A modification of HCG11 promoted its nuclear exportation and binding by Insulin Like Growth Factor 2 MRNA Binding Protein 2 (IGF2BP2), resulting in increased stability.
HOXD antisense growth-associated long non-coding RNA (HAGLR)
 Target Gene 
Thyroid Cancer [ICD-11: 2D10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [54]
Responsed Disease Thyroid Cancer [ICD-11: 2D10]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
Cell invasion
Cell apoptosis
Cell cycle progression
In-vitro Model
 TPC-1 Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
Response Summary IGF2BP2 loss inhibited cell proliferation, migration and invasion, and induced cell apoptosis and cell cycle arrest by down-regulating HOXD antisense growth-associated long non-coding RNA (HAGLR) expression in an m6A-dependent manner in thyroid cancer cells.
Retinopathy [ICD-11: 9B71]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [55]
Responsed Disease Diabetic retinopathy [ICD-11: 9B71.0]
Target Regulation Up regulation
Prostate cancer associated transcript 6 (PCAT6)
 Target Gene 
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [27]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
Cell Process RNA stability
In-vitro Model
 PC-3 Prostate carcinoma Homo sapiens CVCL_0035
LNCaP C4-2B Prostate carcinoma Homo sapiens CVCL_4784
In-vivo Model At 1 week post-injection with PC-3 cells, mice were randomly assigned to three groups (n = 8 per group): the ASO-NC group (injection with ASO negative control targeting unknown sequence, 5 nmol in 100 uL PBS for each mouse), the ASO-L group (injection with low-dose ASO targeting PCAT6, 5 nmol in 100 uL PBS for each mouse), and the ASO-H group (injection with high-dose ASO targeting PCAT6, 10 nmol in 100 uL PBS for each mouse).
Response Summary METTL3-mediated m6A modification contributed to Prostate cancer associated transcript 6 (PCAT6) upregulation in an IGF2BP2-dependent manner. Furthermore, PCAT6 upregulated IGF1R expression by enhancing IGF1R mRNA stability through the PCAT6/IGF2BP2/IGF1R RNA-protein three-dimensional complex. The m6 A-induced PCAT6/IGF2BP2/IGF1R axis promotes PCa bone metastasis and tumor growth, suggesting that PCAT6 serves as a promising prognostic marker and therapeutic target against bone-metastatic PCa.
PTGS2 antisense RNA 1 (PACERR)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
Target Regulation Up regulation
Pathway Response mRNA surveillance pathway hsa03015
RNA degradation hsa03018
Cell Process RNA stability
In-vitro Model
 THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
PATU-8988 (Human pancreatic adenocarcinoma cell)
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
HEK293T Normal Homo sapiens CVCL_0063
37 (Pancreatic cancer cell)
In-vivo Model BALB/c nude mice which were co-injected with THP-1 cells and PATU-8988 cells subcutaneously.
Response Summary PTGS2 antisense RNA 1 (PACERR) which bound to IGF2BP2 acts as an m6A-dependent manner to enhance the stability of KLF12 and c-myc in cytoplasm. This study found that LncRNA-PACERR functions as key regulator of TAMs in PDAC microenvironment and revealed the novel mechanisms in cytoplasm and in nucleus.
ZNFX1 antisense RNA 1 (ZFAS1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [34]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Cell Process Warburg effect
Mitochondrial energy metabolism
In-vitro Model
 Caco-2 Colon adenocarcinoma Homo sapiens CVCL_0025
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HIEC (Normal intestinal epithelial cells)
HT29 Colon cancer Mus musculus CVCL_A8EZ
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
RKO Colon carcinoma Homo sapiens CVCL_0504
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
Response Summary The critical modulation network underlying m6A readers stabilizes lncRNAs, and they jointly promote mitochondrial energy metabolism in the pathogenesis of colorectal cancer. N6-methyladenosine reader stabilizes the ZFAS1/OLA1 axis. Thus, direct interaction between the KH3-4 domain of IMP2 and ZFAS1 where IMP2 serves as a reader for m6A-modified ZFAS1 and promotes the RNA stability of ZFAS1 is critical for CRC development.
hsa-miR-133a-3p
 Target Gene 
Cardiomegaly [ICD-11: BC45]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [56]
Responsed Disease Cardiomegaly [ICD-11: BC45]
Target Regulation Up regulation
In-vitro Model
 CM Pancreatic insulinoma Homo sapiens CVCL_H246
In-vivo Model Neonatal mouse cardiomyocytes (CMs) were blinded to isolate from 7-10 cases of postnatal 1-day old wildtype C57/B mice and cultured using Pierce Primary Cardi Page 10.omyocyte Isolation Kit (Thermo Fisher Scientific) as the manufacturer's instructions.
Response Summary IGF2BP2 physically interacted with AGO2 and increased more hsa-miR-133a-3p accumulation on its target site.m6A modification promoted the repression of specific miRNA during heart development and hypertrophy.
hsa_circ_0000231 (circ_ARHGAP12)
 Target Gene 
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [57]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Up regulation
Pathway Response Cellular senescence hsa04218
In-vitro Model
 C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
Ca Ski Cervical squamous cell carcinoma Homo sapiens CVCL_1100
HaCaT Normal Homo sapiens CVCL_0038
HT-3 Cervical carcinoma Homo sapiens CVCL_1293
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
In-vivo Model CircARHGAP12-stable knockdown cervical cancer cells (100 uL PBS containing 5 × 106 cells) were subcutaneously injected into the lateral flank of BALB/c nude mice.
Response Summary m6A-modified hsa_circ_0000231 (circARHGAP12) interacts with IGF2BP2 to enhance FOXM1 mRNA stability, forming circARHGAP12/IGF2BP2/FOXM1 complex, thereby promoting the proliferation and migration of cervical cancer cells.
hsa_circ_0058493 (Circ_RHBDD1)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [58]
Responsed Disease Gastric cancer [ICD-11: 2B72]
In-vitro Model
 MKN28 Gastric tubular adenocarcinoma Homo sapiens CVCL_1416
5-hydroxytryptamine receptor 3A (HTR3A)
 Target Gene 
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [59]
Responsed Disease Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
Target Regulation Up regulation
In-vitro Model
 KYSE-180 Esophageal squamous cell carcinoma Homo sapiens CVCL_1349
TE-5 Esophageal squamous cell carcinoma Homo sapiens CVCL_1764
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
KYSE-510 Esophageal squamous cell carcinoma Homo sapiens CVCL_1354
KYSE-140 Esophageal squamous cell carcinoma Homo sapiens CVCL_1347
AC026356.1
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [60]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Up regulation
In-vivo Model Cells (2 × 104) were seeded onto 12-well plates and cultured in serum-free 1640 medium. Cell spheroids were documented and quantified using an inverted microscope (Olympus, Japan) after two weeks.
Ankyrin repeat domain-containing protein 22 (ANKRD22)
 Target Gene 
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [61]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
ATP-dependent 6-phosphofructokinase, liver type (PFKL)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [62]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
In-vitro Model
 NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
BACE1 antisense RNA (BACE1-AS)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [63]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model
CCD-841CoN
 N.A. Homo sapiens CVCL_2871
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
In-vivo Model BACE1-AS knockout SW620 or parental SW620 cells were injected into the inferior Hemi-spleen of the mice. The weights of mice were recorded every 3 days. After 7 weeks, the mice were euthanized. The whole livers of mice were resected and photographed to assess metastatic burden. .
Beta-1,4-glucuronyltransferase 1 (B3GNT6)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [64]
Responsed Disease Pancreatic carcinoma [ICD-11: 2C10.Y]
Target Regulation Up regulation
In-vitro Model
 CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
In-vivo Model To evaluate the effect of IGF2BP2 on the tumor formation ability in vivo, 2 × 106 cells were injected into the axilla of nude mice for subcutaneous tumor formation. After 9 days, modified IGF2BP2-si or si-NC was injected into the tumors every 3 days for 3 weeks. Tumor size was measured every 3 days.
Cell division control protein 45 homolog (CDC45)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [65]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
In-vitro Model
 Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
SK-HEP-1 Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
HCCLM3 Adult hepatocellular carcinoma Homo sapiens CVCL_6832
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model Following one week of adaptive feeding, the mice were haphazardly allocated to one of two groups: sh-NC or sh-CDC45. The former received subcutaneous injection of SK-Hep-1 cells transfected with sh-NC while the latter received injection of SK-Hep-1 cells transfected with sh-CDC45. Each mouse was injected with 3 × 10 [6] cells in a volume of 150 μl at the left armpit. Tumor volume was monitored biweekly following implantation.
Cell division control protein 6 homolog (CDC6)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [66]
Responsed Disease Lung cancer [ICD-11: 2C25]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Calu-1 Lung squamous cell carcinoma Homo sapiens CVCL_0608
HOP-62 Lung adenocarcinoma Homo sapiens CVCL_1285
In-vivo Model For the in vivo tumorigenicity assay, female BALB/c nude mice (ages 4-5 weeks) were randomly divided into two groups (n = 5 per group). A549 cells (2 × 106) that had been stably transfected with sh-LCAT1 or scramble were implanted subcutaneously into the nude mice.
Cell division cycle and apoptosis regulator protein 1 (CCAR1)
 Target Gene 
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [67]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
Cohesin subunit SA-3 (STAG3)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [68]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
NCM460 Normal Homo sapiens CVCL_0460
In-vivo Model Oe-STAG3 and sh-METTL3 were transfected into HCT116 cells. Trypsin digestion and cell counting were performed on each set of cells after they had reached around 80% confluence. Nude mice were subcutaneously injected with 200 μL cells (2 × 106) and randomly assigned to 5 groups (n = 6 in each group): control group (mice were injected with cells without transfection plasmid), oe-NC group (mice were injected with cells transfected with oe-NC), oe-STAG3 group (mice were injected with cells transfected with oe-STAG3), oe-STAG3 + sh-NC group (mice were injected with cells transfected with oe-STAG3 and sh-NC) and oe-STAG3 + sh-METTL3 group.
Cyclic AMP-responsive element-binding protein 1 (CREB1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [69]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
COLO205
 N.A. Homo sapiens CVCL_F402
HCT 15 Colon adenocarcinoma Homo sapiens CVCL_0292
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
HT-29 Colon adenocarcinoma Homo sapiens CVCL_0320
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
In-vivo Model To investigate tumor metastasis, approximately 1 × 106 HCT116 (Control or circEZH2 KD) cells suspended in 100 μL of 1 × PBS per mouse were injected into the tail vein of male BALB/c nude mice.
Cytoskeleton-associated protein 2-like (CKAP2L)
 Target Gene 
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [70]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Target Regulation Up regulation
In-vitro Model
 A2780 Ovarian endometrioid adenocarcinoma Homo sapiens CVCL_0134
OVCAR-3 Ovarian serous adenocarcinoma Homo sapiens CVCL_0465
SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
ES-2 Ovarian clear cell adenocarcinoma Homo sapiens CVCL_3509
12Z Endometriosis Homo sapiens CVCL_0Q73
IOSE-80
 N.A. Homo sapiens CVCL_5546
In-vivo Model To establish an orthotopic xenograft tumor model, 12 healthy female Balb/c nude mice were chosen and assigned to two groups. Nude mice were anesthetized by isoflurane inhalation, and after disinfecting the skin with iodophor, a 5 mm incision was made in the skin and abdominal wall, parallel and ventral to the spine, midway, and between the last rib and the iliac crest. After pulling out the ovary, the cell suspensions (10 μL) containing 1 × 106 IGF2BP2-overexpressing or control SKOV3 cells were inoculated after inserting the needle at the junction between the bursa and the fat pad. The ovary was put back in place, and if no bleeding was noted, the incision on the muscle layer and body wall was closed separately.
Dipeptidyl peptidase 4 (DPP4)
 Target Gene 
Thyroid Cancer [ICD-11: 2D10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [71]
Responsed Disease Papillary thyroid cancer [ICD-11: 2D10.1]
Target Regulation Up regulation
Ena/VASP-like protein (EVL)
 Target Gene 
Macroscopic changes of size of the kidney [ICD-11: MF54]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [72]
Responsed Disease Macroscopic changes of size of the kidney [ICD-11: MF54.0]
Responsed Drug Isoforsythiaside Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 HEK293 Normal Homo sapiens CVCL_0045
HK-2 [Human kidney] Normal Homo sapiens CVCL_0302
In-vivo Model For the unilateral ureteral obstruction (UUO)-induced ON model, mice were subjected to permanent ureteral ligation of the left kidney ureter under aseptic and anaesthetic conditions, whereas sham-operated mice merely lacked ligation under equivalent conditions. The mice were sacrificed under anaesthesia at 3, 7 and 14 days postoperatively. For the ischemia/reperfusion (I/R)-induced renal fibrosis model, mice were recovered with blood supply after 42 min of bilateral renal artery clamping under both aseptic and anaesthetic conditions. These mice were sacrificed under anaesthesia at 7 and 14 days postoperatively. For drug treatment, isoforsythiaside was injected intraperitoneally at concentrations of 10, 25 and 50 mg/kg per day when the model was established. Similarly, the sham-operated group received an equivalent volume of saline intraperitoneally as a control. The harvested kidneys have been primarily used for morphological and histopathological observations and molecular biology studies.
F-box only protein 43 (FBXO43)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [73]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
In-vitro Model
 HCCLM3 Adult hepatocellular carcinoma Homo sapiens CVCL_6832
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
Fatty acid-binding protein 5 (FABP5)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [74]
Responsed Disease Pancreatic neuroendocrine neoplasms [ICD-11: 2C10.1]
Target Regulation Down regulation
In-vitro Model
 QGP-1 Pancreatic somatostatinoma Homo sapiens CVCL_3143
In-vivo Model For tumor xenograft models, QGP-1cells (5 × 106) with ALKBH5 over-expression, ALKBH5 over-expression with FABP5 knockdown, and negative control were subcutaneously injected into the right axilla of female BALB/c nude mice (4-6 weeks). After 4 weeks, the mice were sacrificed via a form of euthanasia.
FBXL19 antisense RNA 1 (FBXL19-AS1)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [75]
Responsed Disease Glioma [ICD-11: 2A00.0]
Fibroblast growth factor receptor 2 (FGFR2)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [76]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Flotillin-1 (FLOT1)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [77]
Responsed Disease Glioma [ICD-11: 2A00.0]
Target Regulation Up regulation
In-vitro Model
 U-251MG Astrocytoma Homo sapiens CVCL_0021
T98G Glioblastoma Homo sapiens CVCL_0556
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
U-118MG Astrocytoma Homo sapiens CVCL_0633
Fructose-bisphosphate aldolase A (ALDOA)
 Target Gene 
Hepatic fibrosis/cirrhosis [ICD-11: DB93]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [78]
Responsed Disease Hepatic fibrosis/cirrhosis [ICD-11: DB93]
Target Regulation Up regulation
glucosylceramidase beta 1 like, pseudogene (GBA1LP)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [79]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
In-vitro Model
 L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
SMMC-7721 Endocervical adenocarcinoma Homo sapiens CVCL_0534
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model In vivo tumor growth assay, 1 × 107 Hep3B-GBAP1 or MHCC97H-shGBAP1 subclones and the corresponding control cells were transplanted into the body of 6-week-old BALB/c nude mice (Slac Laboratory Animal Center, Shanghai, China) via subcutaneous injection. Tumor size was measured every 3 days. Twenty-one days later, tumors were removed from mice in different groups. Tumor weight was calculated after dissection. Permission of conducting animal study was obtained from the Research Ethics Committee of Xi'an Jiaotong University. In vivo lung metastasis model, 1 × 106 cells were intravenously injected into the lateral tail vein of nude mice (n = 5 mice/group).
Glutaredoxin-1 (GLRX)
 Target Gene 
Parkinson disease [ICD-11: 8A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [80]
Responsed Disease Parkinson disease [ICD-11: 8A00]
Target Regulation Up regulation
In-vitro Model
 BV-2 Normal Mus musculus CVCL_0182
GNAS antisense RNA 1 (GNAS-AS1)
 Target Gene 
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [81]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Responsed Drug Chidamide Investigative
 Drug Info 
In-vitro Model
 HL-60 Adult acute myeloid leukemia Homo sapiens CVCL_0002
HEL Erythroleukemia Homo sapiens CVCL_0001
MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
Kasumi-1 Myeloid leukemia with maturation Homo sapiens CVCL_0589
HS-5
 N.A. Homo sapiens CVCL_3720
In-vivo Model Subcutaneous tumorigenesis was induced in mice by subcutaneous transplantation of 1 × 106 HL-60 cells. To stably overexpress GNAS-AS1, lentivirus-packaged OE-GNAS-AS1 (1 × 108 plaque-forming units). When the tumor volume reached 150-200 mm3, mice in the control group were orally treated with 1% DMSO (containing 0.2% carboxymethylcellulose and 0.1% Tween 80). Mice in the Chidamide, Chidamide + OE-NC, and Chidamide + OE-GNAS-AS1 groups were orally treated with Chidamide (25 mg/kg body weight, formulated with 1% DMSO containing 0.2% carboxymethylcellulose and 0.1% Tween 80). All treatments were repeated three times a week and for two weeks. Tumor volume was recorded every 5 days.
Granulocyte-macrophage colony-stimulating factor (CSF2)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [82]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
In-vitro Model
 HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
In-vivo Model 48 male BALB/c nu/nu mice (Slake Experimental Animal Center in Shanghai) at the age of 4 weeks were randomly divided into 8 groups (n = 6/group). All groups received subcutaneous injections of HGC-27 (2 × 106 cells in 200 μL PBS), Additionally, MSCs transfected with or without CSF2 plasmid, P-MSCs transfected with or without CSF2/IGF2BP2 inhibitor, and GC-MSCs transfected with or without CSF2/IGF2BP2 inhibitor were co-injected with HGC-27 cells in a 1:1 ratio. The mice were monitored every 2 days. Tumor volumes were calculated using the modified ellipsoidal formula: V = 1/2 (length × width2).
Histone-lysine N-methyltransferase SUV39H2 (SUV39H2)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [83]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
In-vivo Model The nude mice were inoculated in the inguinal region subcutaneously with 1 × 106 stably transfected GC cells which were suspended in 100 μL PBS. After one week, preestablished tumor xenografts were treated with DMSO or OTS186935 (50 mg/kg, 2 × /wk × 3).
Homeobox protein Hox-C6 (HOXC6)
 Target Gene 
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [84]
Responsed Disease Prostate cancer [ICD-11: 2C82]
In-vitro Model
 VCaP Prostate carcinoma Homo sapiens CVCL_2235
DU145 Prostate carcinoma Homo sapiens CVCL_0105
HNC PC3 Retromolar trigone squamous cell carcinoma Homo sapiens CVCL_C8XA
Homeobox protein MSX-1 (MSX1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [85]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HT29 Colon cancer Mus musculus CVCL_A8EZ
JmjC domain-containing protein 8 (JMJD8)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [86]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
In-vitro Model
 SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
Kremen protein 1 (KRM1)
 Target Gene 
Calcific aortic valve disease [ICD-11: BB71 ]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [87]
Responsed Disease Calcific aortic valve disease [ICD-11: BB71 ]
Target Regulation Up regulation
Krueppel-like factor 6 (KLF6)
 Target Gene 
Injury of heart [ICD-11: NB31]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [88]
Responsed Disease Myocardial injury [ICD-11: NB31.Z]
Target Regulation Up regulation
In-vitro Model
 HL-1 Normal Mus musculus CVCL_0303
Large neutral amino acids transporter small subunit 1 (SLC7A5)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [89]
Responsed Disease Lung cancer [ICD-11: 2C25]
Target Regulation Up regulation
long intergenic non-protein coding RNA 941 (LINC00941)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [90]
Responsed Disease Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
Target Regulation Up regulation
In-vitro Model
 PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
AsPC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
HPDE6c7 Normal Homo sapiens CVCL_0P38
In-vivo Model PANC-1 cells were stably transfected with LV-METTL14, LV-NC, sh-METTL14, sh-NC, or sh-LINC00941. A mixture of 2×106 cells and 100 μL PBS was injected into the spleen of every BALB/c nude mouse. After two months of housing in a sterile environment, the mice were sacrificed. Their liver tissues were removed for hematoxylin and eosin (HE) staining.
Macrophage colony-stimulating factor 1 (CSF1)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [33]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Up regulation
Nuclear transcription factor Y subunit alpha (NFYA)
 Target Gene 
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [91]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Target Regulation Up regulation
Cell Process mRNA stability
Phospholipid hydroperoxide glutathione peroxidase GPX4 (GPX4)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [92]
Responsed Disease Small cell lung cancer [ICD-11: 2C25.1]
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
In-vivo Model For xenograft establishment, six-week-old female athymic nude mice (n = 6 per group) were used, following ethical guidelines approved by the Institutional Animal Care and Use Committee. Each mouse received subcutaneous injections in the flank region with 1 × 10^6 cells suspended in 100 μL of serum-free medium, either sh-METTL3-transfected A549 cells or sh-NC-transfected controls. Tumour growth was monitored bi-dimensionally every week using callipers, with tumour volume calculated using the formula (length × width^2)/2. After 4 weeks, the mice were anaesthetised and euthanized by intraperitoneal injection of 3% pentobarbital sodium (100 mg/kg). The tumours were weighted and used for HE and Immunohistochemistry staining.
Ulcerative colitis [ICD-11: DD71]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [93]
Responsed Disease Ulcerative colitis [ICD-11: DD71]
Target Regulation Up regulation
In-vitro Model
 NCM460 Normal Homo sapiens CVCL_0460
In-vivo Model All mice were randomly categorized into 6 groups (n = 6 / group): the control group (mice were fed with normal drinking water), the DSS group, DSS + Lv-oe-NC group, DSS + Lv-oe-IGF2BP2 group, DSS + Lv-oe-IGF2BP2 + Lv-sh-NC group, and DSS + Lv-oe-IGF2BP2 + Lv-sh-GPX4 group. The last four groups of mice underwent anaesthesia via intraperitoneal injection of 30 mg/kg pentobarbital sodium. Next, mice were intracolonically administrated with Lv-oe-NC alone, Lv-oe-IGF2BP2 alone, Lv-oe-IGF2BP2 plus Lv-sh-NC, or Lv-oe-IGF2BP2 plus Lv-sh-GPX4 at a dose of 1 × 109 IU in a final volume of 100 μL PBS [18]. After 48 h, except for the control group, the acute UC model in mice was established by feeding with drinking water containing 3 % DSS for 7 days [19]. On the 10th day, all mice underwent euthanasia via inhalation of overdose CO2, after which the colons of mice in each group were collected, measured using a ruler.
Procathepsin L (CTSL)
 Target Gene 
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [94]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Up regulation
In-vitro Model
 Ca Ski Cervical squamous cell carcinoma Homo sapiens CVCL_1100
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
HEK293-FT Normal Homo sapiens CVCL_6911
In-vivo Model Female BALB/c nude mice (4-5 weeks old) were purchased from the Center of Experimental Animals of Guangdong. To establish a tail vein metastasis model, 2 × 106 SiHa cells in 200 μl PBS were injected into the tail vein of each mouse (n = 6 for both METTL3-overexpressing and empty vector groups). The mice were killed at approximately 8 weeks, and lung tissues were isolated and embedded in paraffin. Hematoxylin and eosin staining was then used to determine the number of lung metastasis nodules. To establish the popliteal lymph node metastasis model, 1 × 106 SiHa cells in 50 μl PBS were injected subcutaneously into the footpad of each mouse (n = 6 for both groups). Cells from the experimental and control groups were inoculated under the right and left footpads of each mouse, respectively. After 8 weeks, the popliteal lymph nodes were excised.
Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 (PLOD2)
 Target Gene 
Male infertility [ICD-11: GB04]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [95]
Responsed Disease Male infertility [ICD-11: GB04]
Target Regulation Up regulation
In-vitro Model
GC-2spd(ts)
 N.A. Mus musculus CVCL_6633
In-vivo Model 20 adult male Wistar rats (180-200 g) were purchased from the Guangdong Provincial Center for Disease Control and Prevention. A 12 h/12 h light/dark cycle was maintained for the animals and they were fed standard food pellets and water as needed.
Protein arginine N-methyltransferase 6 (PRMT6)
 Target Gene 
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [96]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation Up regulation
In-vitro Model
 MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
Protein c-Fos (FOS)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [97]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
In-vitro Model
 Akata EBV-related Burkitt lymphoma Homo sapiens CVCL_0148
In-vivo Model To evaluate the tumorigenic effect of FTO, FTO knockdown or control AGS B95.8 cells (1 × 107 suspended in 150 μL of PBS) were subcutaneously injected into the flanks of B-NDG mice. The diameter and width of the tumours were measured every 4 days and used to estimate the tumour volumes by the standard formula: 0.5 × length × width2. At the end stage, the tumours were removed, imaged and weighed. To investigate the peritoneal dissemination ability of EBVaGC cells, intraperitoneal injection was performed. Briefly, 1 × 107 FTO silencing or control EBVaGC cells suspended in 0.4 mL of PBS were injected into the peritoneal cavity of each mouse. Eight weeks later, all the mice were sacrificed, and the abdominal and intestinal metastatic nodules were excised, counted, photographed and paraffin embedded. For the lung metastasis model, 200 μL of 1 × 106 luciferase-labelled EBVaGC cells from different groups were directly injected into the tail vein of B-NDG mice, and distant and lung metastasis were evaluated using bioluminescent imaging. After 6 or 8 weeks, the mice were euthanized, and the lungs were embedded in paraffin and subjected to haematoxylin and eosin (H&E) staining to record the micrometastatic nodules using a microscope. All animal experiments were approved by our Institutional Animal Care.
Protein Jumonji (JARID2)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [85]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HT29 Colon cancer Mus musculus CVCL_A8EZ
ribonuclease P RNA component H1 (RPPH1)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [76]
Responsed Disease Breast cancer [ICD-11: 2C60]
Semaphorin-3F (SEMA3F)
 Target Gene 
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [98]
Responsed Disease Prostate cancer [ICD-11: 2C82]
In-vitro Model
 RWPE-1 Normal Homo sapiens CVCL_3791
DU145 Prostate carcinoma Homo sapiens CVCL_0105
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
22Rv1 Prostate carcinoma Homo sapiens CVCL_1045
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
LNCaP C4-2B Prostate carcinoma Homo sapiens CVCL_4784
VCaP Prostate carcinoma Homo sapiens CVCL_2235
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model All the animal studies and protocols followed the institutional guidelines of the First Affiliated Hospital, School of Medicine, Zhejiang University.
Serine/threonine-protein kinase Nek7 (NEK7)
 Target Gene 
Intracerebral hemorrhage [ICD-11: 8B00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [99]
Responsed Disease Intracerebral hemorrhage [ICD-11: 8B00]
Target Regulation Down regulation
In-vitro Model
 HT22 Normal Mus musculus CVCL_0321
Serine/threonine-protein phosphatase CPPED1 (CPPED1)
 Target Gene 
Laryngeal cancer [ICD-11: 2C23]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [100]
Responsed Disease Laryngeal squamous cell carcinoma [ICD-11: 2C23.Z]
Target Regulation Up regulation
In-vitro Model
 Tu 177 Laryngeal squamous cell carcinoma Homo sapiens CVCL_4913
AMC-HN-8 Laryngeal squamous cell carcinoma Homo sapiens CVCL_5966
NP69SV40T
 N.A. Homo sapiens CVCL_F755
HEK293T Normal Homo sapiens CVCL_0063
Syndecan-4 (SDC4)
 Target Gene 
Thyroid Cancer [ICD-11: 2D10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [101]
Responsed Disease Thyroid Cancer [ICD-11: 2D10]
In-vitro Model
 BHP 10-3 Thyroid gland papillary carcinoma Homo sapiens CVCL_6278
Ca
 N.A. Drosophila melanogaster CVCL_Z839
K1 Thyroid gland papillary carcinoma Homo sapiens CVCL_2537
Toll-like receptor 2 (TLR2)
 Target Gene 
Hypopharyngeal cancer [ICD-11: 2B6D]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [102]
Responsed Disease Hypopharyngeal squamous cell carcinoma [ICD-11: 2B6D.0]
Target Regulation Up regulation
In-vitro Model
 FaDu Hypopharyngeal squamous cell carcinoma Homo sapiens CVCL_1218
Detroit 562 Pharyngeal squamous cell carcinoma Homo sapiens CVCL_1171
In-vivo Model HPSCC FaDu or Detroit 562 cells (1 × 106 cells) expressing vector control and construct lentiviruses were subcutaneously injected into the right flanks of 4-week-old male nude mice. Tumor diameters and body weight were recorded every 3 days for 1-6 weeks. Detroit 562 and FaDu cells (1 × 106 cells) were subcutaneously injected into the right flanks of 4-week-old male nude mice.
Transcription factor E2F6 (E2F6)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [43]
Responsed Disease Liver cancer [ICD-11: 2C12]
Target Regulation Up regulation
Transcription factor E2F7 (E2F7)
 Target Gene 
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [103]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
In-vivo Model For the tumor growth model, 1 × 106 SUNE-1 cells stably expressing scrambled or sh-VIRMA were injected subcutaneously into the axilla of mice, and the tumor size was measured every 4 days. After 32 days, the mice were sacrificed, and the tumors were retrieved. For the tumor inguinal lymph node metastasis model, 1 × 106 scrambled or sh-VIRMA SUNE-1 cells were injected into the footpads of mice. After 6 weeks, the mice were euthanized. The footpad tumors and inguinal lymph nodes were excised. Tumors and lymph nodes were subjected to subsequent in situ hybridization and immunohistochemistry analysis.
Transcription factor SOX-6 (SOX6)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [104]
Responsed Disease Intrahepatic cholangiocarcinoma [ICD-11: 2C12.10]
Target Regulation Up regulation
Transcriptional enhancer factor TEF-1 (TEAD1)
 Target Gene 
Liver disease [ICD-11: DB9Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [105]
Responsed Disease Liver disease [ICD-11: DB9Z]
Target Regulation Up regulation
Transient receptor potential cation channel subfamily M member 7 (TRPM7)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [106]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation Up regulation
In-vitro Model
 NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
Calu-1 Lung squamous cell carcinoma Homo sapiens CVCL_0608
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
BEAS-2B Normal Homo sapiens CVCL_0168
In-vivo Model The BALB/c nude mice (male, 4-6 weeks) were provided via Vital River Laboratory Animal Technology (Beijing, China). For xenograft tumor growth assay, 15 mice were randomly classified into 3 groups (n = 5/group), including control, sh-NC or sh-DGUOK-AS1 group. In sh-NC or sh-DGUOK-AS1 group, mice were subcutaneously injected with SK-MES-1 cells (3 × 106) stably transfected with sh-NC or sh-DGUOK-AS1; Moreover, mice were subcutaneously injected with non-transfected SK-MES-1 cells (3 × 106) as control group. The tumors were monitored every 7 days, and size was calculated by (length × width2)/2. Mice were euthanized after 4 weeks, and the tumors were collected and weighed, followed via collection for further analyses. Ki67 and CD31 levels were measured through immunohistochemistry staining using Ki67 (ab15580, 1:2000 dilution, Abcam) or CD31 (ab18298, 1:3000 dilution, Abcam) according to the protocols. For pulmonary metastatic assay, 3 × 106 SK-MES-1 cells stably transfected with sh-NC or sh-DGUOK-AS1 or non-transfected SK-MES-1 cells were intravenously injected into mice. Mice were sacrificed after 8 weeks, and lung specimens were collected, followed by hematoxylin-eosin (HE) staining assay for metastatic lesions in lung tissues. All experiments were approved via the Animal Ethics Committee of The Second Hospital of Shandong University.
Ubiquitin carboxyl-terminal hydrolase 13 (USP13)
 Target Gene 
Gastrointestinal stromal tumor [ICD-11: 2B5B]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [107]
Responsed Disease Gastrointestinal stromal tumor [ICD-11: 2B5B]
Responsed Drug 3-Methyladenine Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
In-vivo Model 6 × 106 logarithmically growing GIST cells resuspended in 100 μL PBS were injected subcutaneously into the flank of 6-week-old female nude mice for tumor growth assays. The following treatments were initiated when the tumor volume reached approximately 300 mm3. (1) IM-sensitive GIST cell lines and IM-resistant GIST cell lines were used to establish a subcutaneous xenograft model of GIST (n = 6 mice/group). When the tumors grew to the required size, mice were treated with IM via drinking water; (2) GIST cells were pretreated with USP13 lentivirus or USP13 control lentivirus. In addition, IM-resistant GIST cells were pretreated with USP13 inhibitors or control. These lentivirus-transfected cells were implanted into subcutaneous mice tumors to construct the USP13 positive, USP13-negative, and control groups (n = 6 mice/group). When the transplanted tumor grew to the required volume, mice in each group were treated with IM via drinking water. (3) IM-resistant GIST cells-xenografted mice and control mice were treated with USP13 inhibitors or with USP13 inhibitors and autophagy inhibitors in combination therapy to assess reversal of IM resistance (n = 6 mice/group). Mice were treated with IM (45 mg/kg/day) and with or without 3-MA (15 mg/kg/day) via drinking water when the tumors grew to the required size. The USP13 inhibitor Spautin-1 was used at 20 mg/kg/day when required.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [107]
Responsed Disease Gastrointestinal stromal tumor [ICD-11: 2B5B]
Responsed Drug Spautin 1 Preclinical
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
In-vivo Model 6 × 106 logarithmically growing GIST cells resuspended in 100 μL PBS were injected subcutaneously into the flank of 6-week-old female nude mice for tumor growth assays. The following treatments were initiated when the tumor volume reached approximately 300 mm3. (1) IM-sensitive GIST cell lines and IM-resistant GIST cell lines were used to establish a subcutaneous xenograft model of GIST (n = 6 mice/group). When the tumors grew to the required size, mice were treated with IM via drinking water; (2) GIST cells were pretreated with USP13 lentivirus or USP13 control lentivirus. In addition, IM-resistant GIST cells were pretreated with USP13 inhibitors or control. These lentivirus-transfected cells were implanted into subcutaneous mice tumors to construct the USP13 positive, USP13-negative, and control groups (n = 6 mice/group). When the transplanted tumor grew to the required volume, mice in each group were treated with IM via drinking water. (3) IM-resistant GIST cells-xenografted mice and control mice were treated with USP13 inhibitors or with USP13 inhibitors and autophagy inhibitors in combination therapy to assess reversal of IM resistance (n = 6 mice/group). Mice were treated with IM (45 mg/kg/day) and with or without 3-MA (15 mg/kg/day) via drinking water when the tumors grew to the required size. The USP13 inhibitor Spautin-1 was used at 20 mg/kg/day when required.
Zinc finger protein 281 (ZNF281)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [108]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug RS-102895 Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model MDA-MB-231 cells (1×106 cells/mouse) were mixed with an equivalent number of NFs/Ctrl, CAFs/shNC, CAFs/sh lncSNHG5, CAFs/shZNF281, CAFs/sh lncSNHG5/ZNF281, CAFs/RS102895, CAFs/Maraviroc or CAFs/Cenicriviroc in 200 μl PBS:Matrigel at a ratio of 1:1.
Zinc finger protein RFP (TRIM27)
 Target Gene 
Psoriasis [ICD-11: EA90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [109]
Responsed Disease Psoriasis [ICD-11: EA90]
In-vitro Model
 HaCaT Normal Homo sapiens CVCL_0038
Unspecific Target Gene
Pancreatic cancer [ICD-11: 2C10]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [110]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Responsed Drug Gemcitabine Approved
 Drug Info 
Pathway Response Adipocytokine signaling pathway hsa04920
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
HDE-CT cell line (A normal human pancreatic cell line)
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response Summary Lasso regression identified a six-m6A-regulator-signature prognostic model (KIAA1429, HNRNPC, METTL3, YTHDF1, IGF2BP2, and IGF2BP3). Gene set enrichment analysis revealed m6A regulators (KIAA1429, HNRNPC, and IGF2BP2) were related to multiple biological behaviors in pancreatic cancer, including adipocytokine signaling, the well vs. poorly differentiated tumor pathway, tumor metastasis pathway, epithelial mesenchymal transition pathway, gemcitabine resistance pathway, and stemness pathway.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [111]
Responsed Disease Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
Target Regulation Up regulation
In-vitro Model
 PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model 0.1 ml of cell suspension containing 2 × 106 luciferase-labeled cells was injected into tail veins.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [104]
Responsed Disease Intrahepatic cholangiocarcinoma [ICD-11: 2C12.10]
Target Regulation Up regulation
In-vitro Model
 SK-ChA-1 Cholangiocarcinoma Homo sapiens CVCL_6952
RBE Intrahepatic cholangiocarcinoma Homo sapiens CVCL_4896
Mz-ChA-1 Gallbladder carcinoma Homo sapiens CVCL_6932
HEK293 Normal Homo sapiens CVCL_0045
In-vivo Model Six-week-old male BALB/c nude mice were maintained under specific pathogen-free conditions,Mice were randomly assigned to 2 groups (N = 6). In each group, lentiviral-transduced SK-Cha-1 cells (2.5 × 106) were subcutaneously injected into the dorsal right flanks of the mice, and the mice were monitored every 3 days for tumor growth.
Response Summary The combination of m6A writers, IGF2BP2, and CTNNB1 distinguished CCA tissues from normal tissues.
ATP-dependent translocase ABCB1 (ABCB1)
 Target Gene 
Adriamycin [Phase 3]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [10]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
In-vitro Model MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model The xenograft mouse models were established by injecting MCF-7/ADR cells (1 × 107 in 100 μL RPMI 1640 medium) into the mouse right flank. Tumor size was monitored every week. When the average tumor size reached approximately 100 mm3, 5.0 mg/kg adriamycin were subsequently subjected through tail vein every other day. Mice were sacrificed after 4 weeks, and tumors were excised.
Receptor tyrosine-protein kinase erbB-2 (ERBB2)
 Target Gene 
Temozolomide [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [39]
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Target Regulation Up regulation
Pathway Response Hippo signaling pathway hsa04390
Cell Process Cell apoptosis
In-vitro Model HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model IGF2BP2 activates the expression of ErbB2 by recognizing the m6A of YAP, thus affecting the cell cycle of CRC, inhibiting cell apoptosis, and promoting proliferation.
Response Summary IGF2BP2 activates the expression of Receptor tyrosine-protein kinase erbB-2 (ERBB2) by recognizing the m6A of YAP, thus affecting the cell cycle of colorectal cancer, inhibiting cell apoptosis, and promoting proliferation.
Transcriptional coactivator YAP1 (YAP1)
 Target Gene 
Temozolomide [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [39]
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Target Regulation Up regulation
Pathway Response Hippo signaling pathway hsa04390
Cell Process Cell apoptosis
In-vitro Model HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model IGF2BP2 activates the expression of ErbB2 by recognizing the m6A of YAP, thus affecting the cell cycle of CRC, inhibiting cell apoptosis, and promoting proliferation.
Response Summary IGF2BP2 activates the expression of ErbB2 by recognizing the m6A of Transcriptional coactivator YAP1 (YAP1), thus affecting the cell cycle of colorectal cancer, inhibiting cell apoptosis, and promoting proliferation.
Trans-3,5,4'-trimethoxystilbene [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [46]
Responsed Disease Non-small cell lung cancer ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
In-vitro Model 16HBE14o- Normal Homo sapiens CVCL_0112
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Ena/VASP-like protein (EVL)
 Target Gene 
Isoforsythiaside [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [72]
Responsed Disease Macroscopic changes of size of the kidney ICD-11: MF54.0
 Disease Info 
Target Regulation Up regulation
In-vitro Model HEK293 Normal Homo sapiens CVCL_0045
HK-2 [Human kidney] Normal Homo sapiens CVCL_0302
In-vivo Model For the unilateral ureteral obstruction (UUO)-induced ON model, mice were subjected to permanent ureteral ligation of the left kidney ureter under aseptic and anaesthetic conditions, whereas sham-operated mice merely lacked ligation under equivalent conditions. The mice were sacrificed under anaesthesia at 3, 7 and 14 days postoperatively. For the ischemia/reperfusion (I/R)-induced renal fibrosis model, mice were recovered with blood supply after 42 min of bilateral renal artery clamping under both aseptic and anaesthetic conditions. These mice were sacrificed under anaesthesia at 7 and 14 days postoperatively. For drug treatment, isoforsythiaside was injected intraperitoneally at concentrations of 10, 25 and 50 mg/kg per day when the model was established. Similarly, the sham-operated group received an equivalent volume of saline intraperitoneally as a control. The harvested kidneys have been primarily used for morphological and histopathological observations and molecular biology studies.
GNAS antisense RNA 1 (GNAS-AS1)
 Target Gene 
Chidamide [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [81]
Responsed Disease Acute myeloid leukaemia ICD-11: 2A60
 Disease Info 
In-vitro Model HL-60 Adult acute myeloid leukemia Homo sapiens CVCL_0002
HEL Erythroleukemia Homo sapiens CVCL_0001
MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
Kasumi-1 Myeloid leukemia with maturation Homo sapiens CVCL_0589
HS-5
 N.A. Homo sapiens CVCL_3720
In-vivo Model Subcutaneous tumorigenesis was induced in mice by subcutaneous transplantation of 1 × 106 HL-60 cells. To stably overexpress GNAS-AS1, lentivirus-packaged OE-GNAS-AS1 (1 × 108 plaque-forming units). When the tumor volume reached 150-200 mm3, mice in the control group were orally treated with 1% DMSO (containing 0.2% carboxymethylcellulose and 0.1% Tween 80). Mice in the Chidamide, Chidamide + OE-NC, and Chidamide + OE-GNAS-AS1 groups were orally treated with Chidamide (25 mg/kg body weight, formulated with 1% DMSO containing 0.2% carboxymethylcellulose and 0.1% Tween 80). All treatments were repeated three times a week and for two weeks. Tumor volume was recorded every 5 days.
Ubiquitin carboxyl-terminal hydrolase 13 (USP13)
 Target Gene 
3-Methyladenine [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [107]
Responsed Disease Gastrointestinal stromal tumor ICD-11: 2B5B
 Disease Info 
Target Regulation Up regulation
In-vitro Model GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
In-vivo Model 6 × 106 logarithmically growing GIST cells resuspended in 100 μL PBS were injected subcutaneously into the flank of 6-week-old female nude mice for tumor growth assays. The following treatments were initiated when the tumor volume reached approximately 300 mm3. (1) IM-sensitive GIST cell lines and IM-resistant GIST cell lines were used to establish a subcutaneous xenograft model of GIST (n = 6 mice/group). When the tumors grew to the required size, mice were treated with IM via drinking water; (2) GIST cells were pretreated with USP13 lentivirus or USP13 control lentivirus. In addition, IM-resistant GIST cells were pretreated with USP13 inhibitors or control. These lentivirus-transfected cells were implanted into subcutaneous mice tumors to construct the USP13 positive, USP13-negative, and control groups (n = 6 mice/group). When the transplanted tumor grew to the required volume, mice in each group were treated with IM via drinking water. (3) IM-resistant GIST cells-xenografted mice and control mice were treated with USP13 inhibitors or with USP13 inhibitors and autophagy inhibitors in combination therapy to assess reversal of IM resistance (n = 6 mice/group). Mice were treated with IM (45 mg/kg/day) and with or without 3-MA (15 mg/kg/day) via drinking water when the tumors grew to the required size. The USP13 inhibitor Spautin-1 was used at 20 mg/kg/day when required.
Spautin 1 [Preclinical]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [107]
Responsed Disease Gastrointestinal stromal tumor ICD-11: 2B5B
 Disease Info 
Target Regulation Up regulation
In-vitro Model GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
GIST882 Gastrointestinal stromal tumor Homo sapiens CVCL_7044
GIST-T1 Gastrointestinal stromal tumor Homo sapiens CVCL_4976
In-vivo Model 6 × 106 logarithmically growing GIST cells resuspended in 100 μL PBS were injected subcutaneously into the flank of 6-week-old female nude mice for tumor growth assays. The following treatments were initiated when the tumor volume reached approximately 300 mm3. (1) IM-sensitive GIST cell lines and IM-resistant GIST cell lines were used to establish a subcutaneous xenograft model of GIST (n = 6 mice/group). When the tumors grew to the required size, mice were treated with IM via drinking water; (2) GIST cells were pretreated with USP13 lentivirus or USP13 control lentivirus. In addition, IM-resistant GIST cells were pretreated with USP13 inhibitors or control. These lentivirus-transfected cells were implanted into subcutaneous mice tumors to construct the USP13 positive, USP13-negative, and control groups (n = 6 mice/group). When the transplanted tumor grew to the required volume, mice in each group were treated with IM via drinking water. (3) IM-resistant GIST cells-xenografted mice and control mice were treated with USP13 inhibitors or with USP13 inhibitors and autophagy inhibitors in combination therapy to assess reversal of IM resistance (n = 6 mice/group). Mice were treated with IM (45 mg/kg/day) and with or without 3-MA (15 mg/kg/day) via drinking water when the tumors grew to the required size. The USP13 inhibitor Spautin-1 was used at 20 mg/kg/day when required.
Zinc finger protein 281 (ZNF281)
 Target Gene 
RS-102895 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [108]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
In-vitro Model MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model MDA-MB-231 cells (1×106 cells/mouse) were mixed with an equivalent number of NFs/Ctrl, CAFs/shNC, CAFs/sh lncSNHG5, CAFs/shZNF281, CAFs/sh lncSNHG5/ZNF281, CAFs/RS102895, CAFs/Maraviroc or CAFs/Cenicriviroc in 200 μl PBS:Matrigel at a ratio of 1:1.
Unspecific Target Gene
Gemcitabine [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [110]
Responsed Disease Pancreatic cancer ICD-11: 2C10
 Disease Info 
Pathway Response Adipocytokine signaling pathway hsa04920
Cell Process Epithelial-mesenchymal transition
In-vitro Model BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
HDE-CT cell line (A normal human pancreatic cell line)
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response Summary Lasso regression identified a six-m6A-regulator-signature prognostic model (KIAA1429, HNRNPC, METTL3, YTHDF1, IGF2BP2, and IGF2BP3). Gene set enrichment analysis revealed m6A regulators (KIAA1429, HNRNPC, and IGF2BP2) were related to multiple biological behaviors in pancreatic cancer, including adipocytokine signaling, the well vs. poorly differentiated tumor pathway, tumor metastasis pathway, epithelial mesenchymal transition pathway, gemcitabine resistance pathway, and stemness pathway.
Click to View Potential Drug Response of This Regulator
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
RNA modification
m6A Target: Nuclear transcription factor Y subunit alpha (NFYA)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00058
 Crosstalk Info 
Epigenetic Regulator rRNA 2'-O-methyltransferase fibrillarin (FBL)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship 2'-O-methylation → m6A
Disease Ovarian cancer
 Disease Info 
m6A Target: Glucose transporter type 1 (GLUT1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00489
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target hsa-mir-22
Crosstalk relationship m6Am → m6A
m6A Target: Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00525
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 142 (MIR142)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00529
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target MicroRNA 576 (MIR576)
Crosstalk relationship m6Am → m6A
m6A Target: Insulin-like growth factor 2 (IGF2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00539
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 432 (MIR432)
Crosstalk relationship A-to-I → m6A
m6A Target: Fascin (FSCN1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00546
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 200b (MIR200B)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00547
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target MicroRNA 200b (MIR200B)
Crosstalk relationship m5C → m6A
m6A Target: Transcription factor SOX-6 (SOX6)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00552
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 122 (MIR122)
Crosstalk relationship A-to-I → m6A
m6A Target: Differentiation antagonizing non-protein coding RNA (DANCR)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT00559
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Transcription factor SOX-2 (SOX2)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00561
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target Transcription factor SOX-2 (SOX2)
Crosstalk relationship m6A → m6Am
Crosstalk ID: M6ACROT00563
 Crosstalk Info 
Epigenetic Regulator Methyltransferase-like protein 1 (METTL1)
Regulated Target Transcription factor SOX-2 (SOX2)
Crosstalk relationship m6A → m7G
DNA modification
m6A Target: Semaphorin-3F (SEMA3F)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02016
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Semaphorin-3F (SEMA3F)
Crosstalk relationship m6A → DNA modification
Disease Prostate cancer
 Disease Info 
Drug Docetaxel
 Drug Info 
Histone modification
m6A Target: Fructose-bisphosphate aldolase A (ALDOA)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03079
 Crosstalk Info 
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship m6A → Histone modification
Disease Hepatic fibrosis/cirrhosis
 Disease Info 
m6A Target: Krueppel-like factor 12 (KLF12)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03080
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship m6A → Histone modification
Disease Pancreatic ductal adenocarcinoma
 Disease Info 
Crosstalk ID: M6ACROT03475
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Pancreatic cancer
 Disease Info 
m6A Target: JmjC domain-containing protein 8 (JMJD8)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03102
 Crosstalk Info 
Epigenetic Regulator Histone deacetylase 2 (HDAC2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Large neutral amino acids transporter small subunit 1 (SLC7A5)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03128
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase SETD1A (SETD1A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
m6A Target: Macrophage colony-stimulating factor 1 (CSF1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03132
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Pancreatic cancer
 Disease Info 
Crosstalk ID: M6ACROT06041
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Pancreatic cancer
 Disease Info 
Drug Gemcitabine
 Drug Info 
m6A Target: Myc proto-oncogene protein (MYC)
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT03133
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Pancreatic cancer
 Disease Info 
Crosstalk ID: M6ACROT03476
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Pancreatic cancer
 Disease Info 
Crosstalk ID: M6ACROT03477
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Pancreatic cancer
 Disease Info 
Crosstalk ID: M6ACROT06042
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Pancreatic cancer
 Disease Info 
Drug Gemcitabine
 Drug Info 
m6A Target: Ankyrin repeat domain-containing protein 22 (ANKRD22)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03153
 Crosstalk Info 
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Nasopharyngeal carcinoma
 Disease Info 
m6A Target: Histone-lysine N-methyltransferase SUV39H2 (SUV39H2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03191
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase SUV39H2 (SUV39H2)
Regulated Target Histone H3 lysine 9 trimethylation (H3K9me3)
Crosstalk relationship m6A → Histone modification
Disease Gastric cancer
 Disease Info 
Drug Cisplatin
 Drug Info 
m6A Target: Hexokinase-2 (HK2)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03367
 Crosstalk Info 
Epigenetic Regulator Histone deacetylase 2 (HDAC2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT03368
 Crosstalk Info 
Epigenetic Regulator Histone deacetylase 2 (HDAC2)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Vang-like protein 1 (VANGL1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03465
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase SETD1A (SETD1A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
m6A Target: HLA complex group 11 (HCG11)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03466
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase SETD1A (SETD1A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
m6A Target: Thymidine kinase, cytosolic (TK1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03467
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase SETD1A (SETD1A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
m6A Target: AC026356.1
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03468
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase SETD1A (SETD1A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Lung cancer
 Disease Info 
m6A Target: Putative uncharacterized protein DANCR (DANCR)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03473
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Pancreatic cancer
 Disease Info 
m6A Target: PTGS2 antisense RNA 1 (PACERR)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03474
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Pancreatic cancer
 Disease Info 
m6A Target: Beta-1,4-glucuronyltransferase 1 (B3GNT6)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03478
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Pancreatic cancer
 Disease Info 
m6A Target: Programmed cell death 1 ligand 1 (CD274/PD-L1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03479
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Pancreatic cancer
 Disease Info 
m6A Target: long intergenic non-protein coding RNA 941 (LINC00941)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03480
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Pancreatic cancer
 Disease Info 
Non-coding RNA
m6A Target: 5-hydroxytryptamine receptor 3A (HTR3A)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05021
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 1305 (LINC01305)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Esophageal Squamous Cell Carcinoma
 Disease Info 
m6A Target: Forkhead box protein M1 (FOXM1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05027
 Crosstalk Info 
Epigenetic Regulator LINC00035 (ABHD11-AS1)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Myc proto-oncogene protein (MYC)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05055
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 920 (LINC00920)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT05319
 Crosstalk Info 
Epigenetic Regulator PTGS2 antisense RNA 1 (PACERR)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Pancreatic ductal adenocarcinoma
 Disease Info 
Crosstalk ID: M6ACROT05950
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 901 (LINC00901)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease pancreatic cancer
 Disease Info 
m6A Target: Cellular tumor antigen p53 (TP53/p53)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05064
 Crosstalk Info 
Epigenetic Regulator Antisense of IGF2R non-protein coding RNA (AIRN)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Vascular disorders of the liver
 Disease Info 
m6A Target: Transcription factor E2F6 (E2F6)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05066
 Crosstalk Info 
Epigenetic Regulator Read-through Circular RNA E2F
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
 Disease Info 
m6A Target: Transcription factor E2F3 (E2F3)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05067
 Crosstalk Info 
Epigenetic Regulator Read-through Circular RNA E2F
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
 Disease Info 
m6A Target: Homeobox protein MSX-1 (MSX1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05070
 Crosstalk Info 
Epigenetic Regulator P53 upregulated regulator of p53 levels (PURPL)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Protein Jumonji (JARID2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05071
 Crosstalk Info 
Epigenetic Regulator P53 upregulated regulator of p53 levels (PURPL)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Transcriptional coactivator YAP1 (YAP1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05091
 Crosstalk Info 
Epigenetic Regulator piR-31115
Regulated Target Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship ncRNA → m6A
Disease Triple-negative breast cancer
 Disease Info 
Crosstalk ID: M6ACROT05190
 Crosstalk Info 
Epigenetic Regulator Circ_PACRGL
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
 Disease Info 
Drug Trans-3,5,4'-trimethoxystilbene
 Drug Info 
m6A Target: G1/S-specific cyclin-D1 (CCND1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05098
 Crosstalk Info 
Epigenetic Regulator HNF1A antisense RNA 1 (HNF1A-AS1)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Cell division control protein 6 homolog (CDC6)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05109
 Crosstalk Info 
Epigenetic Regulator Lysocardiolipin acyltransferase 1 (LCLAT1)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Lung cancer
 Disease Info 
m6A Target: Hexokinase-2 (HK2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05158
 Crosstalk Info 
Epigenetic Regulator MIR4458 host gene (MIR4458HG)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
 Disease Info 
m6A Target: Glucose transporter type 1 (SLC2A1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05159
 Crosstalk Info 
Epigenetic Regulator MIR4458 host gene (MIR4458HG)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
 Disease Info 
m6A Target: Serine/threonine-protein phosphatase CPPED1 (CPPED1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05176
 Crosstalk Info 
Epigenetic Regulator Circ_CDK1
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Laryngeal squamous cell carcinoma
 Disease Info 
m6A Target: Zinc finger protein 281 (ZNF281)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05197
 Crosstalk Info 
Epigenetic Regulator Small nucleolar RNA host gene 5 (SNHG5)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Breast cancer
 Disease Info 
Drug RS102895
 Drug Info 
Crosstalk ID: M6ACROT05993
 Crosstalk Info 
Epigenetic Regulator Small nucleolar RNA host gene 5 (SNHG5)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Breast cancer
 Disease Info 
Drug Marasviroc
 Drug Info 
Crosstalk ID: M6ACROT05994
 Crosstalk Info 
Epigenetic Regulator Small nucleolar RNA host gene 5 (SNHG5)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Breast cancer
 Disease Info 
Drug Cenicriviroc
 Drug Info 
m6A Target: Cyclic AMP-responsive element-binding protein 1 (CREB1)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05198
 Crosstalk Info 
Epigenetic Regulator hsa_circ_0006357 (Circ_EZH2)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT05199
 Crosstalk Info 
Epigenetic Regulator hsa-miR-133b
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT05200
 Crosstalk Info 
Epigenetic Regulator hsa_circ_0006357 (Circ_EZH2)
Regulated Target hsa-miR-133b
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: Kremen protein 1 (KRM1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05206
 Crosstalk Info 
Epigenetic Regulator Circ_HIPK3
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Calcific aortic valve disease
 Disease Info 
m6A Target: Stimulator of interferon genes protein (STING1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05222
 Crosstalk Info 
Epigenetic Regulator Circ_ASPH
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: High mobility group protein HMG-I/HMG-Y (HMGA1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05274
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 460 (LINC00460)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT05372
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 460 (LINC00460)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: GNAS antisense RNA 1 (GNAS-AS1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05289
 Crosstalk Info 
Epigenetic Regulator hsa-miR-34a-5p
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Breast cancer
 Disease Info 
Drug Tamoxifen
 Drug Info 
Crosstalk ID: M6ACROT05291
 Crosstalk Info 
Epigenetic Regulator GNAS antisense RNA 1 (GNAS-AS1)
Regulated Target hsa-miR-34a-5p
Crosstalk relationship ncRNA → m6A
Disease Breast cancer
 Disease Info 
Drug Tamoxifen
 Drug Info 
m6A Target: Protein arginine N-methyltransferase 6 (PRMT6)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05290
 Crosstalk Info 
Epigenetic Regulator hsa-miR-34a-5p
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Acute myeloid leukaemia
 Disease Info 
Crosstalk ID: M6ACROT05292
 Crosstalk Info 
Epigenetic Regulator GNAS antisense RNA 1 (GNAS-AS1)
Regulated Target hsa-miR-34a-5p
Crosstalk relationship ncRNA → m6A
Disease Acute myeloid leukaemia
 Disease Info 
m6A Target: Insulin-like growth factor 1 receptor (IGF1R)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05294
 Crosstalk Info 
Epigenetic Regulator Prostate cancer associated transcript 6 (PCAT6)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Prostate cancer
 Disease Info 
m6A Target: ATP-dependent translocase ABCB1 (ABCB1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05307
 Crosstalk Info 
Epigenetic Regulator A1BG antisense RNA 1 (A1BG-AS1)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Breast cancer
 Disease Info 
Drug Adriamycin
 Drug Info 
m6A Target: Krueppel-like factor 12 (KLF12)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05318
 Crosstalk Info 
Epigenetic Regulator PTGS2 antisense RNA 1 (PACERR)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Pancreatic ductal adenocarcinoma
 Disease Info 
m6A Target: Fibroblast growth factor receptor 2 (FGFR2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05362
 Crosstalk Info 
Epigenetic Regulator Ribonuclease P RNA component H1 (RPPH1)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Breast cancer
 Disease Info 
m6A Target: Thymidine kinase, cytosolic (TK1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05367
 Crosstalk Info 
Epigenetic Regulator hsa-miR-320b
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Lung cancer
 Disease Info 
m6A Target: miR-133a
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05495
 Crosstalk Info 
Epigenetic Regulator hsa-miR-133a-3p
Regulated Target Protein argonaute-2 (AGO2)
Crosstalk relationship m6A → ncRNA
Disease Cardiomegaly
 Disease Info 
m6A Target: HOXD antisense growth-associated long non-coding RNA (HAGLR)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05501
 Crosstalk Info 
Epigenetic Regulator HOXD antisense growth-associated long non-coding RNA (HAGLR)
Crosstalk relationship m6A → ncRNA
Disease Thyroid Cancer
 Disease Info 
Crosstalk ID: M6ACROT05768
 Crosstalk Info 
Epigenetic Regulator HOXD antisense growth-associated long non-coding RNA (HAGLR)
Regulated Target hsa-miR-106b-5p
Crosstalk relationship m6A → ncRNA
Disease Diabetic retinopathy
 Disease Info 
Crosstalk ID: M6ACROT05895
 Crosstalk Info 
Epigenetic Regulator hsa-miR-106b-5p
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → ncRNA
Disease Diabetic retinopathy
 Disease Info 
m6A Target: hsa_circ_0000231 (circ_ARHGAP12)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05505
 Crosstalk Info 
Epigenetic Regulator hsa_circ_0000231 (Circ_ARHGAP12)
Regulated Target Forkhead box protein M1 (FOXM1)
Crosstalk relationship m6A → ncRNA
Disease Cervical cancer
 Disease Info 
m6A Target: HLA complex group 11 (HCG11)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05524
 Crosstalk Info 
Epigenetic Regulator HLA complex group 11 (HCG11)
Regulated Target Serine/threonine-protein kinase LATS1 (LATS1)
Crosstalk relationship m6A → ncRNA
Disease Lung cancer
 Disease Info 
m6A Target: Cancer susceptibility 9 (CASC9)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05525
 Crosstalk Info 
Epigenetic Regulator Cancer susceptibility 9 (CASC9)
Regulated Target Hexokinase-2 (HK2)
Crosstalk relationship m6A → ncRNA
Disease Brain cancer
 Disease Info 
m6A Target: ZNFX1 antisense RNA 1 (ZFAS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05537
 Crosstalk Info 
Epigenetic Regulator ZNFX1 antisense RNA 1 (ZFAS1)
Regulated Target Obg-like ATPase 1 (OLA1)
Crosstalk relationship m6A → ncRNA
Disease Colorectal cancer
 Disease Info 
m6A Target: Prostate cancer associated transcript 6 (PCAT6)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05572
 Crosstalk Info 
Epigenetic Regulator Prostate cancer associated transcript 6 (PCAT6)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship m6A → ncRNA
Disease Prostate cancer
 Disease Info 
m6A Target: PTGS2 antisense RNA 1 (PACERR)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05574
 Crosstalk Info 
Epigenetic Regulator PTGS2 antisense RNA 1 (PACERR)
Regulated Target Krueppel-like factor 12 (KLF12)
Crosstalk relationship m6A → ncRNA
Disease Pancreatic ductal adenocarcinoma
 Disease Info 
m6A Target: DIAPH1 antisense RNA 1 (DIAPH1-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05602
 Crosstalk Info 
Epigenetic Regulator DIAPH1 antisense RNA 1 (DIAPH1-AS1)
Regulated Target LIM and SH3 domain protein 1 (LASP1)
Crosstalk relationship m6A → ncRNA
Disease Nasopharyngeal carcinoma
 Disease Info 
m6A Target: Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05631
 Crosstalk Info 
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Regulated Target Ubiquitin-like protein ATG12 (ATG12)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
m6A Target: BACE1 antisense RNA (BACE1-AS)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05641
 Crosstalk Info 
Epigenetic Regulator BACE1 antisense RNA (BACE1-AS)
Regulated Target hsa-miR-214-3p
Crosstalk relationship m6A → ncRNA
Disease Colorectal cancer
 Disease Info 
m6A Target: Long intergenic non-protein coding RNA 941 (LINC00941)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05736
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 941 (LINC00941)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship m6A → ncRNA
Disease Pancreatic cancer
 Disease Info 
m6A Target: AC026356.1
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05774
 Crosstalk Info 
Epigenetic Regulator AC026356.1
Crosstalk relationship m6A → ncRNA
Disease Lung cancer
 Disease Info 
m6A Target: FBXL19 antisense RNA 1 (FBXL19-AS1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05802
 Crosstalk Info 
Epigenetic Regulator FBXL19 antisense RNA 1 (FBXL19-AS1)
Regulated Target Zinc finger protein 765 (ZNF765)
Crosstalk relationship m6A → ncRNA
Disease Glioma
 Disease Info 
Drug DOX
 Drug Info 
Crosstalk ID: M6ACROT05885
 Crosstalk Info 
Epigenetic Regulator FBXL19 antisense RNA 1 (FBXL19-AS1)
Regulated Target Zinc finger protein 765 (ZNF765)
Crosstalk relationship ncRNA → m6A
Disease Glioma
 Disease Info 
Drug DOX
 Drug Info 
m6A Target: OIP5 antisense RNA 1 (OIP5-AS1)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05812
 Crosstalk Info 
Epigenetic Regulator OIP5 antisense RNA 1 (OIP5-AS1)
Regulated Target hsa-miR-495-3p
Crosstalk relationship m6A → ncRNA
Disease Glioma
 Disease Info 
Crosstalk ID: M6ACROT05875
 Crosstalk Info 
Epigenetic Regulator hsa-miR-495-3p
Regulated Target Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A)
Crosstalk relationship m6A → ncRNA
Disease Glioma
 Disease Info 
Crosstalk ID: M6ACROT05876
 Crosstalk Info 
Epigenetic Regulator hsa-miR-495-3p
Regulated Target Matrix metalloproteinase-14 (MMP14)
Crosstalk relationship m6A → ncRNA
Disease Glioma
 Disease Info 
m6A Target: Urothelial cancer associated 1 (UCA1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05817
 Crosstalk Info 
Epigenetic Regulator Urothelial cancer associated 1 (UCA1)
Crosstalk relationship m6A → ncRNA
m6A Target: Cell division cycle and apoptosis regulator protein 1 (CCAR1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05918
 Crosstalk Info 
Epigenetic Regulator Circ_ABCC4
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Prostate cancer
 Disease Info 
m6A Target: Transcription factor SOX-2 (SOX2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05921
 Crosstalk Info 
Epigenetic Regulator Circ_EPHB4
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Brain cancer
 Disease Info 
m6A Target: Programmed cell death 1 ligand 1 (CD274/PD-L1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05923
 Crosstalk Info 
Epigenetic Regulator hsa_circ_0058493 (Circ_RHBDD1)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship ncRNA → m6A
Disease Gastric cancer
 Disease Info 
Xenobiotics Compound(s) Regulating the m6A Methylation Regulator
Compound Name Lapatinib Investigative
Synonyms
Lapatinib; 231277-92-2; Lapatinib Ditosylate; Tykerb; GW572016; Lapatinib base; GW 572016; Tyverb; 388082-78-8; Lapatinib free base; UNII-0VUA21238F; Lapatinib (free base); 231277-92-2 (free base); GSK572016; MFCD09264194; FMM; N-(3-chloro-4-((3-fluorobenzyl)oxy)phenyl)-6-(5-(((2-(methylsulfonyl)ethyl)amino)methyl)furan-2-yl)quinazolin-4-amine; N-{3-CHLORO-4-[(3-FLUOROBENZYL)OXY]PHENYL}-6-[5-({[2-(METHYLSULFONYL)ETHYL]AMINO}METHYL)-2-FURYL]-4-QUINAZOLINAMINE; N-{3-chloro-4-[(3-fluorophenyl)methoxy]phenyl}-6-(5-{[(2-methanesulfonylethyl)amino]methyl}furan-2-yl)quinazolin-4-amine; CHEMBL554; N-[3-chloro-4-[(3-fluorophenyl)methoxy]phenyl]-6-[5-[(2-methylsulfonylethylamino)methyl]furan-2-yl]quinazolin-4-amine; CHEBI:49603; 0VUA21238F; NSC745750; GW-572016; NCGC00167507-01; C29H26ClFN4O4S; DSSTox_CID_26675; DSSTox_RID_81812; DSSTox_GSID_46675; 1210608-87-9; Lapatinib (INN); 4-Quinazolinamine, N-(3-chloro-4-((3-fluorophenyl)methoxy)phenyl)-6-(5-(((2-(methylsulfonyl)ethyl)amino)methyl)-2-furanyl)-; 4-Quinazolinamine, N-[3-chloro-4-[(3-fluorophenyl)methoxy]phenyl]-6-[5-[[[2-(methylsulfonyl)ethyl]amino]methyl]-2-furanyl]-; N-(3-chloro-4-((3-fluorophenyl)methoxy)phenyl)-6-(5-(((2-(methylsulfonyl)ethyl)amino)methyl)-2-furanyl)-4-quinazolinamine; N-(3-chloro-4-(3-fluorobenzyloxy)phenyl)-6-(5-((2-(methylsulfonyl)ethylamino)methyl)furan-2-yl)quinazolin-4-amine; n-[3-chloro-4-[(3-fluorophenyl)methoxy]phenyl]-6-[5-[[[2-(methylsulfonyl)ethyl]amino]methyl]-2-furanyl]-4-quinazolinamine; N-{3-chloro-4-[(3-fluorobenzyl)oxy]phenyl}-6-[5-({[2-(methylsulfonyl)ethyl]amino}methyl)furan-2-yl]quinazolin-4-amine; GSK 572016; CAS-231277-92-2; GW-2016; Lapatinib [INN:BAN]; GW 282974X; HSDB 8209; 1xkk; N-[3-Chloro-4-[(3-fluorobenzyl)oxy]phenyl]-6-[5-({[2-(methanesulphonyl)ethyl]amino}methyl)-2-furyl]-4-quinazolinamine; N-{3-Chloro-4-[(3-fluorobenzyl)oxy]phenyl}-6-[5-({[2-(methanesulphonyl)ethyl]amino}methyl)-2-furyl]-4-quinazolinamine; Lapatinib, Free base; Lapatinib 13C-D7; nchembio866-comp20; Kinome_3684; Kinome_3685; Lapatinib base- Bio-X; SCHEMBL8100; Lapatinib (GW572016); BDBM5445; cid_208908; GTPL5692; QCR-63; DTXSID7046675; AOB5254; EX-A402; SYN1052; BCPP000188; BCPP000189; HMS2089H10; HMS3244N06; HMS3244N10; HMS3244N14; HMS3744K11; Tykerb (TN) (Glaxo Smith Kline); BCP01874; ZINC1550477; Tox21_112505; NSC800780; AKOS005145766; Tox21_112505_1; AC-1314; BCP9000837; BCP9000838; CCG-270133; CM14421; DB01259; GSK-572016; GW-572016X; NSC-745750; NSC-800780; SB16918; NCGC00167507-02; NCGC00167507-03; NCGC00167507-04; NCGC00167507-09; 913989-15-8; AS-14065; BC164610; HY-50898; N-(3-Chloro-4-((3-fluorophenyl)methoxy)phenyl)-6-(5-((2-methylsulfonylethylamino)methyl)-2-furyl)quinazolin-4-amine; N-(3-Chloro-4-{[(3-fluorophenyl)methyl]oxy}phenyl)-6-[5-({[2-(methylsulfonyl)ethyl]amino}methyl)-2-furanyl]-4-quinazolinamine; Q570; AM20090641; FT-0659650; SW199101-5; A25184; D08108; J90020; AB01273965-01; AB01273965-02; AB01273965-03; AB01273965_04; AB01273965_05; 277L922; Q420323; Q-101353; SR-05000001472-1; BRD-K19687926-001-01-7; BRD-K19687926-379-02-5; GW572016;GW-572016;GW 572016; 1092929-10-6; GW-2016;N-(3-chloro-4-((3-fluorobenzyl)oxy)phenyl)-6-(5-(((2-(methylsulfonyl)ethyl)amino)methyl)furan-2-yl)quinazolin-4-amine;4-[[3-Chloro-4-(3-fluorobenzyloxy)phenyl]amino]-6-[5-[[(2-methanesulfonylethyl)amino]methyl]furan-2-yl]quinazoline; N-[3-chloro-4-(3-fluorobenzyloxy)phenyl]-6-[5-({[2-(methanesulfonyl)ethyl]amino}methyl)furan-2-yl]quinazolin-4-amine; N-[3-chloro-4-[(3-fluorophenyl)methoxy]phenyl]-6-[5-[(2-methylsulfonylethylamino)methyl]-2-furyl] quinazolin-4-amine; N-{3-chloro-4-[(3-fluoro-benzyl)oxy]phenyl}-6-[5-({2-(methylsulfonyl)ethyl]amino}methyl)-2-furyl]-4-quinazolinamine; N-{3-Chloro-4-[(3-fluorobenzyl)oxy]phenyl}-6-[5-({[2-(methane sulphonyl)ethyl]amino}methyl)-2-furyl]-4-quinazolinamine; N-{3-Chloro-4[(3-fluorobenzyl)oxy]phenyl}-6-[5-({[2-(methane sulphonyl)ethyl]amino}methyl)-2-furyl]-4-quinazolinamine; N3-Chloro-4-(3-fluorophenyl)methoxyphenyl-6-5-(2-methylsulfonylethylamino)methyl-2-furylquinazolin-4-amine
    Click to Show/Hide
External link
CID: 208908
Activity
IC50 = 9.95uM (TPC1SR cell)
 [112]
References
Ref 1 N6-methyladenosine reader YTH N6-methyladenosine RNA binding protein 3 or insulin like growth factor 2 mRNA binding protein 2 knockdown protects human bronchial epithelial cells from hypoxia/reoxygenation injury by inactivating p38 MAPK, AKT, ERK1/2, and NF-KappaB pathways. Bioengineered. 2022 May;13(5):11973-11986. doi: 10.1080/21655979.2021.1999550.
Ref 2 LncRNA-PACERR induces pro-tumour macrophages via interacting with miR-671-3p and m6A-reader IGF2BP2 in pancreatic ductal adenocarcinoma. J Hematol Oncol. 2022 May 7;15(1):52. doi: 10.1186/s13045-022-01272-w.
Ref 3 N(6)-methyladenosine (m(6)A) reader IGF2BP2 promotes gastric cancer progression via targeting SIRT1. Bioengineered. 2022 May;13(5):11541-11550. doi: 10.1080/21655979.2022.2068920.
Ref 4 m6A methylated EphA2 and VEGFA through IGF2BP2/3 regulation promotes vasculogenic mimicry in colorectal cancer via PI3K/AKT and ERK1/2 signaling. Cell Death Dis. 2022 May 21;13(5):483. doi: 10.1038/s41419-022-04950-2.
Ref 5 LINC00460/DHX9/IGF2BP2 complex promotes colorectal cancer proliferation and metastasis by mediating HMGA1 mRNA stability depending on m6A modification. J Exp Clin Cancer Res. 2021 Feb 1;40(1):52. doi: 10.1186/s13046-021-01857-2.
Ref 6 Recognition of RNA N(6)-methyladenosine by IGF2BP proteins enhances mRNA stability and translation. Nat Cell Biol. 2018 Mar;20(3):285-295. doi: 10.1038/s41556-018-0045-z. Epub 2018 Feb 23.
Ref 7 Specific Regulation of m(6)A by SRSF7 Promotes the Progression of Glioblastoma. Genomics Proteomics Bioinformatics. 2021 Dec 23:S1672-0229(21)00252-7. doi: 10.1016/j.gpb.2021.11.001. Online ahead of print.
Ref 8 YBX1 is required for maintaining myeloid leukemia cell survival by regulating BCL2 stability in an m6A-dependent manner. Blood. 2021 Jul 8;138(1):71-85. doi: 10.1182/blood.2020009676.
Ref 9 IGF2BP2 Regulates MALAT1 by Serving as an N6-Methyladenosine Reader to Promote NSCLC Proliferation. Front Mol Biosci. 2022 Jan 17;8:780089. doi: 10.3389/fmolb.2021.780089. eCollection 2021.
Ref 10 Pharmacokinetics and pharmacodynamics of saruplase, an unglycosylated single-chain urokinase-type plasminogen activator, in patients with acute myocardial infarction. Thromb Haemost. 1994 Nov;72(5):740-4.
Ref 11 Clinical pipeline report, company report or official report of Amgen (2009).
Ref 12 circNDUFB2 inhibits non-small cell lung cancer progression via destabilizing IGF2BPs and activating anti-tumor immunity. Nat Commun. 2021 Jan 12;12(1):295. doi: 10.1038/s41467-020-20527-z.
Ref 13 Discovery of the Highly Potent PI3K/mTOR Dual Inhibitor PF-04979064 through Structure-Based Drug Design. ACS Med Chem Lett. 2012 Nov 7;4(1):91-7. doi: 10.1021/ml300309h. eCollection 2013 Jan 10.
Ref 14 The "m6A writer" METTL3 and the "m6A reader" IGF2BP2 regulate cutaneous T-cell lymphomas progression via CDKN2A. Hematol Oncol. 2022 Apr 21. doi: 10.1002/hon.3005. Online ahead of print.
Ref 15 IGF2BP2 regulates DANCR by serving as an N6-methyladenosine reader. Cell Death Differ. 2020 Jun;27(6):1782-1794. doi: 10.1038/s41418-019-0461-z. Epub 2019 Dec 5.
Ref 16 IGF2BP2 Promotes Liver Cancer Growth Through an m6A-FEN1-Dependent Mechanism. Front Oncol. 2020 Nov 2;10:578816. doi: 10.3389/fonc.2020.578816. eCollection 2020.
Ref 17 A phase 1 dose escalation study of BI 831266, an inhibitor of Aurora kinase B, in patients with advanced solid tumors. Invest New Drugs. 2015 Apr;33(2):409-22. doi: 10.1007/s10637-014-0201-7. Epub 2014 Dec 23.
Ref 18 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1797).
Ref 19 m(6)A-dependent glycolysis enhances colorectal cancer progression. Mol Cancer. 2020 Apr 3;19(1):72. doi: 10.1186/s12943-020-01190-w.
Ref 20 Effect of Rifampin on the Pharmacokinetics of Apixaban, an Oral Direct Inhibitor of Factor Xa. Am J Cardiovasc Drugs. 2016 Apr;16(2):119-27. doi: 10.1007/s40256-015-0157-9.
Ref 21 Pharmacokinetic and pharmacodynamic characterization of a new formulation containing synergistic proportions of interferons alpha-2b and gamma (HeberPAG) in patients with mycosis fungoides: an open-label trial. BMC Pharmacol Toxicol. 2012 Dec 28;13:20. doi: 10.1186/2050-6511-13-20.
Ref 22 Progression of Thyroid Carcinoma Is Promoted by the m6A Methyltransferase METTL3 Through Regulating m(6)A Methylation on TCF1. Onco Targets Ther. 2020 Feb 21;13:1605-1612. doi: 10.2147/OTT.S234751. eCollection 2020.
Ref 23 Potent and selective inhibitors of the Met [hepatocyte growth factor/scatter factor (HGF/SF) receptor] tyrosine kinase block HGF/SF-induced tumor cell growth and invasion. Mol Cancer Ther. 2003 Nov;2(11):1085-92.
Ref 24 A new hope in immunotherapy for malignant gliomas: adoptive T cell transfer therapy. J Immunol Res. 2014;2014:326545. doi: 10.1155/2014/326545. Epub 2014 Jun 9.
Ref 25 Cytochromes P450 in crustacea. Comp Biochem Physiol C Pharmacol Toxicol Endocrinol. 1998 Nov;121(1-3):157-72. doi: 10.1016/s0742-8413(98)10036-1.
Ref 26 IGF2BP2 promotes gastric cancer progression by regulating the IGF1R-RhoA-ROCK signaling pathway. Cell Signal. 2022 Jun;94:110313. doi: 10.1016/j.cellsig.2022.110313. Epub 2022 Mar 16.
Ref 27 m(6) A modification of lncRNA PCAT6 promotes bone metastasis in prostate cancer through IGF2BP2-mediated IGF1R mRNA stabilization. Clin Transl Med. 2021 Jun;11(6):e426. doi: 10.1002/ctm2.426.
Ref 28 WTAP-mediated m(6)A modification of lncRNA DIAPH1-AS1 enhances its stability to facilitate nasopharyngeal carcinoma growth and metastasis. Cell Death Differ. 2022 Jun;29(6):1137-1151. doi: 10.1038/s41418-021-00905-w. Epub 2022 Jan 8.
Ref 29 FTO downregulation mediated by hypoxia facilitates colorectal cancer metastasis. Oncogene. 2021 Aug;40(33):5168-5181. doi: 10.1038/s41388-021-01916-0. Epub 2021 Jul 3.
Ref 30 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2030).
Ref 31 LncRNA LINRIS stabilizes IGF2BP2 and promotes the aerobic glycolysis in colorectal cancer. Mol Cancer. 2019 Dec 2;18(1):174. doi: 10.1186/s12943-019-1105-0.
Ref 32 Inhibition of poly (ADP-ribose) polymerase as a protective effect of nicaraven in ionizing radiation- and ara-C-induced cell death. Anticancer Res. 2006 Sep-Oct;26(5A):3421-7.
Ref 33 WO patent application no. 2014,1441,21, Classification and actionability indices for lung cancer.
Ref 34 N6-methyladenosine reader IMP2 stabilizes the ZFAS1/OLA1 axis and activates the Warburg effect: implication in colorectal cancer. J Hematol Oncol. 2021 Nov 7;14(1):188. doi: 10.1186/s13045-021-01204-0.
Ref 35 Structure-based optimization of phenylbutyrate-derived histone deacetylase inhibitors. J Med Chem. 2005 Aug 25;48(17):5530-5. doi: 10.1021/jm0503749.
Ref 36 Tarloxotinib Is a Hypoxia-Activated Pan-HER Kinase Inhibitor Active Against a Broad Range of HER-Family Oncogenes. Clin Cancer Res. 2021 Mar 1;27(5):1463-1475. doi: 10.1158/1078-0432.CCR-20-3555. Epub 2020 Dec 22.
Ref 37 N6-Methyladenosine Modification of PTTG3P Contributes to Colorectal Cancer Proliferation via YAP1. Front Oncol. 2021 Sep 30;11:669731. doi: 10.3389/fonc.2021.669731. eCollection 2021.
Ref 38 Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator. Chem Biol. 2000 Apr;7(4):299-312. doi: 10.1016/s1074-5521(00)00104-6.
Ref 39 IGF2BP2 promotes the progression of colorectal cancer through a YAP-dependent mechanism. Cancer Sci. 2021 Oct;112(10):4087-4099. doi: 10.1111/cas.15083. Epub 2021 Aug 3.
Ref 40 N(6)-methyladenosine modification of circNSUN2 facilitates cytoplasmic export and stabilizes HMGA2 to promote colorectal liver metastasis. Nat Commun. 2019 Oct 16;10(1):4695. doi: 10.1038/s41467-019-12651-2.
Ref 41 Clinical pipeline report, company report or official report of Genmab.
Ref 42 microRNA-320b suppresses HNF4G and IGF2BP2 expression to inhibit angiogenesis and tumor growth of lung cancer. Carcinogenesis. 2021 May 28;42(5):762-771. doi: 10.1093/carcin/bgab023.
Ref 43 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2616).
Ref 44 Clinical pipeline report, company report or official report of Genentech (2009).
Ref 45 METTL3 facilitates tumor progression via an m(6)A-IGF2BP2-dependent mechanism in colorectal carcinoma. Mol Cancer. 2019 Jun 24;18(1):112. doi: 10.1186/s12943-019-1038-7.
Ref 46 Clinical pipeline report, company report or official report of AbbVie.
Ref 47 AST1306, a novel irreversible inhibitor of the epidermal growth factor receptor 1 and 2, exhibits antitumor activity both in vitro and in vivo. PLoS One. 2011;6(7):e21487. doi: 10.1371/journal.pone.0021487. Epub 2011 Jul 18.
Ref 48 US patent application no. 6,867,039, Antisense modulation of dual specific phosphatase 5 expression.
Ref 49 Up-regulation of VANGL1 by IGF2BPs and miR-29b-3p attenuates the detrimental effect of irradiation on lung adenocarcinoma. J Exp Clin Cancer Res. 2020 Nov 23;39(1):256. doi: 10.1186/s13046-020-01772-y.
Ref 50 The m6A methyltransferase METTL3 aggravates the progression of nasopharyngeal carcinoma through inducing EMT by m6A-modified Snail mRNA. Minerva Med. 2022 Apr;113(2):309-314. doi: 10.23736/S0026-4806.20.06653-7. Epub 2020 Jun 5.
Ref 51 RNA N6-methyladenosine reader IGF2BP2 promotes lymphatic metastasis and epithelial-mesenchymal transition of head and neck squamous carcinoma cells via stabilizing slug mRNA in an m6A-dependent manner. J Exp Clin Cancer Res. 2022 Jan 3;41(1):6. doi: 10.1186/s13046-021-02212-1.
Ref 52 m(6)A reader IGF2BP2-stabilized CASC9 accelerates glioblastoma aerobic glycolysis by enhancing HK2 mRNA stability. Cell Death Discov. 2021 Oct 13;7(1):292. doi: 10.1038/s41420-021-00674-y.
Ref 53 LncRNA HCG11 mediated by METTL14 inhibits the growth of lung adenocarcinoma via IGF2BP2/LATS1. Biochem Biophys Res Commun. 2021 Nov 26;580:74-80. doi: 10.1016/j.bbrc.2021.09.083. Epub 2021 Oct 2.
Ref 54 IGF2BP2 knockdown suppresses thyroid cancer progression by reducing the expression of long non-coding RNA HAGLR. Pathol Res Pract. 2021 Sep;225:153550. doi: 10.1016/j.prp.2021.153550. Epub 2021 Jul 13.
Ref 55 Preclinical pharmacokinetics and in vitro metabolism of BMS-690514, a potent inhibitor of EGFR and VEGFR2. J Pharm Sci. 2010 Aug;99(8):3579-93. doi: 10.1002/jps.22099.
Ref 56 m6A modification promotes miR-133a repression during cardiac development and hypertrophy via IGF2BP2. Cell Death Discov. 2021 Jun 26;7(1):157. doi: 10.1038/s41420-021-00552-7.
Ref 57 IGF2BP2-modified circular RNA circARHGAP12 promotes cervical cancer progression by interacting m(6)A/FOXM1 manner. Cell Death Discov. 2021 Aug 14;7(1):215. doi: 10.1038/s41420-021-00595-w.
Ref 58 Effect of breast cancer resistance protein (Bcrp/Abcg2) on the disposition of phytoestrogens. Mol Pharmacol. 2007 Oct;72(4):967-75.
Ref 59 Clinical pipeline report, company report or official report of Actinium Pharmaceuticals.
Ref 60 BiPar Sciences Co-founder Reunites Management Team At TriAct Therapeutics to Advance Clinical Stage Cancer Programs. TriAct Therapeutics. Sept. 10, 2009.
Ref 61 ClinicalTrials.gov (NCT02442297) T Cells Expressing HER2-specific Chimeric Antigen Receptors(CAR) for Patients With Glioblastoma
Ref 62 Resistance to the translation initiation inhibitor silvestrol is mediated by ABCB1/P-glycoprotein overexpression in acute lymphoblastic leukemia cells. AAPS J. 2011 Sep;13(3):357-64.
Ref 63 Monoclonal antibodies to target epidermal growth factor receptor-positive tumors: a new paradigm for cancer therapy. Cancer. 2002 Mar 1;94(5):1593-611. doi: 10.1002/cncr.10372.
Ref 64 AZD1080, a novel GSK3 inhibitor, rescues synaptic plasticity deficits in rodent brain and exhibits peripheral target engagement in humans. J Neurochem. 2013 May;125(3):446-56. doi: 10.1111/jnc.12203. Epub 2013 Mar 11.
Ref 65 Mechanism-based inactivation of cytochrome P450 3A4 by lapatinib. Mol Pharmacol. 2010 Oct;78(4):693-703. doi: 10.1124/mol.110.065839. Epub 2010 Jul 12.
Ref 66 Modeling and simulation to support dose selection and clinical development of SC-75416, a selective COX-2 inhibitor for the treatment of acute and chronic pain. Clin Pharmacol Ther. 2008 Jun;83(6):857-66. doi: 10.1038/sj.clpt.6100374. Epub 2007 Sep 19.
Ref 67 Gevokizumab, an anti-IL-1Beta mAb for the potential treatment of type 1 and 2 diabetes, rheumatoid arthritis and cardiovascular disease. Curr Opin Mol Ther. 2010 Dec;12(6):755-69.
Ref 68 Apalutamide: First Global Approval. Drugs. 2018 Apr;78(6):699-705. doi: 10.1007/s40265-018-0900-z.
Ref 69 Clinical pipeline report, company report or official report of Innovent Biologics.
Ref 70 Nonclinical pharmacokinetics and in vitro metabolism of H3B-6545, a novel selective ERAlpha covalent antagonist (SERCA). Cancer Chemother Pharmacol. 2019 Jan;83(1):151-160. doi: 10.1007/s00280-018-3716-3. Epub 2018 Nov 1.
Ref 71 A nonpromoting phorbol from the samoan medicinal plant Homalanthus nutans inhibits cell killing by HIV-1. J Med Chem. 1992 May 29;35(11):1978-86. doi: 10.1021/jm00089a006.
Ref 72 Selective androgen receptor modulators (SARMs) negatively regulate triple-negative breast cancer growth and epithelial:mesenchymal stem cell signaling. PLoS One. 2014 Jul 29;9(7):e103202. doi: 10.1371/journal.pone.0103202. eCollection 2014.
Ref 73 Substitution of arginine with proline and proline derivatives in melanocyte-stimulating hormones leads to selectivity for human melanocortin 4 receptor. J Med Chem. 2009 Jun 25;52(12):3627-35. doi: 10.1021/jm801300c.
Ref 74 Determinants of cytochrome P450 2C8 substrate binding: structures of complexes with montelukast, troglitazone, felodipine, and 9-cis-retinoic acid. J Biol Chem. 2008 Jun 20;283(25):17227-37. doi: 10.1074/jbc.M802180200. Epub 2008 Apr 15.
Ref 75 Clinical pipeline report, company report or official report of Splash Pharmaceuticals.
Ref 76 MMAE Delivery Using the Bicycle Toxin Conjugate BT5528. Mol Cancer Ther. 2020 Jul;19(7):1385-1394. doi: 10.1158/1535-7163.MCT-19-1092. Epub 2020 May 12.
Ref 77 Characterization of sirtuin inhibitors in nematodes expressing a muscular dystrophy protein reveals muscle cell and behavioral protection by specific sirtinol analogues. J Med Chem. 2010 Feb 11;53(3):1407-11. doi: 10.1021/jm9013345.
Ref 78 Drugging the p53 pathway: understanding the route to clinical efficacy. Nat Rev Drug Discov. 2014 Mar;13(3):217-36. doi: 10.1038/nrd4236.
Ref 79 Peroxisome proliferator-activated receptor alpha/gamma dual agonists for the treatment of type 2 diabetes. J Med Chem. 2004 Aug 12;47(17):4118-27. doi: 10.1021/jm030631e.
Ref 80 Structural basis of fatty acid substrate binding to cyclooxygenase-2. J Biol Chem. 2010 Jul 16;285(29):22152-63. doi: 10.1074/jbc.M110.119867. Epub 2010 May 12.
Ref 81 MI-219-zinc combination: a new paradigm in MDM2 inhibitor-based therapy. Oncogene. 2011 Jan 6;30(1):117-26. doi: 10.1038/onc.2010.403. Epub 2010 Sep 6.
Ref 82 Fast three dimensional pharmacophore virtual screening of new potent non-steroid aromatase inhibitors. J Med Chem. 2009 Jan 8;52(1):143-50. doi: 10.1021/jm800945c.
Ref 83 National Cancer Institute Drug Dictionary (drug id 577812).
Ref 84 Differential inhibition of murine Bcrp1/Abcg2 and human BCRP/ABCG2 by the mycotoxin fumitremorgin C. Eur J Pharmacol. 2010 Oct 10;644(1-3):41-8. doi: 10.1016/j.ejphar.2010.07.016. Epub 2010 Jul 22.
Ref 85 National Cancer Institute Drug Dictionary (drug id 747683).
Ref 86 AMXI-5001, a novel dual parp1/2 and microtubule polymerization inhibitor for the treatment of human cancers. Am J Cancer Res. 2020 Aug 1;10(8):2649-2676. eCollection 2020.
Ref 87 Immunotherapy with engineered bacteria by targeting the STING pathway for anti-tumor immunity. Nat Commun. 2020 Jun 1;11(1):2739. doi: 10.1038/s41467-020-16602-0.
Ref 88 The Role of Levomilnacipran in the Management of Major Depressive Disorder: A Comprehensive Review. Curr Neuropharmacol. 2016;14(2):191-9. doi: 10.2174/1570159x14666151117122458.
Ref 89 Whole-body organ-level and kidney micro-dosimetric evaluations of (64)Cu-loaded HER2/ErbB2-targeted liposomal doxorubicin ((64)Cu-MM-302) in rodents and primates. EJNMMI Res. 2015 Apr 14;5:24. doi: 10.1186/s13550-015-0096-0. eCollection 2015.
Ref 90 Specificity and mechanism of action of some commonly used protein kinase inhibitors. Biochem J. 2000 Oct 1;351(Pt 1):95-105. doi: 10.1042/0264-6021:3510095.
Ref 91 [Efficacy of different thalidomide regimens for patients with multiple myeloma and its relationship with TNF-alpha level]. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2008 Dec;16(6):1312-5.
Ref 92 Role of the breast cancer resistance protein (ABCG2) in drug transport. AAPS J. 2005 May 11;7(1):E118-33.
Ref 93 Cmpany report (Arraybiopharma)
Ref 94 2,3,5-Trisubstituted pyridines as selective AKT inhibitors. Part II: Improved drug-like properties and kinase selectivity from azaindazoles. Bioorg Med Chem Lett. 2010 Jan 15;20(2):679-83. doi: 10.1016/j.bmcl.2009.11.060. Epub 2009 Nov 20.
Ref 95 Imidazopyridine-Based Fatty Acid Synthase Inhibitors That Show Anti-HCV Activity and in Vivo Target Modulation. ACS Med Chem Lett. 2013 January 10; 4(1): 113-117.
Ref 96 Indazolylamino quinazolines and pyridopyrimidines as inhibitors of the EGFr and C-erbB-2. Bioorg Med Chem Lett. 2001 Jun 4;11(11):1401-5. doi: 10.1016/s0960-894x(01)00219-0.
Ref 97 Decrease of cyclin D1 in the human lung adenocarcinoma cell line A-427 by 7-hydroxycoumarin. Lung Cancer. 2001 Nov;34(2):185-94. doi: 10.1016/s0169-5002(01)00263-x.
Ref 98 Triple negative breast cancer--current status and prospective targeted treatment based on HER1 (EGFR), TOP2A and C-MYC gene assessment. Biomed Pap Med Fac Univ Palacky Olomouc Czech Repub. 2009 Mar;153(1):13-7. doi: 10.5507/bp.2009.002.
Ref 99 P-glycoprotein and breast cancer resistance protein in acute myeloid leukaemia cells treated with the aurora-B kinase inhibitor barasertib-hQPA. BMC Cancer. 2011 Jun 16;11:254.
Ref 100 A CXCR4 antagonist CTCE-9908 inhibits primary tumor growth and metastasis of breast cancer. J Surg Res. 2009 Aug;155(2):231-6. doi: 10.1016/j.jss.2008.06.044. Epub 2008 Aug 9.
Ref 101 Interaction of the breast cancer resistance protein with plant polyphenols. Biochem Biophys Res Commun. 2004 Apr 23;317(1):269-75.
Ref 102 F-12509A, a new sphingosine kinase inhibitor, produced by a discomycete. J Antibiot (Tokyo). 2000 May;53(5):459-66. doi: 10.7164/antibiotics.53.459.
Ref 103 US patent application no. 6,271,030, Antisense inhibition of C/EBP beta expression.
Ref 104 The m6A writers regulated by the IL-6/STAT3 inflammatory pathway facilitate cancer cell stemness in cholangiocarcinoma. Cancer Biol Med. 2021 Aug 4;19(3):343-57. doi: 10.20892/j.issn.2095-3941.2020.0661. Online ahead of print.
Ref 105 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2771).
Ref 106 The mannose-6-phosphate analogue, PXS64, inhibits fibrosis via TGF-Beta1 pathway in human lung fibroblasts. Immunol Lett. 2015 Jun;165(2):90-101. doi: 10.1016/j.imlet.2015.04.003. Epub 2015 Apr 27.
Ref 107 A RNA antagonist of hypoxia-inducible factor-1alpha, EZN-2968, inhibits tumor cell growth. Mol Cancer Ther. 2008 Nov;7(11):3598-608. doi: 10.1158/1535-7163.MCT-08-0510. Epub 2008 Oct 30.
Ref 108 Clinical pipeline report, company report or official report of ZAI Lab.
Ref 109 Identification of cytochromes P450 2C9 and 3A4 as the major catalysts of phenprocoumon hydroxylation in vitro. Eur J Clin Pharmacol. 2004 May;60(3):173-82. doi: 10.1007/s00228-004-0740-5. Epub 2004 Mar 31.
Ref 110 Gene Signature and Identification of Clinical Trait-Related m(6) A Regulators in Pancreatic Cancer. Front Genet. 2020 Jul 10;11:522. doi: 10.3389/fgene.2020.00522. eCollection 2020.
Ref 111 Rindopepimut, a 14-mer injectable peptide vaccine against EGFRvIII for the potential treatment of glioblastoma multiforme. Curr Opin Mol Ther. 2010 Dec;12(6):741-54.
Ref 112 IGF2BP2-dependent activation of ERBB2 signaling contributes to acquired resistance to tyrosine kinase inhibitor in differentiation therapy of radioiodine-refractory papillary thyroid cancer. Cancer Lett. 2022 Feb 28;527:10-23. doi: 10.1016/j.canlet.2021.12.005. Epub 2021 Dec 9.