General Information of the m6A Regulator (ID: REG00001)
Regulator Name Fat mass and obesity-associated protein (FTO)
Synonyms
Alpha-ketoglutarate-dependent dioxygenase FTO; U6 small nuclear RNA (2'-O-methyladenosine-N(6)-)-demethylase FTO; U6 small nuclear RNA N(6)-methyladenosine-demethylase FTO; mRNA (2'-O-methyladenosine-N(6)-)-demethylase FTO; m6A(m)-demethylase FTO; mRNA N(6)-methyladenosine demethylase FTO; tRNA N1-methyl adenine demethylase FTO; KIAA1752
    Click to Show/Hide
Gene Name FTO
Sequence
MKRTPTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLILREASSVSEE
LHKEVQEAFLTLHKHGCLFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPV
KGSNIKHTEAEIAAACETFLKLNDYLQIETIQALEELAAKEKANEDAVPLCMSADFPRVG
MGSSYNGQDEVDIKSRAAYNVTLLNFMDPQKMPYLKEEPYFGMGKMAVSWHHDENLVDRS
AVAVYSYSCEGPEEESEDDSHLEGRDPDIWHVGFKISWDIETPGLAIPLHQGDCYFMLDD
LNATHQHCVLAGSQPRFSSTHRVAECSTGTLDYILQRCQLALQNVCDDVDNDDVSLKSFE
PAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHE
VKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDD
ASMPLPFDLTDIVSELRGQLLEAKP
    Click to Show/Hide
Family fto family
Function
RNA demethylase that mediates oxidative demethylation of different RNA species, such as mRNAs, tRNAs and snRNAs, and acts as a regulator of fat mass, adipogenesis and energy homeostasis . Specifically demethylates N(6)-methyladenosine (m6A) RNA, the most prevalent internal modification of messenger RNA (mRNA) in higher eukaryotes . M6A demethylation by FTO affects mRNA expression and stability . Also able to demethylate m6A in U6 small nuclear RNA (snRNA). Mediates demethylation of N(6),2'-O-dimethyladenosine cap (m6A(m)), by demethylating the N(6)-methyladenosine at the second transcribed position of mRNAs and U6 snRNA . Demethylation of m6A(m) in the 5'-cap by FTO affects mRNA stability by promoting susceptibility to decapping . Also acts as a tRNA demethylase by removing N(1)-methyladenine from various tRNAs . Has no activity towards 1-methylguanine . Has no detectable activity towards double-stranded DNA . Also able to repair alkylated DNA and RNA by oxidative demethylation: demethylates single-stranded RNA containing 3-methyluracil, single-stranded DNA containing 3-methylthymine and has low demethylase activity towards single-stranded DNA containing 1-methyladenine or 3-methylcytosine . Ability to repair alkylated DNA and RNA is however unsure in vivo. Involved in the regulation of fat mass, adipogenesis and body weight, thereby contributing to the regulation of body size and body fat accumulation . Involved in the regulation of thermogenesis and the control of adipocyte differentiation into brown or white fat cells. Regulates activity of the dopaminergic midbrain circuitry via its ability to demethylate m6A in mRNAs (By similarity). Plays an oncogenic role in a number of acute myeloid leukemias by enhancing leukemic oncogene-mediated cell transformation: acts by mediating m6A demethylation of target transcripts such as MYC, CEBPA, ASB2 and RARA, leading to promote their expression.
    Click to Show/Hide
Gene ID 79068
Uniprot ID
FTO_HUMAN
Regulator Type WRITER ERASER READER
Mechanism Diagram Click to View the Original Diagram
Target Genes Click to View Potential Target Genes of This Regulator
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
FTO can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Browse Target Gene related Drug
ADP-ribosylation factor-like protein 5B (ARL5B)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: 7.32E-01
p-value: 5.39E-08
More Results Click to View More RNA-seq Results
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Cell Process Cell invasion and migration
In-vitro Model
T-47D Invasive breast carcinoma Homo sapiens CVCL_0553
SK-BR-3 Breast adenocarcinoma Homo sapiens CVCL_0033
MDA-MB-453 Breast adenocarcinoma Homo sapiens CVCL_0418
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
BT-549 Invasive breast carcinoma Homo sapiens CVCL_1092
BT-474 Invasive breast carcinoma Homo sapiens CVCL_0179
Response Summary FTO up-regulated ADP-ribosylation factor-like protein 5B (ARL5B) by inhibiting miR-181b-3p. The carcinogenic activity of FTO in promoting the invasion and migration of breast cancer cells via the FTO/miR-181b-3p/ARL5B signaling pathway.
Ankyrin repeat and SOCS box protein 2 (ASB2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 8.19E-01
p-value: 3.80E-03
More Results Click to View More RNA-seq Results
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Responsed Drug Tretinoin Approved
Target Regulation Down regulation
Cell Process RNA stability
RNA degradation (hsa03018)
In-vitro Model
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KOCL-48 Childhood acute monocytic leukemia Homo sapiens CVCL_6867
Mono-Mac-6 Adult acute monocytic leukemia Homo sapiens CVCL_1426
Response Summary FTO enhances leukemic oncogene-mediated cell transformation and leukemogenesis, and inhibits all-trans-retinoic acid (ATRA)-induced AML cell differentiation, through regulating expression of targets such as Ankyrin repeat and SOCS box protein 2 (ASB2) and RARA by reducing m6A levels in these mRNA transcripts.
Apolipoprotein E (APOE)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 1.26E+00
p-value: 1.34E-03
More Results Click to View More RNA-seq Results
Thyroid Cancer [ICD-11: 2D10]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Papillary thyroid cancer [ICD-11: 2D10.1]
Target Regulation Down regulation
Pathway Response JAK-STAT signaling pathway hsa04630
Glycolysis / Gluconeogenesis hsa00010
Cell Process Glycolysis
In-vitro Model
TPC-1 Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
Nthy-ori 3-1 Normal Homo sapiens CVCL_2659
K1 Thyroid gland papillary carcinoma Homo sapiens CVCL_2537
IHH-4 Thyroid gland papillary carcinoma Homo sapiens CVCL_2960
B-CPAP Thyroid gland carcinoma Homo sapiens CVCL_0153
Response Summary FTO acts as a tumor suppressor to inhibit tumor glycolysis in Papillary thyroid cancer(PTC). FTO/Apolipoprotein E (APOE) axis inhibits PTC glycolysis by modulating IL-6/JAK2/STAT3 signaling pathway.
Apoptosis regulator Bcl-2 (BCL2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: -6.55E-01
p-value: 1.57E-02
More Results Click to View More RNA-seq Results
Breast cancer [ICD-11: 2C60]
In total 3 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Meclofenamic acid Approved
Pathway Response Apoptosis hsa04210
PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation
Cell apoptosis
Response Summary Studies of the aberrant expression of m6A mediators in breast cancer revealed that they were associated with different BC subtypes and functions, such as proliferation, apoptosis, stemness, the cell cycle, migration, and metastasis, through several factors and signaling pathways, such as Apoptosis regulator Bcl-2 (BCL2) and the PI3K/Akt pathway, among others. Fat mass and obesity-associated protein (FTO) was identified as the first m6A demethylase, and a series of inhibitors that target FTO were reported to have potential for the treatment of BC by inhibiting cell proliferation and promoting apoptosis.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug R-2HG Investigative
Pathway Response Apoptosis hsa04210
PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation
Cell apoptosis
Response Summary Studies of the aberrant expression of m6A mediators in breast cancer revealed that they were associated with different BC subtypes and functions, such as proliferation, apoptosis, stemness, the cell cycle, migration, and metastasis, through several factors and signaling pathways, such as Apoptosis regulator Bcl-2 (BCL2) and the PI3K/Akt pathway, among others. Fat mass and obesity-associated protein (FTO) was identified as the first m6A demethylase, and a series of inhibitors that target FTO were reported to have potential for the treatment of BC by inhibiting cell proliferation and promoting apoptosis.
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Breast cancer [ICD-11: 2C60]
Pathway Response Apoptosis hsa04210
PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation
Cell apoptosis
Response Summary Studies of the aberrant expression of m6A mediators in breast cancer revealed that they were associated with different BC subtypes and functions, such as proliferation, apoptosis, stemness, the cell cycle, migration, and metastasis, through several factors and signaling pathways, such as Apoptosis regulator Bcl-2 (BCL2) and the PI3K/Akt pathway, among others. Fat mass and obesity-associated protein (FTO) was identified as the first m6A demethylase, and a series of inhibitors that target FTO were reported to have potential for the treatment of BC by inhibiting cell proliferation and promoting apoptosis.
ATP-binding cassette sub-family C member 10 (ABCC10)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Mouse hippocampus Mus musculus
Treatment: FTO knockout mice hippocampus
Control: Wild type hippocampus
GSE94098
Regulation
logFC: 6.58E-01
p-value: 2.09E-04
More Results Click to View More RNA-seq Results
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [5]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Gefitinib Approved
Target Regulation Up regulation
Pathway Response ABC transporters hsa02010
In-vitro Model
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
In-vivo Model Mice were randomized into three groups (n = 7/group), 1 × 107 PC9 cells absorbed exosomes were subcutaneously injected into the Bilateral groin of mice. Treatment began 1 week following injection, the mice were intraperitoneally injected with gefitinib (30 mg/kg/day).
Response Summary Not only FTO knockdown enhanced the gefitinib sensitivity of GR cells but also FTO reduction in donor exosomes alleviated the acquired resistance of recipient non-small cell lung cancer PC9 cells. FTO/YTHDF2/ATP-binding cassette sub-family C member 10 (ABCC10) axis played a role in intercellular transmission of GR cell-derived exosome-mediated gefitinib resistance.
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (BNIP3)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: 3.13E+00
p-value: 6.97E-04
More Results Click to View More RNA-seq Results
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell colony formation
Cell metastasis
In-vitro Model
4 T1 (Mouse breast cancer cells)
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
In-vivo Model For the subcutaneous implantation model, 5 4-week-old female Balb/c mice were randomly grouped and injected with 1 × 106 shCtrl, shFTO or shFTO/shBNIP3 KD 4 T1 cells. For tumor metastasis mouse model, 5 4-week-old female Balb/c mice were randomly grouped and injected with 1 × 106 shCtrl, shFTO or shFTO/shBNIP3 KD 4 T1 cells via tail vein. For orthotopic xenograft mouse model, 5 4-week-old female NOD/SCID mice were randomly grouped.
Response Summary FTO mediated m6A demethylation in the 3'UTR of BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (BNIP3) mRNA and induced its degradation via an YTHDF2 independent mechanism. FTO serves as a novel potential therapeutic target for breast cancer.
Sepsis [ICD-11: 1G40]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [69]
Responsed Disease Sepsis [ICD-11: 1G40]
Target Regulation Up regulation
In-vivo Model To assess mortality rates, mice were intraperitoneally administered LPS (30 mg/kg), with mdivi (3 mg/kg) given intraperitoneally 1 h before LPS challenge and then continued for 3 consecutive days. The 72-h mortality was subsequently recorded. For evaluating heart injury, mice received an injection of LPS (10 mg/kg), with songorine (10 or 50 mg/kg) administered 1 h before and 12 h after LPS treatment. Mice were euthanized 24 h later for heart collection.
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [68]
Responsed Disease Osteoarthritis [ICD-11: FA05]
C-X-C chemokine receptor type 4 (CXCR4)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 9.72E-01
p-value: 3.86E-03
More Results Click to View More RNA-seq Results
Melanoma [ICD-11: 2C30]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Melanoma [ICD-11: 2C30]
Responsed Drug PMID31239444-anti-PD1 antibody Investigative
Target Regulation Up regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Cell Process mRNA decay
In-vitro Model
B16-F10 Mouse melanoma Mus musculus CVCL_0159
CHL-1 Melanoma Homo sapiens CVCL_1122
624-mel Melanoma Homo sapiens CVCL_8054
NHEM (Normal Human Epidermal Melanocytes)
SK-MEL-30 Cutaneous melanoma Homo sapiens CVCL_0039
WM115 Melanoma Homo sapiens CVCL_0040
WM35 Melanoma Homo sapiens CVCL_0580
WM3670 Melanoma Homo sapiens CVCL_6799
WM793 Melanoma Homo sapiens CVCL_8787
In-vivo Model When the tumors reached a volume of 80-100 mm3, mice were treated with anti-PD-1 or isotype control antibody (200 ug/mouse) by i.p. injection, every other day for three times. For IFNγ blockade treatment, C57BL/6 mice were treated with anti-IFNγ antibody or isotype control IgG (250 ug/mouse) every other day after tumor cell inoculation.
Response Summary These findings demonstrate a crucial role of FTO as an m6A demethylase in promoting melanoma tumorigenesis and anti-PD-1 resistance, and suggest that the combination of FTO inhibition with anti-PD-1 blockade reduces the resistance to immunotherapy in melanoma. Knockdown of FTO increases m6A methylation in the critical protumorigenic melanoma cell-intrinsic genes including PD-1 (PDCD1), C-X-C chemokine receptor type 4 (CXCR4), and SOX10, leading to increased RNA decay through the m6A reader YTHDF2.
Caveolin-1 (CAV1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: 3.45E+00
p-value: 8.00E-05
More Results Click to View More RNA-seq Results
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Down regulation
In-vitro Model
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
In-vivo Model For the tumor growth analysis, AGS cells were subcutaneously injected into nude mice, and then the tumor volumes were monitored every 5 days. Tumor volumes were estimated based on the length and width and calculated using the following formula: tumor volume = (length × width2)/2. About 1 month later, the nude mice were sacrificed, and then tumors were excised, pictured, and weighed. For the tumor metastasis analysis, AGS cells were injected into nude mice by Tail Vein. About 1 month later, the nude mice were sacrificed, and then lung with metastasis lesions were excised, pictured, and counted.
Response Summary This study demonstrated that the key demethylase of m6A FTO promoted the proliferation and metastasis of gastric cancer via regulating the mitochondrial fission/fusion and metabolism. In terms of mechanism, FTO improved the degradation of Caveolin-1 (CAV1) mRNA via its demethylation.
CCAAT/enhancer-binding protein alpha (CEBPA)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 6.07E-01
p-value: 3.92E-03
More Results Click to View More RNA-seq Results
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Glioma [ICD-11: 2A00.0]
Responsed Drug R-2HG Investigative
Target Regulation Down regulation
Cell Process Glutamine metabolism
Cell apoptosis
In-vitro Model
8-MG-BA Glioblastoma Homo sapiens CVCL_1052
A-172 Glioblastoma Homo sapiens CVCL_0131
DK-MG Glioblastoma Homo sapiens CVCL_1173
GaMG Glioblastoma Homo sapiens CVCL_1226
HEL Erythroleukemia Homo sapiens CVCL_0001
Jurkat T acute lymphoblastic leukemia Homo sapiens CVCL_0065
KOCL-45 B acute lymphoblastic leukemia Homo sapiens CVCL_3993
KOCL-48 Childhood acute monocytic leukemia Homo sapiens CVCL_6867
KOCL-50 B acute lymphoblastic leukemia Homo sapiens CVCL_6866
KOCL-51 B acute lymphoblastic leukemia Homo sapiens CVCL_6865
KOCL-69 B acute lymphoblastic leukemia Homo sapiens CVCL_3995
KOPN-1 B acute lymphoblastic leukemia Homo sapiens CVCL_3937
LN-18 Glioblastoma Homo sapiens CVCL_0392
LN-229 Glioblastoma Homo sapiens CVCL_0393
MA9.3 (MA9.3)
MA9.6ITD (MLL-AF9 plus FLT3-ITD)
MA9.6RAS (MLL-AF9 plus NRasG12D)
MA9.6 (MLL-AF9)
MA9.6ITD (MLL-AF9 plus FLT3-ITD)
MA9.6RAS (MLL-AF9 plus NRasG12D)
ME-1 [Human leukemia] Adult acute myeloid leukemia Homo sapiens CVCL_2110
ML-2 Adult acute myeloid leukemia Homo sapiens CVCL_1418
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
PL21 Familial adenomatous polyposis Homo sapiens CVCL_JM48
T98G Glioblastoma Homo sapiens CVCL_0556
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
In-vivo Model For R-2HG injection mouse models, sensitive (NOMO-1 and MA9.3ITD) or resistant (MA9.3RAS) cells were injected into NSGS or NRGS intravenously, and then R-2HG (6mg/kg body weight) or PBS were injected once daily through tail vein for 12 consecutive days starting from day 11 post xeno-transplantation.
Response Summary This work demonstrates anti-tumor effects of 2HG in inhibiting proliferation/survival of FTO-high cancer cells via targeting FTO/m6A/MYC/CCAAT/enhancer-binding protein alpha (CEBPA) signaling.High levels of FTO sensitize leukemia cells to R-2HG, whereas hyperactivation of MYC signaling confers resistance that can be reversed by the inhibition of MYC signaling. R-2HG also displays anti-tumor activity in glioma. High levels of FTO sensitize leukemic cells to R-2HG, whereas hyperactivation of MYC signaling confers resistance that can be reversed by the inhibition of MYC signaling.
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Leukaemia [ICD-11: 2B33.4]
Responsed Drug R-2HG Investigative
Target Regulation Down regulation
Cell Process Glutamine metabolism
Cell apoptosis
In-vitro Model
8-MG-BA Glioblastoma Homo sapiens CVCL_1052
A-172 Glioblastoma Homo sapiens CVCL_0131
DK-MG Glioblastoma Homo sapiens CVCL_1173
GaMG Glioblastoma Homo sapiens CVCL_1226
HEL Erythroleukemia Homo sapiens CVCL_0001
Jurkat T acute lymphoblastic leukemia Homo sapiens CVCL_0065
KOCL-45 B acute lymphoblastic leukemia Homo sapiens CVCL_3993
KOCL-48 Childhood acute monocytic leukemia Homo sapiens CVCL_6867
KOCL-50 B acute lymphoblastic leukemia Homo sapiens CVCL_6866
KOCL-51 B acute lymphoblastic leukemia Homo sapiens CVCL_6865
KOCL-69 B acute lymphoblastic leukemia Homo sapiens CVCL_3995
KOPN-1 B acute lymphoblastic leukemia Homo sapiens CVCL_3937
LN-18 Glioblastoma Homo sapiens CVCL_0392
LN-229 Glioblastoma Homo sapiens CVCL_0393
MA9.3 (MA9.3)
MA9.6ITD (MLL-AF9 plus FLT3-ITD)
MA9.6RAS (MLL-AF9 plus NRasG12D)
MA9.6 (MLL-AF9)
MA9.6ITD (MLL-AF9 plus FLT3-ITD)
MA9.6RAS (MLL-AF9 plus NRasG12D)
ME-1 [Human leukemia] Adult acute myeloid leukemia Homo sapiens CVCL_2110
ML-2 Adult acute myeloid leukemia Homo sapiens CVCL_1418
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
PL21 Familial adenomatous polyposis Homo sapiens CVCL_JM48
T98G Glioblastoma Homo sapiens CVCL_0556
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
In-vivo Model For R-2HG injection mouse models, sensitive (NOMO-1 and MA9.3ITD) or resistant (MA9.3RAS) cells were injected into NSGS or NRGS intravenously, and then R-2HG (6mg/kg body weight) or PBS were injected once daily through tail vein for 12 consecutive days starting from day 11 post xeno-transplantation.
Response Summary This work demonstrates anti-tumor effects of 2HG in inhibiting proliferation/survival of FTO-high cancer cells via targeting FTO/m6A/MYC/CCAAT/enhancer-binding protein alpha (CEBPA) signaling.High levels of FTO sensitize leukemia cells to R-2HG, whereas hyperactivation of MYC signaling confers resistance that can be reversed by the inhibition of MYC signaling. R-2HG also displays anti-tumor activity in glioma. High levels of FTO sensitize leukemic cells to R-2HG, whereas hyperactivation of MYC signaling confers resistance that can be reversed by the inhibition of MYC signaling.
Cell death activator CIDE-3 (CIDEC)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Mouse liver Mus musculus
Treatment: FTO knockout mouse liver tissue
Control: Wild type mouse liver tissue
GSE125785
Regulation
logFC: -2.15E+00
p-value: 6.18E-03
More Results Click to View More RNA-seq Results
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation Up regulation
Cell Process Lipogenesis
In-vitro Model
HEK293T Normal Homo sapiens CVCL_0063
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model After being fed with high-fat diet for 4 weeks, mice were given twice vena caudalis injection of control siRNA or Cidec siRNA (50 ug/mouse) mixed with liposome. Liposomes were prepared as described elsewhere.
Response Summary FTO increased the lipid accumulation in hepatocytes by increasing nuclear translocation of SREBP1c and SREBP1c maturation, thus improving the transcriptional activity of LD-associated protein Cell death activator CIDE-3 (CIDEC).The studies provide new mechanistic insight into nonalcoholic fatty liver disease (NAFLD) mediated by FTO.
Collagenase 3 (MMP13)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: 2.41E+00
p-value: 4.00E-03
More Results Click to View More RNA-seq Results
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Esophageal squamous cell carcinoma [ICD-11: 2B70.1]
Target Regulation Up regulation
Cell Process Cell growth and migration
In-vitro Model
Eca-109 Esophageal squamous cell carcinoma Homo sapiens CVCL_6898
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
TE-1 Esophageal squamous cell carcinoma Homo sapiens CVCL_1759
In-vivo Model Stable down-regulated FTO cells were prepared in Eca-109 and KYSE150 and subcutaneously injected into the flank of nude mouse with 2 × 106 cells per mouse.
Response Summary Up-regulation of FTO is frequently observed in esophageal squamous cell carcinoma tissues, and FTO facilitates cell proliferation and migration in ESCC by up-regulating Collagenase 3 (MMP13).
Cyclic AMP-dependent transcription factor ATF-4 (ATF4)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: -1.42E+00
p-value: 2.68E-47
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 6 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Asparagine inhibitor Approved
Pathway Response mTOR signaling pathway hsa04150
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. ATF4 transcriptionally upregulated DDIT4 to suppress Cyclic AMP-dependent transcription factor ATF-4 (ATF4), which induced pro-survival autophagy during glutaminolysis inhibition.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Chloroquine Approved
Pathway Response mTOR signaling pathway hsa04150
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. ATF4 transcriptionally upregulated DDIT4 to suppress Cyclic AMP-dependent transcription factor ATF-4 (ATF4), which induced pro-survival autophagy during glutaminolysis inhibition.
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Meclofenamate sodium Approved
Pathway Response mTOR signaling pathway hsa04150
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. Cyclic AMP-dependent transcription factor ATF-4 (ATF4) transcriptionally upregulated DDIT4 to suppress mTOR, which induced pro-survival autophagy during glutaminolysis inhibition.
Experiment 4 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Rapamycin Approved
Pathway Response mTOR signaling pathway hsa04150
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. Cyclic AMP-dependent transcription factor ATF-4 (ATF4) transcriptionally upregulated DDIT4 to suppress mTOR, which induced pro-survival autophagy during glutaminolysis inhibition.
Experiment 5 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug CB-839 Phase 2
Pathway Response mTOR signaling pathway hsa04150
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. Cyclic AMP-dependent transcription factor ATF-4 (ATF4) transcriptionally upregulated DDIT4 to suppress mTOR, which induced pro-survival autophagy during glutaminolysis inhibition.
Experiment 6 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug GLS-IN-968 Investigative
Pathway Response mTOR signaling pathway hsa04150
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. ATF4 transcriptionally upregulated DDIT4 to suppress Cyclic AMP-dependent transcription factor ATF-4 (ATF4), which induced pro-survival autophagy during glutaminolysis inhibition.
Cyclin-A2 (CCNA2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Cerebral cortex Mus musculus
Treatment: METTL3 (f/f, Emx1-cre) cerebral cortex
Control: Wild type cerebral cortex
GSE154992
Regulation
logFC: 7.89E-01
p-value: 6.22E-11
More Results Click to View More RNA-seq Results
Obesity [ICD-11: 5B81]
In total 2 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [13]
Responsed Disease Obesity [ICD-11: 5B81]
Responsed Drug Epigallocatechin gallate Phase 3
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process Adipogenesis
In-vitro Model
3T3-L1 Normal Mus musculus CVCL_0123
Response Summary m6A-dependent Cyclin-A2 (CCNA2) and CDK2 expressions mediated by FTO and YTHDF2 contributed to EGCG-induced adipogenesis inhibition.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [14]
Responsed Disease Obesity [ICD-11: 5B81]
Pathway Response Cell cycle hsa04110
Cell Process Adipogenesis
Arrest cell cycle at S phase
In-vitro Model
3T3-L1 Normal Mus musculus CVCL_0123
Response Summary FTO knockdown markedly decreased the expression of Cyclin-A2 (CCNA2) and CDK2, crucial cell cycle regulators, leading to delayed entry of MDI-induced cells into G2 phase. m6A-binding protein YTHDF2 recognized and decayed methylated mRNAs of CCNA2 and CDK2, leading to decreased protein expression, thereby prolonging cell cycle progression and suppressing adipogenesis. The adipocyte life cycle, including proliferation and adipogenesis, has become a potential target for many bioactive compounds and drugs for the prevention and treatment of obesity.
Cyclin-dependent kinase 2 (CDK2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line B16-OVA cell line Mus musculus
Treatment: shFTO B16-OVA cells
Control: shNC B16-OVA cells
GSE154952
Regulation
logFC: 7.39E-01
p-value: 1.49E-28
More Results Click to View More RNA-seq Results
Obesity [ICD-11: 5B81]
In total 2 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [13]
Responsed Disease Obesity [ICD-11: 5B81]
Responsed Drug Epigallocatechin gallate Phase 3
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process Adipogenesis
In-vitro Model
3T3-L1 Normal Mus musculus CVCL_0123
Response Summary m6A-dependent CCNA2 and Cyclin-dependent kinase 2 (CDK2) expressions mediated by FTO and YTHDF2 contributed to EGCG-induced adipogenesis inhibition.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [14]
Responsed Disease Obesity [ICD-11: 5B81]
Pathway Response Cell cycle hsa04110
Cell Process Adipogenesis
Arrest cell cycle at S phase
In-vitro Model
3T3-L1 Normal Mus musculus CVCL_0123
Response Summary FTO knockdown markedly decreased the expression of CCNA2 and Cyclin-dependent kinase 2 (CDK2), crucial cell cycle regulators, leading to delayed entry of MDI-induced cells into G2 phase. m6A-binding protein YTHDF2 recognized and decayed methylated mRNAs of CCNA2 and CDK2, leading to decreased protein expression, thereby prolonging cell cycle progression and suppressing adipogenesis. The adipocyte life cycle, including proliferation and adipogenesis, has become a potential target for many bioactive compounds and drugs for the prevention and treatment of obesity.
Retinopathy [ICD-11: 9B71]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [77]
Responsed Disease Diabetic retinopathy [ICD-11: 9B71.0]
Target Regulation Up regulation
Cyclin-dependent kinase inhibitor 1 (CDKN1A)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: 9.72E-01
p-value: 1.24E-24
More Results Click to View More RNA-seq Results
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [16]
Responsed Disease Esophageal squamous cell carcinoma [ICD-11: 2B70.1]
Pathway Response Cell cycle hsa04110
Ubiquitin mediated proteolysis hsa04120
Cell Process Ubiquitination degradation
Cell apoptosis
Decreased G0/G1 phase
In-vitro Model
HET-1A Normal Homo sapiens CVCL_3702
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
KYSE-450 Esophageal squamous cell carcinoma Homo sapiens CVCL_1353
KYSE-70 Esophageal squamous cell carcinoma Homo sapiens CVCL_1356
TE-1 Esophageal squamous cell carcinoma Homo sapiens CVCL_1759
In-vivo Model The number of cells inoculated in each mouse was 4 × 106, 1 × 106, 2 × 106 and 1 × 106, respectively.
Response Summary The elevated FTO in esophageal squamous cell carcinoma decreased m6A methylation of LINC00022 transcript, leading to the inhibition of LINC00022 decay via the m6A reader YTHDF2. LINC00022 directly binds to Cyclin-dependent kinase inhibitor 1 (CDKN1A) protein and promotes its ubiquitination-mediated degradation, thereby facilitating cell-cycle progression and proliferation.
Dapper homolog 1 (DACT1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Mouse liver Mus musculus
Treatment: FTO knockout mouse liver tissue
Control: Wild type mouse liver tissue
GSE125785
Regulation
logFC: 1.21E+00
p-value: 4.60E-03
More Results Click to View More RNA-seq Results
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [17]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Target Regulation Down regulation
Pathway Response Wnt signaling pathway hsa04310
Response Summary FTO could reduce the mRNA stability of Dapper homolog 1 (DACT1) via m6A demethylation, which decreased DACT1 expression and further activated the Wnt signaling pathway. The oncogenic effect of FTO on osteosarcoma was dependent on DACT1.
Diacylglycerol O-acyltransferase 2 (DGAT2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line B16-OVA cell line Mus musculus
Treatment: shFTO B16-OVA cells
Control: shNC B16-OVA cells
GSE154952
Regulation
logFC: -6.69E-01
p-value: 1.09E-02
More Results Click to View More RNA-seq Results
Diabetes [ICD-11: 5A10-5A14]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Diabetes [ICD-11: 5A10-5A14]
Pathway Response Metabolic pathways hsa01100
Cell Process Lipid metabolism
In-vitro Model
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary Glucose Is Involved in the Dynamic Regulation of m6A in Patients With Type 2 Diabetes.high-glucose stimulation enhances FTO expression, which leads to decreased m6A, and the lower m6A induces methyltransferase upregulation; FTO then triggers the mRNA expression of FOXO1, FASN, G6PC, and Diacylglycerol O-acyltransferase 2 (DGAT2), and these four genes were correlated with glucose and lipid metabolism.
DNA damage-inducible transcript 3 protein (DDIT3/CHOP)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 7.94E-01
p-value: 7.54E-04
More Results Click to View More RNA-seq Results
Gastric cancer [ICD-11: 2B72]
In total 3 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Responsed Drug Cisplatin Approved
Target Regulation Down regulation
Pathway Response mTOR signaling pathway hsa04150
Apoptosis hsa04210
Cell Process Cell apoptosis
In-vitro Model
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
Response Summary Omeprazole pretreatment could enhance the inhibitory effect of 5-Fu, DDP and TAX on gastric cancer cells. FTO inhibition induced by omeprazole enhanced the activation of mTORC1 signal pathway that inhibited the prosurvival autophagy so as to improve the antitumor efficiency of chemotherapeutic drugs on GC cells. Meanwhile, transcript level of DNA damage-inducible transcript 3 protein (DDIT3), which is an apoptosis-related tumor suppressor gene downstream of mTORC1, was regulated by omeprazole-induced FTO silence through an m6A-dependent mechanism. m6A modification and its eraser FTO plays a role in the improvement of chemosensitivity mediated by proton pump inhibitor omeprazole.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Responsed Drug Fluorouracil Approved
Target Regulation Down regulation
Pathway Response mTOR signaling pathway hsa04150
Apoptosis hsa04210
Cell Process Cell apoptosis
In-vitro Model
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
Response Summary Omeprazole pretreatment could enhance the inhibitory effect of 5-Fu, DDP and TAX on gastric cancer cells. FTO inhibition induced by omeprazole enhanced the activation of mTORC1 signal pathway that inhibited the prosurvival autophagy so as to improve the antitumor efficiency of chemotherapeutic drugs on GC cells. Meanwhile, transcript level of DNA damage-inducible transcript 3 protein (DDIT3), which is an apoptosis-related tumor suppressor gene downstream of mTORC1, was regulated by omeprazole-induced FTO silence through an m6A-dependent mechanism. m6A modification and its eraser FTO plays a role in the improvement of chemosensitivity mediated by proton pump inhibitor omeprazole.
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Responsed Drug Paclitaxel Approved
Target Regulation Down regulation
Pathway Response mTOR signaling pathway hsa04150
Apoptosis hsa04210
Cell Process Cell apoptosis
In-vitro Model
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
Response Summary Omeprazole pretreatment could enhance the inhibitory effect of 5-Fu, DDP and TAX on gastric cancer cells. FTO inhibition induced by omeprazole enhanced the activation of mTORC1 signal pathway that inhibited the prosurvival autophagy so as to improve the antitumor efficiency of chemotherapeutic drugs on GC cells. Meanwhile, transcript level of DNA damage-inducible transcript 3 protein (DDIT3), which is an apoptosis-related tumor suppressor gene downstream of mTORC1, was regulated by omeprazole-induced FTO silence through an m6A-dependent mechanism. m6A modification and its eraser FTO plays a role in the improvement of chemosensitivity mediated by proton pump inhibitor omeprazole.
Ephrin type-B receptor 2 (ERK/EPHB2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 1.37E+00
p-value: 3.20E-04
More Results Click to View More RNA-seq Results
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [20]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation Up regulation
Pathway Response Apoptosis hsa04210
Cell Process Cell apoptosis
In-vitro Model
OCI-AML-3 Adult acute myeloid leukemia Homo sapiens CVCL_1844
OCI-AML-2 Adult acute myeloid leukemia Homo sapiens CVCL_1619
Response Summary FTO depended on its m6A RNA demethylase activity to activate PDGFRB/Ephrin type-B receptor 2 (ERK/EPHB2) signaling axis. FTO-mediated m6A demethylation plays an oncogenic role in NPM1-mutated Acute myeloid leukemia(AML).
Frizzled-10 (FZD10)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Mouse hippocampus Mus musculus
Treatment: FTO knockout mice hippocampus
Control: Wild type hippocampus
GSE94098
Regulation
logFC: -6.03E-01
p-value: 7.74E-04
More Results Click to View More RNA-seq Results
Malignant mixed epithelial mesenchymal tumour [ICD-11: 2B5D]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [21]
Responsed Disease Malignant mixed epithelial mesenchymal tumour of ovary [ICD-11: 2B5D.0]
Responsed Drug PARPi Investigative
Target Regulation Down regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model
UWB1.289 Ovarian carcinoma Homo sapiens CVCL_B079
PEO1 Ovarian cystadenocarcinoma Homo sapiens CVCL_2686
In-vivo Model 2 × 107 PARP inhibitor resistant PEO1 cells were suspended in 200 uL PBS : Matrigel (1:1) unilaterally injected subcutaneously into the right dorsal flank of 6-8 week-old female immunocompromised non-obese diabetic/severe combined immunodeficiency (NOD/SCID) gamma (NSG) mice. When the average tumor size reached ~100 mm3, the mice were then randomized into four groups and treated with vehicle control, Olaparib (50 mg/kg), XAV939 (5 mg/kg) or a combination daily for 18 days.
Response Summary Downregulation of m6A demethylases FTO and ALKBH5 was sufficient to increase Frizzled-10 (FZD10) mRNA m6A modification and reduce PARPi sensitivity, the finding elucidates a novel regulatory mechanism of PARPi resistance in EOC by showing that m6A modification of FZD10 mRNA contributes to PARPi resistance in BRCA-deficient EOC cells via upregulation of Wnt/Bete-catenin pathway.
G1/S-specific cyclin-D1 (CCND1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: FTO inhibition NB4 cells
Control: NB4 cells
GSE103495
Regulation
logFC: -7.40E-01
p-value: 1.34E-03
More Results Click to View More RNA-seq Results
Obesity [ICD-11: 5B81]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [15]
Responsed Disease Obesity [ICD-11: 5B81]
Pathway Response Cell cycle hsa04110
Cell Process Cell cycle
Response Summary Metformin could inhibit adipogenesis and combat obesity, metformin could inhibit protein expression of FTO, leading to increased m6A methylation levels of G1/S-specific cyclin-D1 (CCND1) and Cdk2(two crucial regulators in cell cycle). Ccnd1 and Cdk2 with increased m6A levels were recognised by YTHDF2, causing an YTHDF2-dependent decay and decreased protein expressions.
Pulmonary hypertension [ICD-11: BB01]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [87]
Responsed Disease Pulmonary hypertension [ICD-11: BB01]
Target Regulation Down regulation
In-vivo Model Twelve adult female SD rats, aged 6-8 weeks and weighing 200 g, were purchased from the experimental animal center of Xuzhou Medical University, China (GRADE II). The animal experience program was approved by the Committee of institutions for Animal Protection and use (IACUC). The rats were randomly divided into control group (n = 6) and hypoxia group (n = 6). They were fed in 60% humidity for 21 days, and the hypoxia group was fed under (3% O2) hypoxia. After the establishment of the rat model, the rats were anesthetized with sevoflurane (4.5%), and their hearts and lungs were taken for follow-up study.
Glutamate receptor ionotropic, NMDA 1 (NMDAR1/GRIN1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line UMRC2 cell line Homo sapiens
Treatment: FTO knockdown UMRC2 cells
Control: Wild type UMRC2 cells
GSE139123
Regulation
logFC: -9.35E-01
p-value: 3.38E-05
More Results Click to View More RNA-seq Results
Parkinson disease [ICD-11: 8A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [22]
Responsed Disease Parkinson disease [ICD-11: 8A00]
Target Regulation Up regulation
In-vitro Model
HEK293T Normal Homo sapiens CVCL_0063
PC-12 Lung papillary adenocarcinoma Homo sapiens CVCL_S979
SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
In-vivo Model Two weeks after the stereotaxic surgery, all the animals were intraperitoneally injected with apomorphine at a dose of 0.5 mg/kg to induce the contralateral rotations. Ten minutes after the injection, a video was used to record the rotations of each rat for 20 min. Only those 6-OHDA induced rats showing robust contralateral turning (>7 turns/min) that were injected with 6-OHDA were used in subsequent experiments.
Response Summary Decreased m6A in dopaminergic cells by overexpressing a nucleic acid demethylase, FTO, or by m6A inhibitor. m6A reduction could induce the expression of Glutamate receptor ionotropic, NMDA 1 (NMDAR1/GRIN1), and elevate oxidative stress and Ca2+ influx, resulting in dopaminergic neuron apoptosis. m6A modification plays a vital role in the death of dopaminergic neuron, which provides a novel view of mRNA methylation to understand the epigenetic regulation of Parkinson's disease.
Glycogen synthase kinase-3 beta (GSK3Beta/GSK3B)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line B16-OVA cell line Mus musculus
Treatment: shFTO B16-OVA cells
Control: shNC B16-OVA cells
GSE154952
Regulation
logFC: 6.35E-01
p-value: 1.84E-09
More Results Click to View More RNA-seq Results
Aortic aneurysm or dissection [ICD-11: BD50]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [23]
Responsed Disease Aortic aneurysm or dissection [ICD-11: BD50]
Target Regulation Up regulation
Pathway Response Nucleotide excision repair hsa03420
Cell Process DNA repair
Cell proliferation and migration
In-vitro Model
VSMC (Human aortic vascular smooth muscle cells)
Response Summary FTO expression significantly contributes to the phenotype conversion of VSMCs and the aortic dissecting aneurysm by the demethylation function (m6A), thereby providing a novel therapeutic target. Knockdown of FTO suppresses the Glycogen synthase kinase-3 beta (GSK3Beta/GSK3B) levels and Klf5 expression regardless of AngII treatment.
Heat shock 70 kDa protein 1A (HSPA1A)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: 1.83E+00
p-value: 7.08E-08
More Results Click to View More RNA-seq Results
Low bone mass disorder [ICD-11: FB83]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [24]
Responsed Disease Osteoporosis [ICD-11: FB83.1]
Target Regulation Up regulation
In-vitro Model
1H8 [Mouse hybridoma against human BMSC] Normal Mus musculus CVCL_A7TU
In-vivo Model FtoKO mice were backcrossed to WT C57BL/6 mice to remove Cre and bred to homozygosity. Results are reported for male mice on the same genetic background (C57BL6/J). For the diet-induced bone loss studies, mice were fed a 60% high-fat diet (D12492, Research Diets) from 6 wk of age to 24 wk. Genotyping strategies are available upon request. NBD (KKKKKKKKGGTALDWSWLQTE) with the Trp to Ala substitutions designed to render the peptide inactive underlined, was a gift from D.C.G. and dissolved in water before use. Next, 10 mg/kg NBD was intraperitoneally injected in 29-wk old FtoOc KO mice every other day for 9 d. One day after the last injection, bone was harvested for analysis of DNA damage.
Response Summary Loss of Fto also increased susceptibility of osteoblasts to genotoxic damage from metabolic stress induced by exposure to HF is also consistent with this model for FTO action. FTO functions intrinsically in osteoblasts through Heat shock 70 kDa protein 1A (HSPA1A)-NF-Kappa-B signaling to enhance the stability of mRNA of proteins that function to protect cells from genotoxic damage.
Heat shock factor protein 1 (HSF1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: -7.09E-01
p-value: 1.48E-02
More Results Click to View More RNA-seq Results
Multiple myeloma [ICD-11: 2A83]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [25]
Responsed Disease Multiple myeloma [ICD-11: 2A83.1]
Responsed Drug Bortezomib Approved
Target Regulation Up regulation
In-vitro Model
RPMI-8226 Plasma cell myeloma Homo sapiens CVCL_0014
MM1.R Plasma cell myeloma Homo sapiens CVCL_8794
In-vivo Model A total of 3×106 RPMI8226/MM1R-Luc cells were intravenously injected into NCG mice to establish a disseminated human MM xenograft model. The in vivo antitumor effect of the FTO inhibitor MA2 combined with or without the first-line chemotherapeutic agent BTZ was evaluated as follows: 3 days post xenotransplantation, MA2 (20 mg/kg), or vehicle control was injected intraperitoneally (i.p.) daily for 10 days, and BTZ was injected intraperitoneally on days 1, 4, 8, and 11. Mouse serum was collected at specified time points during the treatment, and the tumor burden was monitored by detecting myeloma cell-secreted Lambda light chains via a Human Lambda ELISA Kit (Bethyl Laboratories, No. E88-116). Tumor development was monitored weekly after treatment with an in vivo imaging system (IVIS, SI Imaging, Lago, and LagoX). Luciferin (150 mg/kg, YEASEN, Shanghai, China) was injected intraperitoneally into the mice.
Response Summary FTO significantly promotes MM cell proliferation, migration, and invasion by targeting Heat shock factor protein 1 (HSF1)/HSPs in a YTHDF2-dependent manner. FTO inhibition, especially when combined with bortezomib (BTZ) treatment, synergistically inhibited myeloma bone tumor formation and extramedullary spread in NCG mice.
Heat shock protein HSP 90-alpha (HSP90/HSP90AA1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: 7.64E-01
p-value: 2.38E-12
More Results Click to View More RNA-seq Results
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [26]
Responsed Disease Glioma [ICD-11: 2A00.0]
Target Regulation Down regulation
Cell Process Cell migration and proliferation
In-vitro Model
U251 (Fibroblasts or fibroblast like cells)
Response Summary m6A regulated cell proliferation by influencing apoptosis of U251 cells through regulating Heat shock protein HSP 90-alpha (HSP90/HSP90AA1) expression.m6A level was decreased in glioma tissue, which was caused by decreased METTL3 and increased FTO levels.
Integrin alpha-6 (ITGA6)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: 5.89E-01
p-value: 3.48E-07
More Results Click to View More RNA-seq Results
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [27]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Pathway Response Notch signaling pathway hsa04330
Cell Process Cell proliferation
Cell invasion
Cell apoptosis
In-vitro Model
HT-1197 Recurrent bladder carcinoma Homo sapiens CVCL_1291
HT-1376 Bladder carcinoma Homo sapiens CVCL_1292
In-vivo Model BALB/cnu/nu mice (4-5 weeks old) were used for the xenograft experiment. The mice were randomly divided into 2 groups (n = 6 for each group) and injected with 5 × 106 HT-1197 cells in control group or FTO plasmid group, respectively.
Response Summary In bladder cancer, the changes in m6A methylation level mainly appeared at 5' untranslated region (5' UTR) of MALAT1 and NOTCH1 transcripts, and at 3' UTR of CSNK2A2 and Integrin alpha-6 (ITGA6) transcripts, responding to the overexpression of FTO. SFPQ could influence the FTO-mediated m6A RNA demethylation, eventually affecting the gene expression.
Integrin beta-1 (ITGB1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: 6.90E-01
p-value: 1.74E-07
More Results Click to View More RNA-seq Results
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [28]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
In-vitro Model
SNU-216 Gastric tubular adenocarcinoma Homo sapiens CVCL_3946
MKN7 Gastric tubular adenocarcinoma Homo sapiens CVCL_1417
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
Response Summary FTO was an independent risk factor for overall survival (OS) of GC patients and FTO could promote GC metastasis by upregulating the expression of Integrin beta-1 (ITGB1) via decreasing its m6A level.
Intercellular adhesion molecule 1 (ICAM1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 1.83E+00
p-value: 2.17E-03
More Results Click to View More RNA-seq Results
Diseases of the circulatory system [ICD-11: BE2Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [29]
Responsed Disease Vascular diseases [ICD-11: BE2Z]
Responsed Drug Atorvastatin Approved
Target Regulation Up regulation
In-vitro Model
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
HUVEC-C Normal Homo sapiens CVCL_2959
HEK293T Normal Homo sapiens CVCL_0063
Response Summary FTO overexpression significantly upregulated the mRNA and protein levels of VCAM-1 and Intercellular adhesion molecule 1 (ICAM1), downregulated those of KLF2 and eNOS, and strongly attenuated the atorvastatin-mediated induction of KLF2 and eNOS expression. FTO could serve as a novel molecular target to modulate endothelial function in vascular diseases.
Krueppel-like factor 2 (KLF2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line B16F10 cell line Mus musculus
Treatment: FTO knockout B16F10 cells
Control: B16F10 cells
GSE134388
Regulation
logFC: -1.68E+00
p-value: 3.25E-02
More Results Click to View More RNA-seq Results
Diseases of the circulatory system [ICD-11: BE2Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [29]
Responsed Disease Vascular diseases [ICD-11: BE2Z]
Responsed Drug Atorvastatin Approved
Target Regulation Down regulation
In-vitro Model
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
HUVEC-C Normal Homo sapiens CVCL_2959
HEK293T Normal Homo sapiens CVCL_0063
Response Summary FTO overexpression significantly upregulated the mRNA and protein levels of VCAM-1 and ICAM-1, downregulated those of Krueppel-like factor 2 (KLF2) and eNOS, and strongly attenuated the atorvastatin-mediated induction of KLF2 and eNOS expression. FTO could serve as a novel molecular target to modulate endothelial function in vascular diseases.
Krueppel-like factor 5 (KLF5)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Cerebral cortex Mus musculus
Treatment: METTL3 (f/f, Emx1-cre) cerebral cortex
Control: Wild type cerebral cortex
GSE154992
Regulation
logFC: -1.34E+00
p-value: 1.46E-05
More Results Click to View More RNA-seq Results
Aortic aneurysm or dissection [ICD-11: BD50]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [23]
Responsed Disease Aortic aneurysm or dissection [ICD-11: BD50]
Target Regulation Up regulation
Pathway Response Nucleotide excision repair hsa03420
Cell Process DNA repair
Cell proliferation and migration
In-vitro Model
VSMC (Human aortic vascular smooth muscle cells)
Response Summary FTO expression significantly contributes to the phenotype conversion of VSMCs and the aortic dissecting aneurysm by the demethylation function (m6A), thereby providing a novel therapeutic target. Knockdown of FTO suppresses the p-GSK3-beta levels and Krueppel-like factor 5 (KLF5) expression regardless of AngII treatment.
Leukocyte immunoglobulin-like receptor subfamily B member 4 (LILRB4)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Mouse liver Mus musculus
Treatment: FTO knockout mouse liver tissue
Control: Wild type mouse liver tissue
GSE125785
Regulation
logFC: 1.12E+00
p-value: 2.09E-02
More Results Click to View More RNA-seq Results
Acute myeloid leukaemia [ICD-11: 2A60]
In total 3 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [30]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Responsed Drug Meclofenamic acid Approved
Target Regulation Down regulation
Pathway Response B cell receptor signaling pathway hsa04662
Cell Process Immune Evasion
In-vitro Model
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
In-vivo Model For each experiment, 6- to 8-week-old mice were used and randomly allocated to each group. For xenograft mouse, 0.1 × 106 MA9.3ITD cells were transplanted into NRGS recipient mice intravenously. Drug treatment was started from 10 days after transplantation. CS2 was administered through intraperitoneal (i.p.) injection at 5mg/kg/day, every other day. CS1 dissolved in saturated Beta-cyclodextrin (C0926, Sigma-Aldrich) solution was delivered by intravenous injection (i.v.). Successful engraftment was observed following 4 weeks post inoculation displaying a level of about 5% human CD33+ cells in peripheral. To generate PDX mouse models, 1 × 106 AML patient derived BMMNCs were transplanted into NRGS recipient mice intravenously, and drug treatment was started from 7 days later. CS2, FB23-2, and free CS1 were administered through i.p. injection at 5 mg/kg/day, while Micelle (900661, Sigma-Aldrich) packaged CS1 was delivered by i.v. injection at 5mg/kg/day. Both CS1 and CS2 were injected every other day for a total of ten times.
Response Summary Genetic depletion and pharmacological inhibition of FTO dramatically attenuate leukemia stem/initiating cell self-renewal and reprogram immune response by suppressing expression of immune checkpoint genes, especially Leukocyte immunoglobulin-like receptor subfamily B member 4 (LILRB4). FTO inhibitors, such as rhein, meclofenamic acid (MA), MO-I-500, fluorescein, and R-2HG, can inhibit acute myeloid leukemia cell viability. CS1 and CS2 displayed a much higher efficacy in inhibiting AML cell viability.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [30]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Responsed Drug R-2HG Investigative
Target Regulation Down regulation
Pathway Response B cell receptor signaling pathway hsa04662
Cell Process Immune Evasion
In-vitro Model
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
In-vivo Model For each experiment, 6- to 8-week-old mice were used and randomly allocated to each group. For xenograft mouse, 0.1 × 106 MA9.3ITD cells were transplanted into NRGS recipient mice intravenously. Drug treatment was started from 10 days after transplantation. CS2 was administered through intraperitoneal (i.p.) injection at 5mg/kg/day, every other day. CS1 dissolved in saturated Beta-cyclodextrin (C0926, Sigma-Aldrich) solution was delivered by intravenous injection (i.v.). Successful engraftment was observed following 4 weeks post inoculation displaying a level of about 5% human CD33+ cells in peripheral. To generate PDX mouse models, 1 × 106 AML patient derived BMMNCs were transplanted into NRGS recipient mice intravenously, and drug treatment was started from 7 days later. CS2, FB23-2, and free CS1 were administered through i.p. injection at 5 mg/kg/day, while Micelle (900661, Sigma-Aldrich) packaged CS1 was delivered by i.v. injection at 5mg/kg/day. Both CS1 and CS2 were injected every other day for a total of ten times.
Response Summary Genetic depletion and pharmacological inhibition of FTO dramatically attenuate leukemia stem/initiating cell self-renewal and reprogram immune response by suppressing expression of immune checkpoint genes, especially Leukocyte immunoglobulin-like receptor subfamily B member 4 (LILRB4). FTO inhibitors, such as rhein, meclofenamic acid (MA), MO-I-500, fluorescein, and R-2HG, can inhibit acute myeloid leukemia cell viability. CS1 and CS2 displayed a much higher efficacy in inhibiting AML cell viability.
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [30]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation Down regulation
Pathway Response B cell receptor signaling pathway hsa04662
Cell Process Immune Evasion
In-vitro Model
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
In-vivo Model For each experiment, 6- to 8-week-old mice were used and randomly allocated to each group. For xenograft mouse, 0.1 × 106 MA9.3ITD cells were transplanted into NRGS recipient mice intravenously. Drug treatment was started from 10 days after transplantation. CS2 was administered through intraperitoneal (i.p.) injection at 5mg/kg/day, every other day. CS1 dissolved in saturated Beta-cyclodextrin (C0926, Sigma-Aldrich) solution was delivered by intravenous injection (i.v.). Successful engraftment was observed following 4 weeks post inoculation displaying a level of about 5% human CD33+ cells in peripheral. To generate PDX mouse models, 1 × 106 AML patient derived BMMNCs were transplanted into NRGS recipient mice intravenously, and drug treatment was started from 7 days later. CS2, FB23-2, and free CS1 were administered through i.p. injection at 5 mg/kg/day, while Micelle (900661, Sigma-Aldrich) packaged CS1 was delivered by i.v. injection at 5mg/kg/day. Both CS1 and CS2 were injected every other day for a total of ten times.
Response Summary Genetic depletion and pharmacological inhibition of FTO dramatically attenuate leukemia stem/initiating cell self-renewal and reprogram immune response by suppressing expression of immune checkpoint genes, especially Leukocyte immunoglobulin-like receptor subfamily B member 4 (LILRB4). FTO inhibitors, such as rhein, meclofenamic acid (MA), MO-I-500, fluorescein, and R-2HG, can inhibit acute myeloid leukemia cell viability. CS1 and CS2 displayed a much higher efficacy in inhibiting AML cell viability.
Matrix metalloproteinase-24 (MMP24)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line HEK293 cell line Homo sapiens
Treatment: FTO knockdown HEK293T cells
Control: HEK293T cells
GSE78040
Regulation
logFC: 8.43E-01
p-value: 7.94E-03
More Results Click to View More RNA-seq Results
Pain disorders [ICD-11: 8E43]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [31]
Responsed Disease Neuropathic Pain [ICD-11: 8E43.0]
Target Regulation Up regulation
In-vivo Model Mice were anesthetized with Nembutal. The lower back was dissected until the transverse lumbar process was exposed. After the process was removed, the underneath L4 spinal nerve was ligated with a silk 6-0 thread. A slight distal location was chosen for transection around the ligation site. Subsequent layers of muscle and skin were closed. The sham groups undertook identical procedures, but without the transection or ligature of the corresponding nerve. The intraspinal injection was performed as described previously. In short, after anesthetized with Nembutal, mice underwent hemilaminectomy at the L1-L2 vertebral segments. The intraspinal injection was carried out ipsilaterally on the left side. By using a glass micropipette, each animal received two injections (5 × 105 TU per injection, 0.8 mm from the midline, 0.5 mm apart in rostrocaudal axis, 0.5 mm deep) of lentivirus following the L3-L4 dorsal root entry zone after exposure of spinal cord. The tip of glass micropipette should reach a depth of lamina II-IV of the spinal cord. Finally, the dorsal muscle and skin were sutured layer by layer.
Response Summary FTO was colocalized with Matrix metalloproteinase-24 (MMP24) in spinal neurons and shown increased binding to the Mmp24 mRNA in the spinal cord after SNL. SNL promoted the m6A eraser FTO binding to the Mmp24 mRNA, which subsequently facilitated the translation of MMP24 in the spinal cord, and ultimately contributed to neuropathic pain genesis.
Melanocortin receptor 4 (MC4R)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Cerebral cortex Mus musculus
Treatment: METTL3 (f/f, Emx1-cre) cerebral cortex
Control: Wild type cerebral cortex
GSE154992
Regulation
logFC: 7.52E-01
p-value: 2.88E-08
More Results Click to View More RNA-seq Results
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [32]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Down regulation
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
WPMY-1 Normal Homo sapiens CVCL_3814
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
DU145 Prostate carcinoma Homo sapiens CVCL_0105
22Rv1 Prostate carcinoma Homo sapiens CVCL_1045
In-vivo Model PCa cells carrying the transfected plasmid were subcutaneously injected into immunodeficient mice at a rate of 1 × 106 cells per mouse according to a previous study. Tumor formation in the two groups of mice was observed and recorded by a designated personnel every day, and the volume of the tumors was measured. The nude mice were sacrificed 21 days after tumor formation, and the tumors were removed to measure their volume and weight.
Response Summary FTO was downregulated in PCa and its expression level showed a relevance to the prognosis of PCa patients. Additionally, FTO could regulate the proliferation, migration and invasion of PCa via regulating the expression level of Melanocortin receptor 4 (MC4R).
Myc proto-oncogene protein (MYC)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: -6.81E-01
p-value: 3.45E-03
More Results Click to View More RNA-seq Results
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Glioma [ICD-11: 2A00.0]
Responsed Drug R-2HG Investigative
Target Regulation Down regulation
Cell Process Glutamine metabolism
Cell apoptosis
In-vitro Model
8-MG-BA Glioblastoma Homo sapiens CVCL_1052
A-172 Glioblastoma Homo sapiens CVCL_0131
DK-MG Glioblastoma Homo sapiens CVCL_1173
GaMG Glioblastoma Homo sapiens CVCL_1226
HEL Erythroleukemia Homo sapiens CVCL_0001
Jurkat T acute lymphoblastic leukemia Homo sapiens CVCL_0065
KOCL-45 B acute lymphoblastic leukemia Homo sapiens CVCL_3993
KOCL-48 Childhood acute monocytic leukemia Homo sapiens CVCL_6867
KOCL-50 B acute lymphoblastic leukemia Homo sapiens CVCL_6866
KOCL-51 B acute lymphoblastic leukemia Homo sapiens CVCL_6865
KOCL-69 B acute lymphoblastic leukemia Homo sapiens CVCL_3995
KOPN-1 B acute lymphoblastic leukemia Homo sapiens CVCL_3937
LN-18 Glioblastoma Homo sapiens CVCL_0392
LN-229 Glioblastoma Homo sapiens CVCL_0393
MA9.3 (MA9.3)
MA9.6ITD (MLL-AF9 plus FLT3-ITD)
MA9.6RAS (MLL-AF9 plus NRasG12D)
MA9.6 (MLL-AF9)
MA9.6ITD (MLL-AF9 plus FLT3-ITD)
MA9.6RAS (MLL-AF9 plus NRasG12D)
ME-1 [Human leukemia] Adult acute myeloid leukemia Homo sapiens CVCL_2110
ML-2 Adult acute myeloid leukemia Homo sapiens CVCL_1418
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
PL21 Familial adenomatous polyposis Homo sapiens CVCL_JM48
T98G Glioblastoma Homo sapiens CVCL_0556
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
In-vivo Model For R-2HG injection mouse models, sensitive (NOMO-1 and MA9.3ITD) or resistant (MA9.3RAS) cells were injected into NSGS or NRGS intravenously, and then R-2HG (6mg/kg body weight) or PBS were injected once daily through tail vein for 12 consecutive days starting from day 11 post xeno-transplantation.
Response Summary This work demonstrates anti-tumor effects of 2HG in inhibiting proliferation/survival of FTO-high cancer cells via targeting FTO/m6A/Myc proto-oncogene protein (MYC)/CEBPA signaling.High levels of FTO sensitize leukemia cells to R-2HG, whereas hyperactivation of MYC signaling confers resistance that can be reversed by the inhibition of MYC signaling. R-2HG also displays anti-tumor activity in glioma. High levels of FTO sensitize leukemic cells to R-2HG, whereas hyperactivation of MYC signaling confers resistance that can be reversed by the inhibition of MYC signaling.
Solid tumour/cancer [ICD-11: 2A00-2F9Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [33]
Responsed Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Target Regulation Down regulation
Pathway Response Wnt signaling pathway hsa04310
Central carbon metabolism in cancer hsa05230
Glycolysis / Gluconeogenesis hsa00010
Cell Process Glycolysis
In-vitro Model
NCI-H322 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1556
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model Mice were randomized into several groups. For the subcutaneous implantation model, 1 × 106 cells were injected subcutaneously into the flank regions of female BALB/c nude mice (4-5 weeks). For lung colonization assays, 1 × 106 cells were injected into the tail vein of female NOD/SCID mice (6-7 weeks), and 6 weeks later the lung was removed and fixed with 10% formalin.
Response Summary Wnt/Beta-catenin-mediated FTO downregulation and underscored the role of m6A modifications of Myc proto-oncogene protein (MYC) mRNA in regulating tumor cell glycolysis and growth.
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Leukaemia [ICD-11: 2B33.4]
Responsed Drug R-2HG Investigative
Target Regulation Down regulation
Cell Process Glutamine metabolism
Cell apoptosis
In-vitro Model
8-MG-BA Glioblastoma Homo sapiens CVCL_1052
A-172 Glioblastoma Homo sapiens CVCL_0131
DK-MG Glioblastoma Homo sapiens CVCL_1173
GaMG Glioblastoma Homo sapiens CVCL_1226
HEL Erythroleukemia Homo sapiens CVCL_0001
Jurkat T acute lymphoblastic leukemia Homo sapiens CVCL_0065
KOCL-45 B acute lymphoblastic leukemia Homo sapiens CVCL_3993
KOCL-48 Childhood acute monocytic leukemia Homo sapiens CVCL_6867
KOCL-50 B acute lymphoblastic leukemia Homo sapiens CVCL_6866
KOCL-51 B acute lymphoblastic leukemia Homo sapiens CVCL_6865
KOCL-69 B acute lymphoblastic leukemia Homo sapiens CVCL_3995
KOPN-1 B acute lymphoblastic leukemia Homo sapiens CVCL_3937
LN-18 Glioblastoma Homo sapiens CVCL_0392
LN-229 Glioblastoma Homo sapiens CVCL_0393
MA9.3 (MA9.3)
MA9.6ITD (MLL-AF9 plus FLT3-ITD)
MA9.6RAS (MLL-AF9 plus NRasG12D)
MA9.6 (MLL-AF9)
MA9.6ITD (MLL-AF9 plus FLT3-ITD)
MA9.6RAS (MLL-AF9 plus NRasG12D)
ME-1 [Human leukemia] Adult acute myeloid leukemia Homo sapiens CVCL_2110
ML-2 Adult acute myeloid leukemia Homo sapiens CVCL_1418
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
PL21 Familial adenomatous polyposis Homo sapiens CVCL_JM48
T98G Glioblastoma Homo sapiens CVCL_0556
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
In-vivo Model For R-2HG injection mouse models, sensitive (NOMO-1 and MA9.3ITD) or resistant (MA9.3RAS) cells were injected into NSGS or NRGS intravenously, and then R-2HG (6mg/kg body weight) or PBS were injected once daily through tail vein for 12 consecutive days starting from day 11 post xeno-transplantation.
Response Summary This work demonstrates anti-tumor effects of 2HG in inhibiting proliferation/survival of FTO-high cancer cells via targeting FTO/m6A/Myc proto-oncogene protein (MYC)/CEBPA signaling.High levels of FTO sensitize leukemia cells to R-2HG, whereas hyperactivation of MYC signaling confers resistance that can be reversed by the inhibition of MYC signaling. R-2HG also displays anti-tumor activity in glioma. High levels of FTO sensitize leukemic cells to R-2HG, whereas hyperactivation of MYC signaling confers resistance that can be reversed by the inhibition of MYC signaling.
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [34]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell apoptosis
In-vitro Model
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model RC cells SW480 at logarithmic growth phase were prepared into cell suspension with a concentration of about 1 × 107/100 L, which was then injected into the left axilla of nude mice with a 1 ml syringe to establish a subcutaneous mouse xenograft model. Once the tumor volume reached about 50 mm3, the nude mice were injected with miR-96 antagomir or NC antagomir (10 nmol once every 5 days for 5 weeks). After 5 weeks, the mice were euthanized, after which the subcutaneous transplanted tumor was removed, and weighed.
Response Summary MiR-96 antagomir could potentially retard the cancerogenesis in colorectal cancer via AMPK-alpha-2-dependent inhibition of FTO and blocking FTO-mediated m6A modification of Myc proto-oncogene protein (MYC).
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [36]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Up regulation
Cell Process Cell proliferation
In-vitro Model
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
HPDE Normal Homo sapiens CVCL_4376
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
Response Summary FTO has been indicated to interact with Myc proto-oncogene protein (MYC) proto-oncogene, bHLH transcription factor and to enhance its stability by decreasing its m6A level.the aforementioned observations indicate a novel mechanism for the regulation of pancreatic cancer cells by FTO.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [37]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Pathway Response p53 signaling pathway hsa04115
Central carbon metabolism in cancer hsa05230
PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Response Summary This study revealed that m6A methylation is closely related to the poor prognosis of non-small cell lung cancer patients via interference with the TIME, which suggests that m6A plays a role in optimizing individualized immunotherapy management and improving prognosis. The expression levels of METTL3, FTO and YTHDF1 in non-small cell lung cancer were changed. Patients in Cluster 1 had lower immunoscores, higher programmed death-ligand 1 (PD-L1) expression, and shorter overall survival compared to patients in Cluster 2. The Myc proto-oncogene protein (MYC) targets, E2 transcription Factor (E2F) targets were significantly enriched.
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [38]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Up regulation
Cell Process Cell proliferation and migration
In-vitro Model
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
Response Summary FTO interacts with transcripts of E2F1 and Myc proto-oncogene protein (MYC), inhibition of FTO significantly impairs the translation efficiency of E2F1 and Myc.FTO plays important oncogenic role in regulating cervical cancer cells' proliferation.
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [100]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation Down regulation
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [101]
Responsed Disease Esophageal cancer [ICD-11: 2B70]
Target Regulation Down regulation
In-vitro Model
TE-1 Esophageal squamous cell carcinoma Homo sapiens CVCL_1759
Eca-109 Esophageal squamous cell carcinoma Homo sapiens CVCL_6898
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
TE-10 Esophageal squamous cell carcinoma Homo sapiens CVCL_1760
In-vivo Model The mice were acclimatized and fed for one week. Then, they were randomly divided into two groups: sh-NC group and sh-SHMT2 group. Cells transfected with sh-NC or sh-SHMT2 were subsequently cultured routinely. Next, cells with logarithmic growth phase (1 ×106) were taken and injected to the right axilla of nude mice. After subcutaneous inoculation, the mice were observed for their mental status, activity, and tumor formation. The tumor volume was monitored every 4 days, and the mice were euthanized after 28 days. Tumor tissues were separated and weighed from nude mice. A portion of the dissected tumor tissue was fixed overnight in 4% paraformaldehyde, embedded in paraffin blocks and sectioned.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [88]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
In-vivo Model Male BALB/c nude mice (aged 4-6 weeks; n = 5/group) were obtained from Vital River Laboratory Animal Technology (Beijing, China). MHCC97H or Huh7 cells (2 × 106 cells/mouse) stably transfected with lentivirus containing different plasmids in 100 μL DMEM were subcutaneously or orthotopically implanted into the nude mice.
Myeloid zinc finger 1 (MZF1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line B16-OVA cell line Mus musculus
Treatment: shFTO B16-OVA cells
Control: shNC B16-OVA cells
GSE154952
Regulation
logFC: -6.18E-01
p-value: 2.06E-02
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [35]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
Pathway Response Ubiquitin mediated proteolysis hsa04120
Cell Process Cell proliferation
In-vitro Model
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
In-vivo Model Twenty-four specific pathogen free female BALB/c nude mice (age: 6 weeks, weight: 15 ~ 18 g) were purchased from Slac Laboratory Animal Co., Ltd., and subcutaneously injected with SW620 cells stably transfected with oe-NC, oe-GSK3-Beta + oe-NC, or oe-GSK3-Beta + oe-c-Myc to establish a subcutaneous xenograft tumour model in nude mice.
Response Summary GSK3beta inhibited Myeloid zinc finger 1 (MZF1) expression by mediating FTO-regulated m6A modification of MZF1 and then decreased the proto-oncogene c-Myc expression, thus hampering CRC cell proliferation.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [39]
Responsed Disease Lung squamous cell carcinoma [ICD-11: 2C25.2]
Target Regulation Up regulation
Cell Process mRNA stability
In-vitro Model
16HBE14o- Normal Homo sapiens CVCL_0112
BEAS-2B Normal Homo sapiens CVCL_0168
CHLH-1 (The human squamous lung cancer cell line)
NCI-H226 Pleural epithelioid mesothelioma Homo sapiens CVCL_1544
CHLH-1 (The human squamous lung cancer cell line)
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
Response Summary FTO enhanced Myeloid zinc finger 1 (MZF1) expression by reducing m6A levels and mRNA stability in MZF1 mRNA transcript, leading to oncogenic functions. The functional importance of FTO in the tumor progression of LUSC and provides a potential therapeutic target for LUSC treatment.
Negative growth regulatory protein MyD118 (GADD45B)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line HEK293 cell line Homo sapiens
Treatment: FTO knockout HEK293 cells
Control: Wild type HEK293 cells
GSE79577
Regulation
logFC: 8.04E-01
p-value: 5.27E-05
More Results Click to View More RNA-seq Results
Muscular dystrophies [ICD-11: 8C70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [40]
Responsed Disease Muscular dystrophies [ICD-11: 8C70]
Target Regulation Up regulation
Pathway Response Nucleotide excision repair hsa03420
MAPK signaling pathway hsa04010
Cell Process DNA repair
In-vitro Model
GPM (Goat primary myoblasts)
In-vivo Model Sixteen female goats in good body condition and suitable for pregnancy were selected. All selected goats underwent estrus synchronization treatment and were naturally mated. After 75 days of gestation, four male fetuses were removed from five pregnant goats during abortion operations, and their longissimus muscle samples were collected.
Response Summary Negative growth regulatory protein MyD118 (GADD45B)-mediated m6A modification in Negative growth regulatory protein MyD118 (GADD45B) mRNA drives skeletal muscle differentiation by activating the p38 MAPK pathway, which provides a molecular mechanism for the regulation of myogenesis via RNA methylation.
Neurogenic locus notch homolog protein 1 (NOTCH1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: 6.94E-01
p-value: 5.11E-07
More Results Click to View More RNA-seq Results
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [27]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Down regulation
Pathway Response Notch signaling pathway hsa04330
Cell Process Cell proliferation
Cell invasion
Cell apoptosis
In-vitro Model
HT-1197 Recurrent bladder carcinoma Homo sapiens CVCL_1291
HT-1376 Bladder carcinoma Homo sapiens CVCL_1292
In-vivo Model BALB/cnu/nu mice (4-5 weeks old) were used for the xenograft experiment. The mice were randomly divided into 2 groups (n = 6 for each group) and injected with 5 × 106 HT-1197 cells in control group or FTO plasmid group, respectively.
Response Summary In bladder cancer, the changes in m6A methylation level mainly appeared at 5' untranslated region (5' UTR) of MALAT1 and Neurogenic locus notch homolog protein 1 (NOTCH1) transcripts, and at 3' UTR of CSNK2A2 and ITGA6 transcripts, responding to the overexpression of FTO. SFPQ could influence the FTO-mediated m6A RNA demethylation, eventually affecting the gene expression.
Neutral amino acid transporter B(0) (SLC1A5)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: -1.02E+00
p-value: 5.80E-30
More Results Click to View More RNA-seq Results
Renal cell carcinoma [ICD-11: 2C90]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [41]
Responsed Disease Renal cell carcinoma [ICD-11: 2C90]
Responsed Drug GLS-IN-968 Investigative
Target Regulation Up regulation
Pathway Response Central carbon metabolism in cancer hsa05230
HIF-1 signaling pathway hsa04066
Central carbon metabolism in cancer hsa05230
Metabolic pathways hsa01100
VEGF signaling pathway hsa04370
In-vitro Model
UMRC2-vec (CCRCC isogenic cell lines that are VHL-deficient)
Response Summary Genetic inactivation of FTO using multiple orthogonal approaches revealed that FTO inhibition selectively reduces the growth and survival of VHL-deficient cells in vitro and in vivo. Integrated analysis of transcriptome-wide m6A-seq and mRNA-seq analysis identified the glutamine transporter Neutral amino acid transporter B(0) (SLC1A5) as an FTO target that promotes metabolic reprogramming and survival of VHL-deficient ccRCC cells. GLS1 inhibitors that target mitochondrial glutaminase and the conversion of glutamine to glutamate are currently being evaluated in early-phase clinical trials in ccRCC. These findings identify FTO as a potential HIF-independent therapeutic target for the treatment of VHL-deficient renal cell carcinoma.
Nucleophosmin (NPM1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: -7.88E-01
p-value: 1.66E-04
More Results Click to View More RNA-seq Results
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [20]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation Up regulation
In-vitro Model
OCI-AML-3 Adult acute myeloid leukemia Homo sapiens CVCL_1844
OCI-AML-2 Adult acute myeloid leukemia Homo sapiens CVCL_1619
Response Summary FTO depended on its m6A RNA demethylase activity to activate PDGFRB/ERK signaling axis. FTO-mediated m6A demethylation plays an oncogenic role in Nucleophosmin (NPM1)-mutated Acute myeloid leukemia(AML).
P5C reductase 1 (PYCR1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: -8.46E-01
p-value: 2.98E-19
More Results Click to View More RNA-seq Results
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [42]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Pathway Response mRNA surveillance pathway hsa03015
RNA degradation hsa03018
Cell Process RNA stability
In-vitro Model
T24 Bladder carcinoma Homo sapiens CVCL_0554
SV-HUC-1 Normal Homo sapiens CVCL_3798
RT-4 Bladder carcinoma Homo sapiens CVCL_0036
J82 Bladder carcinoma Homo sapiens CVCL_0359
EJ (Human bladder cancer cells)
5637 Bladder carcinoma Homo sapiens CVCL_0126
In-vivo Model T24 cells were subcutaneously injected into the mice (1 x 106 cells / injecting site).
Response Summary FTO decreased N6-methyladenosine methylation level in P5C reductase 1 (PYCR1) through its demethylase enzymatic activity and stabilized PYCR1 transcript to promote bladder cancer initiation and progression.
PDH kinase 1 (PDK1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: -7.19E-01
p-value: 8.18E-03
More Results Click to View More RNA-seq Results
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [43]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Responsed Drug Temozolomide Approved
Target Regulation Up regulation
Pathway Response Citrate cycle hsa00020
Central carbon metabolism in cancer hsa05230
Cell Process Aerobic glycolysis
Cell apoptosis
In-vitro Model
LN-18 Glioblastoma Homo sapiens CVCL_0392
LN-229 Glioblastoma Homo sapiens CVCL_0393
SHG-44 Astrocytoma Homo sapiens CVCL_6728
U251 (Fibroblasts or fibroblast like cells)
U87 (A primary glioblastoma cell line)
Response Summary Long noncoding RNA just proximal to X-inactive specific transcript facilitates aerobic glycolysis and temozolomide chemoresistance by promoting stability of PDH kinase 1 (PDK1) mRNA in an m6A-dependent manner in glioblastoma multiforme cells. JPX interacted with N6-methyladenosine (m6A) demethylase FTO alpha-ketoglutarate dependent dioxygenase (FTO) and enhanced FTO-mediated PDK1 mRNA demethylation.
Peroxisome proliferator-activated receptor gamma (PPARG)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 2.20E+00
p-value: 2.69E-03
More Results Click to View More RNA-seq Results
Low bone mass disorder [ICD-11: FB83]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [44]
Responsed Disease Osteoporosis [ICD-11: FB83.1]
Target Regulation Down regulation
Pathway Response Osteoclast differentiation hsa04380
In-vitro Model
hMSCs (Human osteogenesis of mesenchymal stem cells (HUXMA-01001, Cyagen Biosciences, Suzhou, China))
In-vivo Model Conditional knockout of Fto in bone in mice was generated as previously described. Throughout the study, mice were maintained on a 12 h: 12 h light:dark cycle in a specific pathogen-free facility.
Response Summary Both depletion of FTO and application of the FTO inhibitor FB23 or FB23-2 impaired osteogenic differentiation of human MSCs. Knockdown of Peroxisome proliferator-activated receptor gamma (PPARG) promoted FTO-induced expression of the osteoblast biomarkers ALPL and OPN during osteogenic differentiation. This study demonstrates the functional significance of the FTO-PPARG axis in promoting the osteogenesis of human MSCs and sheds light on the role of m6A modification in mediating osteoporosis and osteonecrosis.
Platelet-derived growth factor C (PDGFC)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: 8.37E+00
p-value: 3.21E-02
More Results Click to View More RNA-seq Results
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [45]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
In-vitro Model
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
HPDE Normal Homo sapiens CVCL_4376
CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
Capan-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0237
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
AsPC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model The right flanks of mice were injected subcutaneously with 2 × 106 MiaPaCa-2 cells stably expressing shFTO and a scrambled shRNA in 100 uL PBS. Tumors were measured using an external caliper once per week, and tumor volume was calculated with the formula: (length × width2)/2.
Response Summary FTO downregulation leads to increased m6A modifications in the 3' UTR of Platelet-derived growth factor C (PDGFC) and then modulates the degradation of its transcriptional level in an m6A-YTHDF2-dependent manner, highlighting a potential therapeutic target for PDAC treatment and prognostic prediction.
Platelet-derived growth factor receptor beta (PDGFRB)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 6.89E-01
p-value: 9.80E-03
More Results Click to View More RNA-seq Results
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [20]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model
OCI-AML-3 Adult acute myeloid leukemia Homo sapiens CVCL_1844
OCI-AML-2 Adult acute myeloid leukemia Homo sapiens CVCL_1619
Response Summary FTO depended on its m6A RNA demethylase activity to activate Platelet-derived growth factor receptor beta (PDGFRB)/ERK signaling axis. FTO-mediated m6A demethylation plays an oncogenic role in NPM1-mutated Acute myeloid leukemia(AML).
PPAR-gamma coactivator 1-alpha (PGC-1a/PPARGC1A)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: 4.58E+00
p-value: 7.10E-03
More Results Click to View More RNA-seq Results
Renal cell carcinoma [ICD-11: 2C90]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [46]
Responsed Disease clear cell renal cell carcinoma [ICD-11: 2C90.0]
Target Regulation Up regulation
Cell Process Oxidative stress
ROS production
In-vitro Model
HEK293T Normal Homo sapiens CVCL_0063
769-P Renal cell carcinoma Homo sapiens CVCL_1050
786-O Renal cell carcinoma Homo sapiens CVCL_1051
In-vivo Model Five- to 6-week-old male athymic nude mice purchased by Charles River were used for the xenograft model. 769-P cells stably expressing Ctrl, FTO and FTO-mut were trypsinized and washed twice to thrice with standardized PBS, and then, 5 × 106 cells in 100 uL of PBS was subcutaneously injected into the flanks of the mice (five mice per group). Mice were monitored twice every week for tumour growth, and tumour diameters were measured using a caliper.
Response Summary FTO plays a critical anti-tumorigenic role in Clear Cell Renal Cell Carcinoma.Restored expression of FTO, through reducing m6A levels in mRNA transcripts of its critical target gene PPAR-gamma coactivator 1-alpha (PGC-1a/PPARGC1A), increases mitochondrial content, ROS production and oxidative damage, with the most important effect of repressed tumour growth.
Muscular dystrophies [ICD-11: 8C70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [47]
Responsed Disease Muscular dystrophies [ICD-11: 8C70]
Target Regulation Up regulation
Cell Process Myogenic differentiation
mTOR signaling pathway (hsa04150)
In-vitro Model
MPM (Mouse primary myoblasts from about 10-day-old C57BL/6J were isolated)
C2C12 Normal Mus musculus CVCL_0188
HEK293-FT Normal Homo sapiens CVCL_6911
In-vivo Model To generate doxycycline-inducible skeletal muscle-specific FTO deletion mice, FTOflox/flox mice were crossed with HSA-Cre mice to generate FTOflox/+ HSA-Cre mice, which were then crossed to FTOflox/flox mice to generate FTOflox/flox and FTOflox/flox HSA-Cre mice.
Response Summary FTO downregulation suppressed mitochondria biogenesis and energy production, showing as the decreased mitochondria mass and mitochondrial DNA (mtDNA) content, the downregulated expression of mtDNA-encoding genes and PPAR-gamma coactivator 1-alpha (PGC-1a/PPARGC1A) gene, together with declined ATP level. These findings provide the first evidence for the contribution of FTO for skeletal muscle differentiation.
Programmed cell death 1 ligand 1 (CD274/PD-L1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: 3.22E+00
p-value: 3.45E-05
More Results Click to View More RNA-seq Results
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [48]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Target Regulation Up regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Response Summary Arecoline-induced FTO promotes the stability and expression levels of Programmed cell death 1 ligand 1 (CD274/PD-L1) transcripts through mediating m6A modification and MYC activity, respectively. PD-L1 upregulation confers superior cell proliferation, migration, and resistance to T-cell killing to OSCC cells.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [37]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Pathway Response p53 signaling pathway hsa04115
Central carbon metabolism in cancer hsa05230
PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Response Summary This study revealed that m6A methylation is closely related to the poor prognosis of non-small cell lung cancer patients via interference with the TIME, which suggests that m6A plays a role in optimizing individualized immunotherapy management and improving prognosis. The expression levels of METTL3, FTO and YTHDF1 in non-small cell lung cancer were changed. Patients in Cluster 1 had lower immunoscores, higher Programmed cell death 1 ligand 1 (CD274/PD-L1) expression, and shorter overall survival compared to patients in Cluster 2. The hallmarks of the Myelocytomatosis viral oncogene (MYC) targets, E2 transcription Factor (E2F) targets were significantly enriched.
Pyruvate kinase PKM (PKM2/PKM)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 1.52E+00
p-value: 5.79E-04
More Results Click to View More RNA-seq Results
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [49]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Down regulation
Pathway Response Central carbon metabolism in cancer hsa05230
Cell Process Glucose metabolism
In-vitro Model
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
SMMC-7721 Endocervical adenocarcinoma Homo sapiens CVCL_0534
In-vivo Model The transfected cells (2×106) were directly subcutaneously injected in to flank of mice. The width and length were measured every six days. After three weeks, the mice were killed and the necropsies were weighted.
Response Summary The overexpression of demethylase FTO in the HCC tissue and cells. FTO could regulate the demethylation of Pyruvate kinase PKM (PKM2/PKM) in the hepatocellular carcinoma.
Ras GTPase-activating-like protein IQGAP1 (IQGAP1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 6.41E-01
p-value: 2.42E-02
More Results Click to View More RNA-seq Results
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [50]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
Pathway Response Ubiquitin mediated proteolysis hsa04120
Cell Process Proteasome pathway degradation
In-vitro Model
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
HCCLM3 Adult hepatocellular carcinoma Homo sapiens CVCL_6832
In-vivo Model For subcutaneous xenotransplanted tumor models, cells were injected subcutaneously (5 × 106 for MHCC97H or 1×106 for PLC cells per mouse).
Response Summary AMD1 could stabilize the interaction of Ras GTPase-activating-like protein IQGAP1 (IQGAP1) with FTO, which then promotes FTO expression and increases HCC stemness.
Runt-related transcription factor 2 (Runx2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Cerebral cortex Mus musculus
Treatment: METTL3 (f/f, Emx1-cre) cerebral cortex
Control: Wild type cerebral cortex
GSE154992
Regulation
logFC: -1.60E+00
p-value: 6.61E-03
More Results Click to View More RNA-seq Results
Low bone mass disorder [ICD-11: FB83]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [51]
Responsed Disease Osteoporosis [ICD-11: FB83.1]
Target Regulation Down regulation
In-vitro Model
BMSCs (BMSCs were obtained from the femurs and tibias of 2-3-week-old Sprague-Dawley male rats (Animal Center of Sun Yat-sen University))
In-vivo Model Female C57BL/6J mice (14 weeks old) were treated with bilateral ovariectomy under general anesthesia. Eight weeks after surgery, tibial plateau was harvested and the structure were evaluated with a SCANCO Medical uCT 40 scanner.
Response Summary RNA N6-methyladenosine demethylase FTO promotes osteoporosis through demethylating Runt-related transcription factor 2 (Runx2) mRNA and inhibiting osteogenic differentiation.
Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2a/ATP2A2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 5.91E-01
p-value: 1.58E-02
More Results Click to View More RNA-seq Results
Energy metabolism disorder [ICD-11: 5C53]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [52]
Responsed Disease Energy metabolism disorder [ICD-11: 5C53]
Target Regulation Up regulation
Cell Process Energy metabolism
Cell apoptosis
In-vitro Model
AC16 [Human hybrid cardiomyocyte] Normal Homo sapiens CVCL_4U18
Response Summary FTO modification of N6 -methyladenosine is associated with myocardial cell energy metabolism disorder. FTO reduced the m6A level of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2a/ATP2A2) mRNA through demethylation, thus promoting SERCA2a expression, maintaining calcium homeostasis, and improving energy metabolism of H/R cardiomyocytes.
Acute myocardial infarction [ICD-11: BA41]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [116]
Responsed Disease Acute myocardial infarction [ICD-11: BA41]
Sequestosome-1 (SQSTM1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: 6.53E-01
p-value: 1.38E-07
More Results Click to View More RNA-seq Results
Solid tumour/cancer [ICD-11: 2A00-2F9Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [54]
Responsed Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Target Regulation Down regulation
Pathway Response Autophagy hsa04140
Cell Process Cellular Processes
Transport and catabolism
Cell autophagy
In-vitro Model
HaCaT Normal Homo sapiens CVCL_0038
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
MEF (Mouse embryonic fibroblasts)
In-vivo Model As cells (5 million) in Matrigel or As-T (1 million) cells in PBS with or without gene manipulations were injected subcutaneously into the right flanks of female mice (6-8 weeks of age). For treatment with CS1 or CS2, As-T cells (1 million) in PBS were injected subcutaneously into the right flanks of 6-week-old female nude mice.
Response Summary FTO deletion inhibited arsenic-induced tumorigenesis. Epidermis-specific FTO deletion prevented skin tumorigenesis induced by arsenic and UVB irradiation. NEDD4L was identified as the m6A-modified gene target of FTO. Arsenic stabilizes FTO protein through inhibiting Sequestosome-1 (SQSTM1)-mediated selective autophagy. FTO-mediated dysregulation of mRNA m6A methylation as an epitranscriptomic mechanism to promote arsenic tumorigenicity. Arsenic suppresses p62 expression by downregulating the NF-kappaB pathway to upregulate FTO.
Human skin lesions [ICD-11: ME60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [54]
Responsed Disease Human skin lesions [ICD-11: ME60]
Target Regulation Down regulation
Pathway Response Autophagy hsa04140
Cell Process Cellular Processes
Transport and catabolism
Cell autophagy
In-vitro Model
HaCaT Normal Homo sapiens CVCL_0038
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
MEF (Mouse embryonic fibroblasts)
In-vivo Model As cells (5 million) in Matrigel or As-T (1 million) cells in PBS with or without gene manipulations were injected subcutaneously into the right flanks of female mice (6-8 weeks of age). For treatment with CS1 or CS2, As-T cells (1 million) in PBS were injected subcutaneously into the right flanks of 6-week-old female nude mice.
Response Summary FTO deletion inhibited arsenic-induced tumorigenesis. Epidermis-specific FTO deletion prevented skin tumorigenesis induced by arsenic and UVB irradiation. NEDD4L was identified as the m6A-modified gene target of FTO. Arsenic stabilizes FTO protein through inhibiting Sequestosome-1 (SQSTM1)-mediated selective autophagy. FTO-mediated dysregulation of mRNA m6A methylation as an epitranscriptomic mechanism to promote arsenic tumorigenicity. Arsenic suppresses p62 expression by downregulating the NF-kappaB pathway to upregulate FTO.
Macroscopic changes of size of the kidney [ICD-11: MF54]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [117]
Responsed Disease Macroscopic changes of size of the kidney [ICD-11: MF54.0]
Responsed Drug Canagliflozin Approved
Target Regulation Down regulation
In-vitro Model
HK2 Normal Acipenser baerii CVCL_YE28
Serine/threonine-protein kinase ULK1 (ULK1/ATG1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: -6.13E-01
p-value: 1.25E-06
More Results Click to View More RNA-seq Results
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [55]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Responsed Drug Cisplatin Approved
Target Regulation Up regulation
In-vitro Model
GES-1 Normal Homo sapiens CVCL_EQ22
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
In-vivo Model A total of 5 × 106 cells in 200 ul PBS were injected subcutaneously into the flanks of nude mice. After injection, cisplatin treatment was initiated on day 5. Mice were injected with 5 mg/kg cisplatin or PBS solution in the abdominal cavity once a week for 3 weeks.
Response Summary Knockdown of FTO reversed cisplatin resistance of SGC-7901/DDP cells both in vitro and in vivo, which was attributed to the inhibition of Serine/threonine-protein kinase ULK1 (ULK1)-mediated autophagy. These findings indicate that the FTO/ULK1 axis exerts crucial roles in cisplatin resistance of gastric cancer.
Sterol regulatory element-binding protein 1 (SREBF1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: -1.19E+00
p-value: 4.36E-38
More Results Click to View More RNA-seq Results
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation Up regulation
Cell Process Lipogenesis
In-vitro Model
HEK293T Normal Homo sapiens CVCL_0063
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model After being fed with high-fat diet for 4 weeks, mice were given twice vena caudalis injection of control siRNA or Cidec siRNA (50 ug/mouse) mixed with liposome. Liposomes were prepared as described elsewhere.
Response Summary FTO increased the lipid accumulation in hepatocytes by increasing nuclear translocation of Sterol regulatory element-binding protein 1 (SREBF1) and SREBP1c maturation, thus improving the transcriptional activity of LD-associated protein CIDEC.The studies provide new mechanistic insight into nonalcoholic fatty liver disease (NAFLD) mediated by FTO.
Superoxide dismutase [Mn], mitochondrial (SOD2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 8.09E-01
p-value: 6.85E-03
More Results Click to View More RNA-seq Results
Multiple myeloma [ICD-11: 2A83]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [56]
Responsed Disease Multiple myeloma [ICD-11: 2A83.1]
Responsed Drug Bortezomib Approved
Target Regulation Down regulation
Response Summary FTO promotes Bortezomib resistance via m6A-dependent destabilization of Superoxide dismutase [Mn], mitochondrial (SOD2) expression in multiple myeloma.
Tissue factor pathway inhibitor 2 (TFPI-2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: 1.23E+01
p-value: 1.69E-03
More Results Click to View More RNA-seq Results
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [57]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Down regulation
Cell Process Cell growth
cell migration
cell invasion
Response Summary Knockdown of FTO increases m6A methylation of Tissue factor pathway inhibitor 2 (TFPI-2) mRNA in PC cells, thereby increasing mRNA stability via the m6A reader YTHDF1.
Transcription factor PU.1 (SPI1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line TPC_1 cell line Homo sapiens
Treatment: FTO overexpression TPC_1 cells
Control: TPC_1 cells
GSE199206
Regulation
logFC: -7.40E+00
p-value: 4.06E-02
More Results Click to View More RNA-seq Results
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [58]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Target Regulation Down regulation
In-vitro Model
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
U251 (Fibroblasts or fibroblast like cells)
U-118MG Astrocytoma Homo sapiens CVCL_0633
LN-229 Glioblastoma Homo sapiens CVCL_0393
A-172 Glioblastoma Homo sapiens CVCL_0131
In-vivo Model BALB/c male nude mice were 4 weeks old. GBM cells with stable overexpression or knockdown of FTO and ovNC or shNC were transduced with lentivirus expressing luciferase. The cells were intracranially injected at a density of 5 × 105/10 uL into every mouse to form an orthotopic xenograft model. Coordinates of injection were 1 mm anterior and 2.5 mm right to the bregma, at a depth of 3.5 mm (the right frontal lobes of the mouse). Every 6 days, bioluminescence imaging (IVIS Lumina Series III; PerkinElmer, Waltham, MA) was used to image the mouse. At 8 days, we randomly chose 5 mice from each group to euthanize them, and their brain tissues were fixed with paraformaldehyde for further study. Another 5 mice were used for survival time analysis. For DB2313 (563801; MedKoo) anti-tumor research, male nude mice were subcutaneously injected with 5 × 106 U87MG cells suspended in 0.1 mL PBS. After 7 days, mice were intraperitoneally injected with DB2313 at density of 10 mg/kg/day dissolved in PBS solvent containing 10% DMSO for 7 days. The other group treated with vehicle only was set as the control group.
Response Summary FTO inhibited growth, migration and invasion of GBM cells in vitro and in vivo.decreased FTO expression could induce the downregulation of MTMR3 expression by modulating the processing of pri-miR-10a in an m6A/HNRNPA2B1-dependent manner in GBM cells. Furthermore, the transcriptional activity of FTO was inhibited by the transcription factor Transcription factor PU.1 (SPI1).
Transcription factor SOX-10 (SOX10)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Cerebral cortex Mus musculus
Treatment: METTL3 (f/f, Emx1-cre) cerebral cortex
Control: Wild type cerebral cortex
GSE154992
Regulation
logFC: -8.13E-01
p-value: 2.61E-03
More Results Click to View More RNA-seq Results
Melanoma [ICD-11: 2C30]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Melanoma [ICD-11: 2C30]
Responsed Drug PMID31239444-anti-PD1 antibody Investigative
Target Regulation Up regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Cell Process mRNA decay
In-vitro Model
B16-F10 Mouse melanoma Mus musculus CVCL_0159
CHL-1 Melanoma Homo sapiens CVCL_1122
624-mel Melanoma Homo sapiens CVCL_8054
NHEM (Normal Human Epidermal Melanocytes)
SK-MEL-30 Cutaneous melanoma Homo sapiens CVCL_0039
WM115 Melanoma Homo sapiens CVCL_0040
WM35 Melanoma Homo sapiens CVCL_0580
WM3670 Melanoma Homo sapiens CVCL_6799
WM793 Melanoma Homo sapiens CVCL_8787
In-vivo Model When the tumors reached a volume of 80-100 mm3, mice were treated with anti-PD-1 or isotype control antibody (200 ug/mouse) by i.p. injection, every other day for three times. For IFNγ blockade treatment, C57BL/6 mice were treated with anti-IFNγ antibody or isotype control IgG (250 ug/mouse) every other day after tumor cell inoculation.
Response Summary These findings demonstrate a crucial role of FTO as an m6A demethylase in promoting melanoma tumorigenesis and anti-PD-1 resistance, and suggest that the combination of FTO inhibition with anti-PD-1 blockade reduces the resistance to immunotherapy in melanoma. Knockdown of FTO increases m6A methylation in the critical protumorigenic melanoma cell-intrinsic genes including PD-1 (PDCD1), CXCR4, and Transcription factor SOX-10 (SOX10), leading to increased RNA decay through the m6A reader YTHDF2.
Transcriptional coactivator YAP1 (YAP1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Cerebral cortex Mus musculus
Treatment: METTL3 (f/f, Emx1-cre) cerebral cortex
Control: Wild type cerebral cortex
GSE154992
Regulation
logFC: 6.87E-01
p-value: 5.76E-08
More Results Click to View More RNA-seq Results
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [59]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Target Regulation Up regulation
Response Summary Stable knockdown of FTO inhibited OSCC cell viability, colony formation, and tumor growth. Further, FTO depletion increased Transcriptional coactivator YAP1 (YAP1) m6A modification at mRNA 3'-untranslated region, accelerating the degradation of YAP1 mRNA, a well-documented oncogene promoting OSCC progression.
Ischemic heart disease [ICD-11: BA40-BA6Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [60]
Responsed Disease Ischemic heart disease [ICD-11: BA40-BA6Z]
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model
Neonatal rat ventricular cardiomyocytes (Primary myocyte cells)
In-vivo Model After anesthesia (50 mg/kg pentobarbital sodium, intraperitoneal injection), the left thorax was cut to expose the heart, and the left anterior descending (LAD) coronary artery was ligated by 7/0 sterile suture. Myocardial ischemia was induced by 30 min of LAD coronary artery ligation and following 2 h of reperfusion. Sham group mice underwent the same surgical procedure without LAD coronary artery ligation.
Response Summary FTO down-expressed in myocardial IRI mice and hypoxia/reoxygenation (H/R)-induced cardiomyocytes. Moreover, FTO uninstalled the methylation of Transcriptional coactivator YAP1 (YAP1) mRNA, and enforced the stability of Yap1 mRNA.The study reveals the role of FTO in H/R-induced myocardial cell injury via m6A-dependent manner, which provided a new approach to improve myocardial IRI.
Transcriptional enhancer factor TEF-4 (TEAD2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Cerebral cortex Mus musculus
Treatment: METTL3 (f/f, Emx1-cre) cerebral cortex
Control: Wild type cerebral cortex
GSE154992
Regulation
logFC: 6.75E-01
p-value: 4.59E-03
More Results Click to View More RNA-seq Results
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [61]
Responsed Disease Intrahepatic cholangiocarcinoma [ICD-11: 2C12.10]
Target Regulation Down regulation
Cell Process Cell cycle
Cell proliferation
In-vitro Model
HCCC-9810 Intrahepatic cholangiocarcinoma Homo sapiens CVCL_6908
HIBEPIC (Human intrahepatic bile duct epithelial cells)
HuCC-T1 Intrahepatic cholangiocarcinoma Homo sapiens CVCL_0324
RBE Intrahepatic cholangiocarcinoma Homo sapiens CVCL_4896
TFK-1 Cholangiocarcinoma Homo sapiens CVCL_2214
In-vivo Model 1.5 × 106 TFK1 cells with or without FTO overexpression were injected subcutaneously into the left and right flanks of 6-week-old female athymic nude mice.
Response Summary RNA decay assay showed that oncogene Transcriptional enhancer factor TEF-4 (TEAD2) mRNA stability was impaired by FTO. The overexpression of FTO suppressed tumor growth in vivo. In conclusion, our study demonstrated the critical roles of FTO in Intrahepatic cholangiocarcinoma.
Transgelin (SM22alpha)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line TPC_1 cell line Homo sapiens
Treatment: FTO overexpression TPC_1 cells
Control: TPC_1 cells
GSE199206
Regulation
logFC: 6.14E-01
p-value: 1.66E-07
More Results Click to View More RNA-seq Results
Type 2 diabetes mellitus [ICD-11: 5A11]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [62]
Responsed Disease Type 2 diabetes mellitus [ICD-11: 5A11]
Target Regulation Down regulation
In-vitro Model
VSMC (Human aortic vascular smooth muscle cells)
Response Summary FTO knockdown elevated Transgelin (SM22alpha) expression and m6A-binding protein IGF2BP2 enhanced SM22alpha mRNA stability by recognizing and binding to m6A methylation modified mRNA. m6A methylation-mediated elevation of SM22alpha restrained VSMC proliferation and migration and ameliorated intimal hyperplasia in T2DM.
Ubiquitin-like modifier-activating enzyme ATG7 (ATG7)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 1.18E+00
p-value: 1.81E-03
More Results Click to View More RNA-seq Results
Malignant mixed epithelial mesenchymal tumour [ICD-11: 2B5D]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [63]
Responsed Disease Malignant mixed epithelial mesenchymal tumour of ovary [ICD-11: 2B5D.0]
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cell autophagy
In-vitro Model
SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
In-vivo Model The SKOV3 ovarian cancer cell line was transfected with LV2-1 or LV2-NC. Thereafter, BALB/c nude mice (6-week old) were intraperitoneally injected with SKOV3 cells. The mice were killed after 5 weeks, and the number of ascites was determined.
Response Summary CircRAB11FIP1 promoted autophagy flux of ovarian cancer through DSC1 and miR-129. CircRAB11FIP1 can serve as the possible marker for EOC diagnosis and treatment. CircRAB11FIP1 regulated the mechanism of autophagy through m6A modification and direct binding to mRNA. CircRAB11FIP1 bound to the mRNA of FTO and promoted its expression. CircRAB11FIP1 directly bound to miR-129 and regulated its targets Ubiquitin-like modifier-activating enzyme ATG7 (ATG7) and ATG14. CircRAB11FIP1 bound to desmocollin 1to facilitate its interaction with ATG101. CircRAB11FIP1 mediated mRNA expression levels of ATG5 and ATG7 depending on m6A.
Obesity [ICD-11: 5B81]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [64]
Responsed Disease Obesity [ICD-11: 5B81]
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagy
Adipogenesis regulation
In-vitro Model
3T3-L1 Normal Mus musculus CVCL_0123
Pig primary preadipocytes (Isolated from cervical subcutaneous adipose tissue of piglets)
In-vivo Model Mice were maintained at 22 ± 2 ℃ with a humidity of 35 ± 5% under a 12 h light and 12 h dark cycle, with free access to water and food. For the HFD experiment, female control (Ftoflox/flox) and adipose-selective fto knockout (Fabp4-Cre Ftoflox/flox, fto-AKO) mice were fed with high-fat diet (60% fat in calories; Research Diets, D12492) for the desired periods of time, and food intake and body weight were measured every week after weaning (at 3 weeks of age).
Response Summary Atg5 and Ubiquitin-like modifier-activating enzyme ATG7 (ATG7) were the targets of YTHDF2 (YTH N6-methyladenosine RNA binding protein 2). Upon FTO silencing, Atg5 and Atg7 transcripts with higher m6A levels were captured by YTHDF2, which resulted in mRNA degradation and reduction of protein expression, thus alleviating autophagy and adipogenesis.
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [68]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Vascular cell adhesion protein 1 (VCAM1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Mouse hippocampus Mus musculus
Treatment: FTO knockout mice hippocampus
Control: Wild type hippocampus
GSE94098
Regulation
logFC: 6.17E-01
p-value: 3.60E-03
More Results Click to View More RNA-seq Results
Diseases of the circulatory system [ICD-11: BE2Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [29]
Responsed Disease Vascular diseases [ICD-11: BE2Z]
Responsed Drug Atorvastatin Approved
Target Regulation Up regulation
In-vitro Model
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
HUVEC-C Normal Homo sapiens CVCL_2959
HEK293T Normal Homo sapiens CVCL_0063
Response Summary FTO overexpression significantly upregulated the mRNA and protein levels of Vascular cell adhesion protein 1 (VCAM1) and ICAM-1, downregulated those of KLF2 and eNOS, and strongly attenuated the atorvastatin-mediated induction of KLF2 and eNOS expression. FTO could serve as a novel molecular target to modulate endothelial function in vascular diseases.
Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 8.67E-01
p-value: 5.83E-03
More Results Click to View More RNA-seq Results
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [27]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Down regulation
Pathway Response Notch signaling pathway hsa04330
Cell Process Cell proliferation
Cell invasion
Cell apoptosis
In-vitro Model
HT-1197 Recurrent bladder carcinoma Homo sapiens CVCL_1291
HT-1376 Bladder carcinoma Homo sapiens CVCL_1292
In-vivo Model BALB/cnu/nu mice (4-5 weeks old) were used for the xenograft experiment. The mice were randomly divided into 2 groups (n = 6 for each group) and injected with 5 × 106 HT-1197 cells in control group or FTO plasmid group, respectively.
Response Summary In bladder cancer, the changes in m6A methylation level mainly appeared at 5' untranslated region (5' UTR) of Metastasis associated lung adenocarcinoma transcript 1 (MALAT1) and NOTCH1 transcripts, and at 3' UTR of CSNK2A2 and ITGA6 transcripts, responding to the overexpression of FTO. SFPQ could influence the FTO-mediated m6A RNA demethylation, eventually affecting the gene expression.
Kidney failure [ICD-11: GB6Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [66]
Responsed Disease Kidney failure [ICD-11: GB6Z]
Target Regulation Up regulation
In-vitro Model
NIT-1 Insulin tumor Mus musculus CVCL_3561
Response Summary m6A modification is co-regulated by METTL3 and FTO in cadmium-treated cells. Metastasis associated lung adenocarcinoma transcript 1 (MALAT1), LncRNA-PVT1 and m6A modification could be key nodes for cadmium-induced oxidative damage, and highlight their importance as promising preventive and therapeutic targets in cadmium toxicity.
Autophagy protein 5 (ATG5)
Malignant mixed epithelial mesenchymal tumour [ICD-11: 2B5D]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [63]
Responsed Disease Malignant mixed epithelial mesenchymal tumour of ovary [ICD-11: 2B5D.0]
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cell autophagy
In-vitro Model
SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
In-vivo Model The SKOV3 ovarian cancer cell line was transfected with LV2-1 or LV2-NC. Thereafter, BALB/c nude mice (6-week old) were intraperitoneally injected with SKOV3 cells. The mice were killed after 5 weeks, and the number of ascites was determined.
Response Summary CircRAB11FIP1 promoted autophagy flux of ovarian cancer through DSC1 and miR-129. CircRAB11FIP1 can serve as the possible marker for EOC diagnosis and treatment. CircRAB11FIP1 regulated the mechanism of autophagy through m6A modification and direct binding to mRNA. CircRAB11FIP1 bound to the mRNA of FTO and promoted its expression. CircRAB11FIP1 directly bound to miR-129 and regulated its targets ATG7 and ATG14. CircRAB11FIP1 bound to desmocollin 1to facilitate its interaction with ATG101. CircRAB11FIP1 mediated mRNA expression levels of Autophagy protein 5 (ATG5) and ATG7 depending on m6A.
Diabetes [ICD-11: 5A10-5A14]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [67]
Responsed Disease Diabetes [ICD-11: 5A10-5A14]
Responsed Drug Dac51 Investigative
In-vitro Model
MIN6 Mouse insulinoma Mus musculus CVCL_0431
Obesity [ICD-11: 5B81]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [64]
Responsed Disease Obesity [ICD-11: 5B81]
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Autophagy
Adipogenesis regulation
In-vitro Model
3T3-L1 Normal Mus musculus CVCL_0123
Pig primary preadipocytes (Isolated from cervical subcutaneous adipose tissue of piglets)
In-vivo Model Mice were maintained at 22 ± 2 ℃ with a humidity of 35 ± 5% under a 12 h light and 12 h dark cycle, with free access to water and food. For the HFD experiment, female control (Ftoflox/flox) and adipose-selective fto knockout (Fabp4-Cre Ftoflox/flox, fto-AKO) mice were fed with high-fat diet (60% fat in calories; Research Diets, D12492) for the desired periods of time, and food intake and body weight were measured every week after weaning (at 3 weeks of age).
Response Summary Autophagy protein 5 (ATG5) and Atg7 were the targets of YTHDF2 (YTH N6-methyladenosine RNA binding protein 2). Upon FTO silencing, Atg5 and Atg7 transcripts with higher m6A levels were captured by YTHDF2, which resulted in mRNA degradation and reduction of protein expression, thus alleviating autophagy and adipogenesis.
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [68]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Autophagy-related protein 101 (ATG101)
Malignant mixed epithelial mesenchymal tumour [ICD-11: 2B5D]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [63]
Responsed Disease Malignant mixed epithelial mesenchymal tumour of ovary [ICD-11: 2B5D.0]
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cell autophagy
In-vitro Model
SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
In-vivo Model The SKOV3 ovarian cancer cell line was transfected with LV2-1 or LV2-NC. Thereafter, BALB/c nude mice (6-week old) were intraperitoneally injected with SKOV3 cells. The mice were killed after 5 weeks, and the number of ascites was determined.
Response Summary CircRAB11FIP1 promoted autophagy flux of ovarian cancer through DSC1 and miR-129. CircRAB11FIP1 can serve as the possible marker for EOC diagnosis and treatment. CircRAB11FIP1 regulated the mechanism of autophagy through m6A modification and direct binding to mRNA. CircRAB11FIP1 bound to the mRNA of FTO and promoted its expression. CircRAB11FIP1 directly bound to miR-129 and regulated its targets ATG7 and ATG14. CircRAB11FIP1 bound to desmocollin 1to facilitate its interaction with Autophagy-related protein 101 (ATG101). CircRAB11FIP1 mediated mRNA expression levels of ATG5 and ATG7 depending on m6A.
Beclin 1-associated autophagy-related key regulator (ATG14)
Malignant mixed epithelial mesenchymal tumour [ICD-11: 2B5D]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [63]
Responsed Disease Malignant mixed epithelial mesenchymal tumour of ovary [ICD-11: 2B5D.0]
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cell autophagy
In-vitro Model
SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
In-vivo Model The SKOV3 ovarian cancer cell line was transfected with LV2-1 or LV2-NC. Thereafter, BALB/c nude mice (6-week old) were intraperitoneally injected with SKOV3 cells. The mice were killed after 5 weeks, and the number of ascites was determined.
Response Summary CircRAB11FIP1 promoted autophagy flux of ovarian cancer through DSC1 and miR-129. CircRAB11FIP1 can serve as the possible marker for EOC diagnosis and treatment. CircRAB11FIP1 regulated the mechanism of autophagy through m6A modification and direct binding to mRNA. CircRAB11FIP1 bound to the mRNA of FTO and promoted its expression. CircRAB11FIP1 directly bound to miR-129 and regulated its targets ATG7 and Beclin 1-associated autophagy-related key regulator (ATG14). CircRAB11FIP1 bound to desmocollin 1to facilitate its interaction with ATG101. CircRAB11FIP1 mediated mRNA expression levels of ATG5 and ATG7 depending on m6A.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [70]
Responsed Disease Liver cancer [ICD-11: 2C12]
Target Regulation Up regulation
In-vitro Model
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
PLC/PRF/5 Adult hepatocellular carcinoma Homo sapiens CVCL_0485
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Li-7 Adult hepatocellular carcinoma Homo sapiens CVCL_3840
SNU-182 Adult hepatocellular carcinoma Homo sapiens CVCL_0090
HEK293T Normal Homo sapiens CVCL_0063
HCCLM3 Adult hepatocellular carcinoma Homo sapiens CVCL_6832
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
PLC/PRF/5 Adult hepatocellular carcinoma Homo sapiens CVCL_0485
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Li-7 Adult hepatocellular carcinoma Homo sapiens CVCL_3840
SNU-182 Adult hepatocellular carcinoma Homo sapiens CVCL_0090
HEK293T Normal Homo sapiens CVCL_0063
HCCLM3 Adult hepatocellular carcinoma Homo sapiens CVCL_6832
THLE-2 Normal Homo sapiens CVCL_3803
In-vivo Model For subcutaneous tumor models, 1.5 × 106 HUH7 cells (e.g., negative control, AC115619-overexpressing cells) in 50 μL PBS with 50 μL Matrigel were administered to male BALB/c nude mice (4-6 weeks of age) by subcutaneous injection and cell line-derived xenografts (CDX) were established.For lung metastasis models, luciferase-tagged lentivirus transfected into HUH7 cells (1 × 106/100 μL PBS) was injected into male BALB/c nude mice (4-6 weeks of age) via tail vein.
Casein kinase II subunit alpha' (CSNK2A2)
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [27]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Pathway Response Notch signaling pathway hsa04330
Cell Process Cell proliferation
Cell invasion
Cell apoptosis
In-vitro Model
HT-1197 Recurrent bladder carcinoma Homo sapiens CVCL_1291
HT-1376 Bladder carcinoma Homo sapiens CVCL_1292
In-vivo Model BALB/cnu/nu mice (4-5 weeks old) were used for the xenograft experiment. The mice were randomly divided into 2 groups (n = 6 for each group) and injected with 5 × 106 HT-1197 cells in control group or FTO plasmid group, respectively.
Response Summary In bladder cancer, the changes in m6A methylation level mainly appeared at 5' untranslated region (5' UTR) of MALAT1 and NOTCH1 transcripts, and at 3' UTR of Casein kinase II subunit alpha' (CSNK2A2) and ITGA6 transcripts, responding to the overexpression of FTO. SFPQ could influence the FTO-mediated m6A RNA demethylation, eventually affecting the gene expression.
Catenin beta-1 (CTNNB1/Beta-catenin)
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [71]
Responsed Disease Head and neck squamous carcinoma [ICD-11: 2B6E]
Target Regulation Up regulation
Pathway Response Adherens junction hsa04520
Cell Process Cell proliferation and migration
In-vitro Model
CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
FaDu Hypopharyngeal squamous cell carcinoma Homo sapiens CVCL_1218
Tu 686 Laryngeal squamous cell carcinoma Homo sapiens CVCL_4916
HN-6 Tongue squamous cell carcinoma Homo sapiens CVCL_8129
HEp-2 Endocervical adenocarcinoma Homo sapiens CVCL_1906
Response Summary FTO expression was significantly upregulated in HNSCC datasets and tissues. FTO expression was significantly correlated with Catenin beta-1 (CTNNB1/Beta-catenin) expression. Moreover, it exerted a tumorigenic effect by increasing CTNNB1 expression in an m6A-dependent manner.
Cervical intraepithelial neoplasia [ICD-11: 2E66]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [72]
Responsed Disease Cervical squamous cell carcinoma [ICD-11: 2E66.2]
Target Regulation Up regulation
Cell Process RNA decay
In-vitro Model
C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
In-vivo Model Either SiHa cells or FTO overexpressed SiHa cells were injected subcutaneously into the right flanks of 4- to 6-week-old female athymic nude mice (CAS, Beijing, China). The mice were divided into four groups (N = 6). After transplantation, tumor size was measured by caliper every other day. Tumor volume was calculated using the formula: volume = (length × width2)/2. When the tumor volumes reached 50 mm3, the animals were treated with intraperitoneal injection of cisplatin (3 mg/kg) every other day for seven times and local irradiation of 8 Gy one time.
Response Summary The mRNA level of FTO is elevated in cervical squamous cell carcinoma (CSCC) tissues when compared with respective adjacent normal tissues.FTO enhances the chemo-radiotherapy resistance both in vitro and in vivo through regulating expression of Catenin beta-1 (CTNNB1/Beta-catenin) by reducing m6A levels in its mRNA transcripts and in turn increases excision repair cross-complementation group 1 (ERCC1) activity.
Cellular tumor antigen p53 (TP53/p53)
Renal cell carcinoma [ICD-11: 2C90]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [73]
Responsed Disease Renal cell carcinoma [ICD-11: 2C90]
Responsed Drug Erianin Investigative
Target Regulation Up regulation
Acute kidney failure [ICD-11: GB60]
In total 2 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [74]
Responsed Disease Acute kidney failure [ICD-11: GB60]
Responsed Drug Cisplatin Approved
Target Regulation Down regulation
Pathway Response Apoptosis hsa04210
Cell Process Cell apoptosis
In-vitro Model
HK2 Normal Acipenser baerii CVCL_YE28
In-vivo Model Induced AKI in c57BL/6 mice by intraperitoneal cisplatin injection and treated the animal with vehicle or an FTO inhibitor meclofenamic acid (MA) for 3 days.
Response Summary Meclofenamic acid increased Cellular tumor antigen p53 (TP53/p53) mRNA and protein levels in AKI both in vitro and in vivo, and FTO overexpression reduced p53 expression and reversed the MA-induced p53 increase in cisplatin-induced acute kidney injury Acute kidney injury.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [74]
Responsed Disease Acute kidney failure [ICD-11: GB60]
Responsed Drug Meclofenamic acid Approved
Target Regulation Down regulation
Pathway Response Apoptosis hsa04210
Cell Process Cell apoptosis
In-vitro Model
HK2 Normal Acipenser baerii CVCL_YE28
In-vivo Model Induced AKI in c57BL/6 mice by intraperitoneal cisplatin injection and treated the animal with vehicle or an FTO inhibitor meclofenamic acid (MA) for 3 days.
Response Summary Meclofenamic acid increased Cellular tumor antigen p53 (TP53/p53) mRNA and protein levels in AKI both in vitro and in vivo, and FTO overexpression reduced p53 expression and reversed the MA-induced p53 increase in cisplatin-induced Acute kidney injury.
Chloride intracellular channel protein 4 (CLIC4)
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [75]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
In-vitro Model
RWPE-1 Normal Homo sapiens CVCL_3791
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
DU145 Prostate carcinoma Homo sapiens CVCL_0105
LNCaP C4-2 Prostate carcinoma Homo sapiens CVCL_4782
In-vivo Model Approximately 2×106 PCa cells (DU145 transfected with shFTO and shNC) were injected subcutaneously in mice. The tumor volume (V = (0.5*length*width2)) was measured with Vernier caliper every week. Ten mice were randomly divided into two groups, 2×106 cells transfected with shFTO and shNC were resuspended with 100 uL PBS and injected into the mouse tail vein to create a metastatic model. After 7 weeks, the mice were anesthetized, and D-luciferin (#D-Luciferin, Apexbio) was injected intraperitoneally, then used the IVIS imaging system (Caliper Life Sciences) to visualize the luciferase signal.
Response Summary FTO suppresses PCa proliferation and metastasis through reducing the degradation of Chloride intracellular channel protein 4 (CLIC4) mRNA in an m6A dependent manner.
Constitutive NOS (eNOS)
Diseases of the circulatory system [ICD-11: BE2Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [29]
Responsed Disease Vascular diseases [ICD-11: BE2Z]
Responsed Drug Atorvastatin Approved
Target Regulation Down regulation
In-vitro Model
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
HUVEC-C Normal Homo sapiens CVCL_2959
HEK293T Normal Homo sapiens CVCL_0063
Response Summary FTO overexpression significantly upregulated the mRNA and protein levels of VCAM-1 and ICAM-1, downregulated those of KLF2 and Constitutive NOS (eNOS), and strongly attenuated the atorvastatin-mediated induction of KLF2 and eNOS expression. FTO could serve as a novel molecular target to modulate endothelial function in vascular diseases.
Cyclin-dependent kinase 6 (CDK6)
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [78]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
5637 Bladder carcinoma Homo sapiens CVCL_0126
T24 Bladder carcinoma Homo sapiens CVCL_0554
UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
In-vivo Model Approximately 1 × 107 stably transfected T24 cells were subcutaneously injected into BALB/c nude mice. The length (L) and width (W) of the tumours were measured weekly using callipers, while their volume was calculated using the equation: V = (L × W2)/2. After 4 weeks of injections, the mice were euthanised, and the tumour tissues were removed and weighed.
Response Summary FTO promoted bladder cancer cell proliferation, migration and invasion via the FTO/miR-576/Cyclin-dependent kinase 6 (CDK6) pathways in an m6A-dependent manner.
Cytochrome P450 2C8 (CYP2C8)
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [79]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Down regulation
Pathway Response Drug metabolism - cytochrome P450 hsa00982
Cell Process Drug-metabolizing
In-vitro Model
HepaRG Hepatitis C infection Homo sapiens CVCL_9720
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Response Summary In the Hepatocellular carcinoma cells YTHDC2 promotes CYP2C8 mRNA degradation via recognizing the m6A in CYP2C8 mRNA, which is installed by METTL3/14 and removed by FTO.
Desmocollin-1 (DSC1)
Malignant mixed epithelial mesenchymal tumour [ICD-11: 2B5D]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [63]
Responsed Disease Malignant mixed epithelial mesenchymal tumour of ovary [ICD-11: 2B5D.0]
Pathway Response Autophagy hsa04140
Cell Process Cell autophagy
In-vitro Model
SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
In-vivo Model The SKOV3 ovarian cancer cell line was transfected with LV2-1 or LV2-NC. Thereafter, BALB/c nude mice (6-week old) were intraperitoneally injected with SKOV3 cells. The mice were killed after 5 weeks, and the number of ascites was determined.
Response Summary CircRAB11FIP1 promoted autophagy flux of ovarian cancer through Desmocollin-1 (DSC1) and miR-129. CircRAB11FIP1 can serve as the possible marker for EOC diagnosis and treatment. CircRAB11FIP1 regulated the mechanism of autophagy through m6A modification and direct binding to mRNA. CircRAB11FIP1 bound to the mRNA of FTO and promoted its expression. CircRAB11FIP1 directly bound to miR-129 and regulated its targets ATG7 and ATG14. CircRAB11FIP1 bound to desmocollin 1to facilitate its interaction with ATG101. CircRAB11FIP1 mediated mRNA expression levels of ATG5 and ATG7 depending on m6A.
DNA excision repair protein ERCC-1 (ERCC1)
Cervical intraepithelial neoplasia [ICD-11: 2E66]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [72]
Responsed Disease Cervical squamous cell carcinoma [ICD-11: 2E66.2]
Target Regulation Up regulation
Cell Process RNA decay
In-vitro Model
C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
In-vivo Model Either SiHa cells or FTO overexpressed SiHa cells were injected subcutaneously into the right flanks of 4- to 6-week-old female athymic nude mice (CAS, Beijing, China). The mice were divided into four groups (N = 6). After transplantation, tumor size was measured by caliper every other day. Tumor volume was calculated using the formula: volume = (length × width2)/2. When the tumor volumes reached 50 mm3, the animals were treated with intraperitoneal injection of cisplatin (3 mg/kg) every other day for seven times and local irradiation of 8 Gy one time.
Response Summary The mRNA level of FTO is elevated in cervical squamous cell carcinoma (CSCC) tissues when compared with respective adjacent normal tissues.FTO enhances the chemo-radiotherapy resistance both in vitro and in vivo through regulating expression of beta-catenin by reducing m6A levels in its mRNA transcripts and in turn increases DNA excision repair protein ERCC-1 (ERCC1) activity.
DNA polymerase kappa (Pol Kappa/POLK)
Exposure to radiation [ICD-11: PH73]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [80]
Responsed Disease Exposure to radiation [ICD-11: PH73]
Target Regulation Up regulation
Cell Process DNA repair
Nucleotide excision repair (hsa03420)
In-vitro Model
A-375 Amelanotic melanoma Homo sapiens CVCL_0132
U2OS Osteosarcoma Homo sapiens CVCL_0042
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
MEF (Mouse embryonic fibroblasts)
U2OS Osteosarcoma Homo sapiens CVCL_0042
Response Summary Methylation at the 6 position of adenosine (m6A) in RNA is rapidly (within 2 min) and transiently induced at DNA damage sites in response to ultraviolet irradiation. This modification occurs on numerous poly(A)+ transcripts and is regulated by the methyltransferase METTL3 and the demethylase FTO. DNA DNA polymerase kappa (Pol Kappa/POLK), which has been implicated in both nucleotide excision repair and trans-lesion synthesis, required the catalytic activity of METTL3 for immediate localization to ultraviolet-induced DNA damage sites.
E3 ubiquitin-protein ligase NEDD4-like (NEDD4L)
Solid tumour/cancer [ICD-11: 2A00-2F9Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [54]
Responsed Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Pathway Response Autophagy hsa04140
Cell Process Cellular Processes
Transport and catabolism
Cell autophagy
In-vitro Model
HaCaT Normal Homo sapiens CVCL_0038
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
MEF (Mouse embryonic fibroblasts)
In-vivo Model As cells (5 million) in Matrigel or As-T (1 million) cells in PBS with or without gene manipulations were injected subcutaneously into the right flanks of female mice (6-8 weeks of age). For treatment with CS1 or CS2, As-T cells (1 million) in PBS were injected subcutaneously into the right flanks of 6-week-old female nude mice.
Response Summary FTO deletion inhibited arsenic-induced tumorigenesis. Epidermis-specific FTO deletion prevented skin tumorigenesis induced by arsenic and UVB irradiation. E3 ubiquitin-protein ligase NEDD4-like (NEDD4L) was identified as the m6A-modified gene target of FTO. Arsenic stabilizes FTO protein through inhibiting p62-mediated selective autophagy. FTO-mediated dysregulation of mRNA m6A methylation as an epitranscriptomic mechanism to promote arsenic tumorigenicity. Arsenic suppresses p62 expression by downregulating the NF-kappaB pathway to upregulate FTO.
Human skin lesions [ICD-11: ME60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [54]
Responsed Disease Human skin lesions [ICD-11: ME60]
Pathway Response Autophagy hsa04140
Cell Process Cellular Processes
Transport and catabolism
Cell autophagy
In-vitro Model
HaCaT Normal Homo sapiens CVCL_0038
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
MEF (Mouse embryonic fibroblasts)
In-vivo Model As cells (5 million) in Matrigel or As-T (1 million) cells in PBS with or without gene manipulations were injected subcutaneously into the right flanks of female mice (6-8 weeks of age). For treatment with CS1 or CS2, As-T cells (1 million) in PBS were injected subcutaneously into the right flanks of 6-week-old female nude mice.
Response Summary FTO deletion inhibited arsenic-induced tumorigenesis. Epidermis-specific FTO deletion prevented skin tumorigenesis induced by arsenic and UVB irradiation. E3 ubiquitin-protein ligase NEDD4-like (NEDD4L) was identified as the m6A-modified gene target of FTO. Arsenic stabilizes FTO protein through inhibiting p62-mediated selective autophagy. FTO-mediated dysregulation of mRNA m6A methylation as an epitranscriptomic mechanism to promote arsenic tumorigenicity. Arsenic suppresses p62 expression by downregulating the NF-kappaB pathway to upregulate FTO.
Estradiol 17-beta-dehydrogenase 11 (HSD17B11)
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [81]
Responsed Disease Esophageal cancer [ICD-11: 2B70]
Target Regulation Up regulation
Cell Process Lipid metabolism
In-vitro Model
TE-1 Esophageal squamous cell carcinoma Homo sapiens CVCL_1759
KYSE-510 Esophageal squamous cell carcinoma Homo sapiens CVCL_1354
In-vivo Model Nude mice were randomly divided into five groups of six mice each, and the mice in each group were received subcutaneous injections of shFTO, scrambled shNC, FTO OE, and vector KYSE510 cells (5×106 tumor cells/mouse), respectively. The tumor size and weight of mice were measured 1 week later, which was recorded as day 0, and then measured once every other day; and the tumor volumes were calculated using the following formula: (length×width2)/2.When the tumor maximum diameter was close to 15 mm, the mice were euthanized and the tumor tissues were collected for immunohistochemistry analysis.
Response Summary FTO relys on the reading protein YTHDF1 to affect the translation pathway of the Estradiol 17-beta-dehydrogenase 11 (HSD17B11) gene to regulate the formation of lipid droplets in esophageal cancer cells.
Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1)
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [82]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Responsed Drug Rapamycin Approved
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cell autophagy
Response Summary Rapamycin inhibited FTO activity, and directly targeted Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1) transcripts and mediated their expression in an m6A-dependent manner in oral squamous cell carcinoma. After FTO silencing, YTHDF2 captured eIF4G1 transcripts containing m6A, resulting in mRNA degradation and decreased expression of eIF4G1 protein, thereby promoting autophagy and reducing tumor occurrence.
Fatty acid synthase (FASN)
Solid tumour/cancer [ICD-11: 2A00-2F9Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [83]
Responsed Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Target Regulation Down regulation
Cell Process Deficiency of lipid accumulation
Cellular apoptosis
In-vitro Model
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary FTO regulates hepatic lipogenesis via FTO-dependent m6A demethylation in Fatty acid synthase (FASN) mRNA and indicate the critical role of FTO-mediated lipid metabolism in the survival of HepG2 cells. This study provides novel insights into a unique RNA epigenetic mechanism by which FTO mediates hepatic lipid accumulation through m6 A modification and indicates that FTO could be a potential target for obesity-related diseases and cancer.
Diabetes [ICD-11: 5A10-5A14]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Diabetes [ICD-11: 5A10-5A14]
Pathway Response Metabolic pathways hsa01100
Fatty acid metabolism hsa01212
Cell Process Lipid metabolism
In-vitro Model
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary Glucose Is Involved in the Dynamic Regulation of m6A in Patients With Type 2 Diabetes.high-glucose stimulation enhances FTO expression, which leads to decreased m6A, and the lower m6A induces methyltransferase upregulation; FTO then triggers the mRNA expression of FOXO1, Fatty acid synthase (FASN), G6PC, and DGAT2, and these four genes were correlated with glucose and lipid metabolism.
Obesity [ICD-11: 5B81]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [83]
Responsed Disease Obesity [ICD-11: 5B81]
Target Regulation Down regulation
Cell Process Deficiency of lipid accumulation
Cellular apoptosis
In-vitro Model
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary FTO regulates hepatic lipogenesis via FTO-dependent m6A demethylation in Fatty acid synthase (FASN) mRNA and indicate the critical role of FTO-mediated lipid metabolism in the survival of HepG2 cells. This study provides novel insights into a unique RNA epigenetic mechanism by which FTO mediates hepatic lipid accumulation through m6 A modification and indicates that FTO could be a potential target for obesity-related diseases and cancer.
Flotillin-2 (FLOT2)
Ovarian dysfunction [ICD-11: 5A80]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [84]
Responsed Disease Polycystic ovary syndrome [ICD-11: 5A80.1]
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model
KGN Ovarian granulosa cell tumor Homo sapiens CVCL_0375
Response Summary FTO induced the dysfunctions of GCs by upregulating Flotillin-2 (FLOT2), suggesting that FTO/FLOT2 plays a role in the pathophysiology of polycystic ovarian syndrome.
Forkhead box protein O1 (FOXO1)
Diabetes [ICD-11: 5A10-5A14]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Diabetes [ICD-11: 5A10-5A14]
Cell Process Lipid metabolism
In-vitro Model
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary Glucose Is Involved in the Dynamic Regulation of m6A in Patients with Type 2 Diabetes. High-glucose stimulation enhances FTO expression, which leads to decreased m6A, and the lower m6A induces methyltransferase upregulation; FTO then triggers the mRNA expression of Forkhead box protein O1 (FOXO1), FASN, G6PC, and DGAT2, and these four genes were correlated with glucose and lipid metabolism.
Forkhead box protein O3 (FOXO3)
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [85]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Responsed Drug Cytarabine Approved
Target Regulation Down regulation
In-vitro Model
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
HL-60 Adult acute myeloid leukemia Homo sapiens CVCL_0002
In-vivo Model Cg-Prkdcscid Il2rgtm1Vst/Vst (NPG) mice (6 weeks old) were divided into three groups and implanted with 4 × 106 cells of control (MV4-11 NC) or FTO-knockdown (MV4-11 KD-1 or KD-2) by tail vein injection, respectively.
Glioblastoma multiforme [ICD-11: XH0MB1]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [86]
Responsed Disease Glioblastoma multiforme [ICD-11: XH0MB1]
Target Regulation Up regulation
Glucose transporter type 1 (GLUT1)
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [88]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
In-vivo Model Male BALB/c nude mice (aged 4-6 weeks; n = 5/group) were obtained from Vital River Laboratory Animal Technology (Beijing, China). MHCC97H or Huh7 cells (2 × 106 cells/mouse) stably transfected with lentivirus containing different plasmids in 100 μL DMEM were subcutaneously or orthotopically implanted into the nude mice.
Glucose-6-phosphatase catalytic subunit 1 (G6PC/G6PC1)
Diabetes [ICD-11: 5A10-5A14]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Diabetes [ICD-11: 5A10-5A14]
Pathway Response Metabolic pathways hsa01100
Glycolysis / Gluconeogenesis hsa00010
Cell Process Lipid metabolism
In-vitro Model
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary Glucose Is Involved in the Dynamic Regulation of m6A in Patients With Type 2 Diabetes.high-glucose stimulation enhances FTO expression, which leads to decreased m6A, and the lower m6A induces methyltransferase upregulation; FTO then triggers the mRNA expression of FOXO1, FASN, Glucose-6-phosphatase catalytic subunit 1 (G6PC/G6PC1), and DGAT2, and these four genes were correlated with glucose and lipid metabolism.
Glucose-6-phosphate dehydrogenase (G6PD)
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [89]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Glutathione metabolism hsa00480
In-vitro Model
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model For CDX model, nude mice (female, 4-6-week-old) were subcutaneously injected with 5 × 106 HCT116 cells on the both flank. For PDX model, the patient tumors were divided into small pieces and then inoculated on both flank of nude mice. For knockdown FTO mice model, FTO mice model, two weeks after inoculation, the shFTO#3 lenti-virus injected into the tumor for three consecutive days. For combined medication mice model, intraperitoneal injection of Rhein and Olaparib was started one week after inoculation.
Response Summary Targeting FTO significantly suppresses cancer cell growth and enhances chemotherapy sensitivity, which not only mediating the balance of intracellular ROS by regulating Glucose-6-phosphate dehydrogenase (G6PD) expression, but also maintaining genome instability by regulating PARP1 expression. These findings shed light on new molecular mechanisms of CRC development and treatments mediated by m6A modification.
Hexokinase-2 (HK2)
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [90]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
In-vitro Model
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
In-vivo Model For the mouse xenograft model, 2 × 106 cells were injected subcutaneously into the flank regions of female BALB/c nude mice (4-5 weeks).
Histone-lysine N-methyltransferase EHMT2 (G9a)
Pain disorders [ICD-11: 8E43]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [91]
Responsed Disease Neuropathic Pain [ICD-11: 8E43.0]
Target Regulation Up regulation
In-vitro Model
PC12 Rat adrenal gland pheochromocytoma Rattus norvegicus CVCL_0481
In-vivo Model After the animal was anesthetized with isoflurane, a midline incision in the lower lumbar back region was made and the lumbar articular process was exposed and then removed. The exposed DRG was injected with viral solution (1-1.5 ul in rats and 0.5-1 ul in mice) through a glass micropipette connected to a Hamilton syringe. The pipette was retained for 10 min after injection. Animals showing signs of paresis or other abnormalities were excluded. The injected DRGs were stained with hematoxylin/eosin to examine the integrity of their structure and whether they contained visible leukocytes.
Response Summary FTO contributes to neuropathic pain through stabilizing nerve injury-induced upregulation of Histone-lysine N-methyltransferase EHMT2 (G9a), a neuropathic pain initiator, in primary sensory neurons.
Homeobox protein Hox-B13 (HOXB13)
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [92]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Down regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
mTOR signaling pathway hsa04150
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
SNU-5 Gastric adenocarcinoma Homo sapiens CVCL_0078
NCI-N87 Gastric tubular adenocarcinoma Homo sapiens CVCL_1603
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
GES-1 Normal Homo sapiens CVCL_EQ22
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
In-vivo Model Male nu/nu mice between 4 and 6 weeks of age received subcutaneous injections of equivalent AGS cells expressing either control or LV-HOXB13 within 30 min of harvesting on the right and left flanks.
Response Summary FTO suppresses Homeobox protein Hox-B13 (HOXB13) methytlation; FTO and HOXB13 expression promotes GC cell proliferation, migration, and invasion. HOXB13 expression intensifies GC invasion through PI3K/AKT/mTOR signaling via IGF-1R.
Endometrial cancer [ICD-11: 2C76]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [93]
Responsed Disease Endometrial cancer [ICD-11: 2C76]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model
KLE Endometrial adenocarcinoma Homo sapiens CVCL_1329
AN3-CA Endometrial adenocarcinoma Homo sapiens CVCL_0028
In-vivo Model Female SCID-Beige mice (6 weeks old) were purchased from Vitalriver. AN3CA cells with FTO overexpression or silencing or the appropriate controls (1 × 106) were injected into the lower abdominal cavity of mice (n = 5 mice/group). After 4 weeks, the mice were sacrificed, and tumours were harvested, weighed and photographed.
Response Summary This study found high expression of FTO in metastatic endometrial cancer and that this action promote both metastasis and invasion in vivo and in vitro. Mechanistically, FTO can catalyse demethylation modification in 3'UTR region of Homeobox protein Hox-B13 (HOXB13) mRNA, thereby abolishing m6A modification recognition with the YTHDF2 protein.
Interleukin enhancer-binding factor 3 (ILF3)
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [94]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Target Regulation Up regulation
In-vitro Model
GBM1 Glioblastoma Homo sapiens CVCL_DG57
GBM2 Glioblastoma Homo sapiens CVCL_DG58
GBM3 Glioblastoma Homo sapiens CVCL_DG59
Response Summary Loss of m6A RNA methylation and increased translation in human glioblastoma cells as well as a role for miRNAs in the modulation of m6A RNA demethylation in genes that are most efficiently translated during glioma stem cells differentiation. Ectopic expression of the RRACH-binding miR-145 induces loss of m6A, formation of FTO/AGO1/Interleukin enhancer-binding factor 3 (ILF3)/miR-145 complexes on a clinically relevant tumor suppressor gene (CLIP3) and significant increase in its nascent translation.
Isocitrate dehydrogenase [NADP] cytoplasmic (IDH/IDH1)
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [95]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation Down regulation
Cell Process Glutamine metabolism
In-vitro Model
HEK293T Normal Homo sapiens CVCL_0063
Response Summary 1) Isocitrate dehydrogenase [NADP] cytoplasmic (IDH/IDH1) mutant cells, likely via a D2-HG-mediated competitive inhibition of the Alpha-KG-dependent RNA demethylase FTO, display significantly elevated RNA methylation; 2) Deregulated RNA methylation should be considered part of the pathogenesis of IDH-mutant tumors, which alongside with the well-characterized DNA and histone disturbances defines a "hypermethylation triad"; 3) the effects of FTO expression on AML pathogenesis need to be interpreted in the context of IDH1/2 mutation since in this setting FTO activity is probably low, irrespective of its expression level.
Mammalian target of rapamycin complex 1 (mTORC1)
Gastric cancer [ICD-11: 2B72]
In total 3 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Responsed Drug Cisplatin Approved
Target Regulation Down regulation
Pathway Response mTOR signaling pathway hsa04150
Cell Process Cell apoptosis
In-vitro Model
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
Response Summary Omeprazole pretreatment could enhance the inhibitory effect of 5-Fu, DDP and TAX on gastric cancer cells. FTO inhibition induced by omeprazole enhanced the activation of Mammalian target of rapamycin complex 1 (mTORC1) signal pathway that inhibited the prosurvival autophagy so as to improve the antitumor efficiency of chemotherapeutic drugs on GC cells. Meanwhile, transcript level of DDIT3, which is an apoptosis-related tumor suppressor gene downstream of mTORC1, was regulated by omeprazole-induced FTO silence through an m6A-dependent mechanism. m6A modification and its eraser FTO plays a role in the improvement of chemosensitivity mediated by proton pump inhibitor omeprazole.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Responsed Drug Fluorouracil Approved
Target Regulation Down regulation
Pathway Response mTOR signaling pathway hsa04150
Cell Process Cell apoptosis
In-vitro Model
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
Response Summary Omeprazole pretreatment could enhance the inhibitory effect of 5-Fu, DDP and TAX on gastric cancer cells. FTO inhibition induced by omeprazole enhanced the activation of Mammalian target of rapamycin complex 1 (mTORC1) signal pathway that inhibited the prosurvival autophagy so as to improve the antitumor efficiency of chemotherapeutic drugs on GC cells. Meanwhile, transcript level of DDIT3, which is an apoptosis-related tumor suppressor gene downstream of mTORC1, was regulated by omeprazole-induced FTO silence through an m6A-dependent mechanism. m6A modification and its eraser FTO plays a role in the improvement of chemosensitivity mediated by proton pump inhibitor omeprazole.
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Responsed Drug Paclitaxel Approved
Target Regulation Down regulation
Pathway Response mTOR signaling pathway hsa04150
Cell Process Cell apoptosis
In-vitro Model
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
Response Summary Omeprazole pretreatment could enhance the inhibitory effect of 5-Fu, DDP and TAX on gastric cancer cells. FTO inhibition induced by omeprazole enhanced the activation of Mammalian target of rapamycin complex 1 (mTORC1) signal pathway that inhibited the prosurvival autophagy so as to improve the antitumor efficiency of chemotherapeutic drugs on GC cells. Meanwhile, transcript level of DDIT3, which is an apoptosis-related tumor suppressor gene downstream of mTORC1, was regulated by omeprazole-induced FTO silence through an m6A-dependent mechanism. m6A modification and its eraser FTO plays a role in the improvement of chemosensitivity mediated by proton pump inhibitor omeprazole.
Human breast ductal carcinoma in situ [ICD-11: 2E65]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [96]
Responsed Disease Human breast ductal carcinoma in situ [ICD-11: 2E65.2]
Metastasis-associated protein MTA1 (MTA1)
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [97]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
Pathway Response mRNA surveillance pathway hsa03015
RNA degradation hsa03018
Cell Process RNA stability
In-vitro Model
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
RKO Colon carcinoma Homo sapiens CVCL_0504
LS174T Colon adenocarcinoma Homo sapiens CVCL_1384
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
HCT 15 Colon adenocarcinoma Homo sapiens CVCL_0292
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
CW-2 Colon adenocarcinoma Homo sapiens CVCL_1151
In-vivo Model FTO-overexpressing and control cells (2 × 106 suspended in 100 ul PBS) were subcutaneously injected into each mouse.
Response Summary FTO inhibited CRC metastasis both in vitro and in vivo. FTO exerted a tumor suppressive role by inhibiting Metastasis-associated protein MTA1 (MTA1) expression in an m6A-dependent manner. Methylated MTA1 transcripts were recognized by an m6A "reader", insulin-like growth factor 2 mRNA binding protein 2 (IGF2BP2), which then stabilized its mRNA.
Mutated in multiple advanced cancers 1 (PTEN)
Hypoxic-ischemic brain damage [ICD-11: 8B24]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [98]
Responsed Disease Hypoxic-ischemic brain damage [ICD-11: 8B24]
Target Regulation Down regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
mTOR signaling pathway hsa04150
Nuclear factor erythroid 2-related factor 2 (NFE2L2)
Epilepsy due to structural or metabolic conditions or diseases [ICD-11: 8A60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [105]
Responsed Disease Epilepsy due to structural or metabolic conditions or diseases [ICD-11: 8A60.5]
Target Regulation Up regulation
Acute ischemic stroke [ICD-11: 8B11]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [106]
Responsed Disease Acute ischemic stroke [ICD-11: 8B11]
Target Regulation Up regulation
In-vitro Model
SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
In-vivo Model Cerebral I/R injury was induced by MCAO/R surgery following previous method [10]. Rats were anesthetized by intraperitoneal injection of 2% sodium pentobarbital. After cutting the cervical skin of the rats with surgical scissors, the internal, external and common carotid arteries were separated. Then the proximal ends of the external and the common carotid arteries were ligated and the distal internal carotid artery was clipped. After cutting an incision 1 cm away from the bifurcation of the internal carotid artery with a surgical scissors, the left common carotid artery was slowly inserted into the internal carotid artery of the rats with sutures coated with silicone (head diameter 0.36±0.02 mm, Beijing Sunbio Biotech Co., Ltd., China) until sutures reached the bifurcation of the middle cerebral artery, and the wound was sutured after the sutures were fixed. After blocking blood flow for 1 h, the plug was removed to restore blood flow and reperfusion was performed. Other rats were selected for the Sham group, and the operation procedure was the same as above except for no ligation and insertion.
DOX-induced cardiotoxicity [ICD-11: BA00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [108]
Responsed Disease DOX-induced cardiotoxicity [ICD-11: BA00.Z]
Target Regulation Up regulation
In-vitro Model
H9c2(2-1) Normal Rattus norvegicus CVCL_0286
Reproductive System disorders [ICD-11: SM9Z-SN0Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [109]
Responsed Disease Reproductive System disorders [ICD-11: SM9Z-SN0Z]
Target Regulation Down regulation
In-vitro Model
TM3 Normal Mus musculus CVCL_4326
Male reproductive disorders [ICD-11: VV5Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [110]
Responsed Disease Male reproductive disorders [ICD-11: VV5Z]
Target Regulation Up regulation
Cell Process Oxidative stress
Cell apoptosis
In-vivo Model Exposed Sprague-Dawley rats to 0, 250, and 500 mg DEHP per kg body weight per day at the prepuberty stage from postnatal day 22 (PND 22) to PND 35 by oral gavage.
Response Summary DEHP worsened testicular histology, decreased testosterone concentrations, downregulated expression of spermatogenesis inducers, enhanced oxidative stress, inhibited the Nuclear factor erythroid 2-related factor 2 (NFE2L2)-mediated antioxidant pathway, and increased apoptosis in testes. DEHP is a common environmental endocrine disrupting chemical that induces male reproductive disorders. Additionally, DEHP increased global levels of m6A RNA modification and altered the expression of two important RNA methylation modulator genes, FTO and YTHDC2.
Peroxisome proliferator-activated receptor alpha (PPARalpha/PPARA)
Urinary/pelvic organs injury [ICD-11: NB92]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [111]
Responsed Disease Renal ischemia-reperfusion injury [ICD-11: NB92.0Y]
In-vitro Model
HK2 Normal Acipenser baerii CVCL_YE28
Poly [ADP-ribose] polymerase 1 (PARP1)
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [89]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Glutathione metabolism hsa00480
In-vitro Model
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model For CDX model, nude mice (female, 4-6-week-old) were subcutaneously injected with 5 × 106 HCT116 cells on the both flank. For PDX model, the patient tumors were divided into small pieces and then inoculated on both flank of nude mice. For knockdown FTO mice model, FTO mice model, two weeks after inoculation, the shFTO#3 lenti-virus injected into the tumor for three consecutive days. For combined medication mice model, intraperitoneal injection of Rhein and Olaparib was started one week after inoculation.
Response Summary Targeting FTO significantly suppresses cancer cell growth and enhances chemotherapy sensitivity, which not only mediating the balance of intracellular ROS by regulating G6PD expression, but also maintaining genome instability by regulating Poly [ADP-ribose] polymerase 1 (PARP1) expression. These findings shed light on new molecular mechanisms of CRC development and treatments mediated by m6A modification.
Programmed cell death 1 (PD-1)
Melanoma [ICD-11: 2C30]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Melanoma [ICD-11: 2C30]
Responsed Drug PMID31239444-anti-PD1 antibody Investigative
Target Regulation Up regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Cell Process mRNA decay
In-vitro Model
B16-F10 Mouse melanoma Mus musculus CVCL_0159
CHL-1 Melanoma Homo sapiens CVCL_1122
624-mel Melanoma Homo sapiens CVCL_8054
NHEM (Normal Human Epidermal Melanocytes)
SK-MEL-30 Cutaneous melanoma Homo sapiens CVCL_0039
WM115 Melanoma Homo sapiens CVCL_0040
WM35 Melanoma Homo sapiens CVCL_0580
WM3670 Melanoma Homo sapiens CVCL_6799
WM793 Melanoma Homo sapiens CVCL_8787
In-vivo Model When the tumors reached a volume of 80-100 mm3, mice were treated with anti-PD-1 or isotype control antibody (200 ug/mouse) by i.p. injection, every other day for three times. For IFNγ blockade treatment, C57BL/6 mice were treated with anti-IFNγ antibody or isotype control IgG (250 ug/mouse) every other day after tumor cell inoculation.
Response Summary These findings demonstrate a crucial role of FTO as an m6A demethylase in promoting melanoma tumorigenesis and anti-PD-1 resistance, and suggest that the combination of FTO inhibition with anti-PD-1 blockade reduces the resistance to immunotherapy in melanoma. Knockdown of FTO increases m6A methylation in the critical protumorigenic melanoma cell-intrinsic genes including Programmed cell death 1 (PD-1) (PDCD1), CXCR4, and SOX10, leading to increased RNA decay through the m6A reader YTHDF2.
Protein argonaute-1 (AGO1)
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [94]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Target Regulation Up regulation
In-vitro Model
GBM1 Glioblastoma Homo sapiens CVCL_DG57
GBM2 Glioblastoma Homo sapiens CVCL_DG58
GBM3 Glioblastoma Homo sapiens CVCL_DG59
Response Summary Loss of m6A RNA methylation and increased translation in human glioblastoma cells as well as a role for miRNAs in the modulation of m6A RNA demethylation in genes that are most efficiently translated during glioma stem cells differentiation. Ectopic expression of the RRACH-binding miR-145 induces loss of m6A, formation of FTO/Protein argonaute-1 (AGO1)/ILF3/miR-145 complexes on a clinically relevant tumor suppressor gene (CLIP3) and significant increase in its nascent translation.
Protein CBFA2T1 (RUNX1T1)
Obesity [ICD-11: 5B81]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [112]
Responsed Disease Obesity [ICD-11: 5B81]
Target Regulation Down regulation
Cell Process Adipogenesis
Spliceosome (hsa03040)
In-vitro Model
3T3-L1 Normal Mus musculus CVCL_0123
Response Summary FTO-dependent m6A demethylation functions as a novel regulatory mechanism of RNA processing and plays a critical role in the regulation of adipogenesis and obesity. FTO-dependent regulatory role of m6A and SRSF2 in mRNA splicing and adipocyte differentiation. FTO controls exonic splicing of adipogenic regulatory factor Protein CBFA2T1 (RUNX1T1) by regulating m6A levels around splice sites and thereby modulates differentiation.
Protein kinase C-binding protein NELL2 (NELL2)
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [113]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Up regulation
Cell Process Cell viability
Cell migration
Cell invasion
In-vitro Model
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
NCI-H23 Lung adenocarcinoma Homo sapiens CVCL_1547
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
16HBE14o- Normal Homo sapiens CVCL_0112
In-vivo Model The nude mice were maintained under pathogen-free conditions and kept under timed lighting conditions mandated by the committee with food and water provided ad libitum. For xenograft experiments, nude mice were injected subcutaneously with 5 × 106 cells resuspended in 0.1 mL PBS. When a tumor was palpable, it was measured every 3 days.
Response Summary FTO upregulated the expression of E2F1 by inhibiting the m6A modification of E2F1. The FTO/E2F1/Protein kinase C-binding protein NELL2 (NELL2) axis modulated NSCLC cell viability, migration, and invasion in vitro as well as affected NSCLC tumor growth and metastasis in vivo.
Receptor tyrosine-protein kinase erbB-2 (ERBB2)
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [114]
Responsed Disease Esophageal squamous cell carcinoma [ICD-11: 2B70.1]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
KYSE-450 Esophageal squamous cell carcinoma Homo sapiens CVCL_1353
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
KYSE-180 Esophageal squamous cell carcinoma Homo sapiens CVCL_1349
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
KYSE-140 Esophageal squamous cell carcinoma Homo sapiens CVCL_1347
In-vivo Model For the subcutaneous transplantation model, sh-control, sh-FTO, NC-OE and ERBB2-OE KYSE150 stable cells (6 × 106 per mouse, n = 3 for each group) were diluted to 100 uL PBS + 100 uL Matrigel (BD) and subcutaneously injected to two points in the middle and upper groin of immunodeficient mice to study tumor growth. When the tumor volume reached ~ 1000 mm3 in each group, the nude mice were killed, and the tumors were excised and weighed for histology and further study. The tumor volume was calculated by the formula V = 1/2 × large diameter × (small diameter)2. For a model of lung metastasis in vivo, nude mice were injected with 100 uL WT (wide type), sh-FTO, ERBB2-OE and sh-FTO+ERBB2-OE KYSE150 stable cells (1 × 106 cells per mouse, n = 3 for each group) through tail vein, respectively. Six weeks after injection, the mice were killed and analyzed for metastatic lung tumors.
Response Summary Knockdown of FTO drastically suppressed the proliferation, migration, and invasion of ESCC cells,and Receptor tyrosine-protein kinase erbB-2 (ERBB2) is the target of FTO, which acts in concert in ESCC tumorigenesis and metastasis.
Retinoic acid receptor alpha (RARA)
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Responsed Drug Tretinoin Approved
Target Regulation Down regulation
Cell Process RNA stability
RNA degradation (hsa03018)
In-vitro Model
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KOCL-48 Childhood acute monocytic leukemia Homo sapiens CVCL_6867
Mono-Mac-6 Adult acute monocytic leukemia Homo sapiens CVCL_1426
Response Summary FTO enhances leukemic oncogene-mediated cell transformation and leukemogenesis, and inhibits all-trans-retinoic acid (ATRA)-induced AML cell differentiation, through regulating expression of targets such as ASB2 and Retinoic acid receptor alpha (RARA) by reducing m6A levels in these mRNA transcripts.
RNA cytosine C(5)-methyltransferase NSUN2 (NSUN2)
Rheumatoid arthritis [ICD-11: FA20]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [115]
Responsed Disease Rheumatoid arthritis [ICD-11: FA20]
Serine-protein kinase ATM (ATM)
Parkinson disease [ICD-11: 8A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [118]
Responsed Disease Parkinson disease [ICD-11: 8A00]
Target Regulation Up regulation
In-vitro Model
MN9D
N.A. Mus musculus CVCL_M067
In-vivo Model Male C57BL/6 mice were intraperitoneally injected with MPTP hydrochloride (30 mg/kg/day, Sigma, USA) for 5 consecutive days. Control mice were injected with equal volume of 0.9% saline. 3 days after the last injection of MPTP, behavioral tests were performed.
Serine/threonine-protein kinase mTOR (MTOR)
Colorectal cancer [ICD-11: 2B91]
In total 6 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Asparagine inhibitor Approved
Pathway Response mTOR signaling pathway hsa04150
Autophagy hsa04140
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. ATF4 transcriptionally upregulated DDIT4 to suppress Serine/threonine-protein kinase mTOR (MTOR), which induced pro-survival autophagy during glutaminolysis inhibition.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Chloroquine Approved
Pathway Response mTOR signaling pathway hsa04150
Autophagy hsa04140
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. ATF4 transcriptionally upregulated DDIT4 to suppress Serine/threonine-protein kinase mTOR (MTOR), which induced pro-survival autophagy during glutaminolysis inhibition.
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Meclofenamate sodium Approved
Pathway Response mTOR signaling pathway hsa04150
Autophagy hsa04140
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. Serine/threonine-protein kinase mTOR (MTOR) transcriptionally upregulated DDIT4 to suppress mTOR, which induced pro-survival autophagy during glutaminolysis inhibition.
Experiment 4 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Rapamycin Approved
Pathway Response mTOR signaling pathway hsa04150
Autophagy hsa04140
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. Serine/threonine-protein kinase mTOR (MTOR) transcriptionally upregulated DDIT4 to suppress mTOR, which induced pro-survival autophagy during glutaminolysis inhibition.
Experiment 5 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug CB-839 Phase 2
Pathway Response mTOR signaling pathway hsa04150
Autophagy hsa04140
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. Serine/threonine-protein kinase mTOR (MTOR) transcriptionally upregulated DDIT4 to suppress mTOR, which induced pro-survival autophagy during glutaminolysis inhibition.
Experiment 6 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug GLS-IN-968 Investigative
Pathway Response mTOR signaling pathway hsa04150
Autophagy hsa04140
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. ATF4 transcriptionally upregulated DDIT4 to suppress Serine/threonine-protein kinase mTOR (MTOR), which induced pro-survival autophagy during glutaminolysis inhibition.
Signal transducer and activator of transcription 3 (STAT3)
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [119]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Doxil Approved
In-vitro Model
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Hs 578T Invasive breast carcinoma Homo sapiens CVCL_0332
Response Summary Decreased doxorubicin resistance by Signal transducer and activator of transcription 3 (STAT3) knockdown was abolished by FTO overexpression and decreased doxorubicin sensitivity by STAT3 overexpression was reversed by FTO knockdown, indicating that FTO was implicated in STAT3-mediated doxorubicin resistance and impairment of doxorubicin sensitivity of BC cells.
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [120]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
In-vitro Model
T24 Bladder carcinoma Homo sapiens CVCL_0554
UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
Splicing factor, proline- and glutamine-rich (SFPQ)
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [27]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Pathway Response Notch signaling pathway hsa04330
Cell Process Cell proliferation
Cell invasion
Cell apoptosis
In-vitro Model
HT-1197 Recurrent bladder carcinoma Homo sapiens CVCL_1291
HT-1376 Bladder carcinoma Homo sapiens CVCL_1292
In-vivo Model BALB/cnu/nu mice (4-5 weeks old) were used for the xenograft experiment. The mice were randomly divided into 2 groups (n = 6 for each group) and injected with 5 × 106 HT-1197 cells in control group or FTO plasmid group, respectively.
Response Summary In bladder cancer, the changes in m6A methylation level mainly appeared at 5' untranslated region (5' UTR) of MALAT1 and NOTCH1 transcripts, and at 3' UTR of CSNK2A2 and ITGA6 transcripts, responding to the overexpression of FTO. Splicing factor, proline- and glutamine-rich (SFPQ) could influence the FTO-mediated m6A RNA demethylation, eventually affecting the gene expression.
SRSF protein kinase 2 (SRPK2)
Obesity [ICD-11: 5B81]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [112]
Responsed Disease Obesity [ICD-11: 5B81]
Target Regulation Down regulation
Pathway Response Spliceosome hsa03040
Cell Process Adipogenesis
In-vitro Model
3T3-L1 Normal Mus musculus CVCL_0123
Response Summary FTO-dependent m6A demethylation functions as a novel regulatory mechanism of RNA processing and plays a critical role in the regulation of adipogenesis and obesity. FTO-dependent regulatory role of m6A and SRSF protein kinase 2 (SRPK2) in mRNA splicing and adipocyte differentiation. FTO controls exonic splicing of adipogenic regulatory factor RUNX1T1 by regulating m6A levels around splice sites and thereby modulates differentiation.
Suppressor of cytokine signaling 1 (SOCS1)
Chronic kidney disease [ICD-11: GB61]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [122]
Responsed Disease Chronic kidney disease [ICD-11: GB61.Z]
Target Regulation Up regulation
Pathway Response JAK-STAT signaling pathway hsa04630
In-vitro Model
HEK293T Normal Homo sapiens CVCL_0063
hMC Normal Homo sapiens CVCL_9Q61
HK-2 [Human kidney] Normal Homo sapiens CVCL_0302
In-vivo Model FTO over-expression db/db mice were generated through injecting the tail vein with Fto-overexpression lentivirus at 12 weeks.
Response Summary Mechanistically, the FTO/Suppressor of cytokine signaling 1 (SOCS1)/JAK-STAT axis promotes diabetic kidney disease(DKD) pathogenesis via promoting inflammation. Moreover, FTO expression is significantly decreased in DKD, and overexpression of FTO can dramatically alleviate kidney inflammation.
Suppressor of cytokine signaling 2 (SOCS2)
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [70]
Responsed Disease Liver cancer [ICD-11: 2C12]
Target Regulation Up regulation
In-vitro Model
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
PLC/PRF/5 Adult hepatocellular carcinoma Homo sapiens CVCL_0485
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Li-7 Adult hepatocellular carcinoma Homo sapiens CVCL_3840
SNU-182 Adult hepatocellular carcinoma Homo sapiens CVCL_0090
HEK293T Normal Homo sapiens CVCL_0063
HCCLM3 Adult hepatocellular carcinoma Homo sapiens CVCL_6832
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
PLC/PRF/5 Adult hepatocellular carcinoma Homo sapiens CVCL_0485
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Li-7 Adult hepatocellular carcinoma Homo sapiens CVCL_3840
SNU-182 Adult hepatocellular carcinoma Homo sapiens CVCL_0090
HEK293T Normal Homo sapiens CVCL_0063
HCCLM3 Adult hepatocellular carcinoma Homo sapiens CVCL_6832
THLE-2 Normal Homo sapiens CVCL_3803
In-vivo Model For subcutaneous tumor models, 1.5 × 106 HUH7 cells (e.g., negative control, AC115619-overexpressing cells) in 50 μL PBS with 50 μL Matrigel were administered to male BALB/c nude mice (4-6 weeks of age) by subcutaneous injection and cell line-derived xenografts (CDX) were established.For lung metastasis models, luciferase-tagged lentivirus transfected into HUH7 cells (1 × 106/100 μL PBS) was injected into male BALB/c nude mice (4-6 weeks of age) via tail vein.
Suppressor of cytokine signaling 3 (SOCS3)
Ossification of spinal ligaments [ICD-11: FA83]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [123]
Responsed Disease Ossification of spinal ligaments [ICD-11: FA83]
Target Regulation Down regulation
Transcription factor E2F1 (E2F1)
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [37]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Pathway Response p53 signaling pathway hsa04115
Central carbon metabolism in cancer hsa05230
PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Response Summary This study revealed that m6A methylation is closely related to the poor prognosis of non-small cell lung cancer patients via interference with the TIME, which suggests that m6A plays a role in optimizing individualized immunotherapy management and improving prognosis. The expression levels of METTL3, FTO and YTHDF1 in non-small cell lung cancer were changed. Patients in Cluster 1 had lower immunoscores, higher programmed death-ligand 1 (PD-L1) expression, and shorter overall survival compared to patients in Cluster 2. The hallmarks of the Myelocytomatosis viral oncogene (MYC) targets, Transcription factor E2F1 (E2F1) targets were significantly enriched.
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [38]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Up regulation
Cell Process Cell proliferation and migration
In-vitro Model
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
Response Summary FTO interacts with transcripts of Transcription factor E2F1 (E2F1) and Myc, inhibition of FTO significantly impairs the translation efficiency of E2F1 and Myc.FTO plays important oncogenic role in regulating cervical cancer cells' proliferation.
Transferrin receptor protein 1 (TFRC)
Vascular disorders of the liver [ICD-11: DB98]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [124]
Responsed Disease Vascular disorders of the liver [ICD-11: DB98.B]
Ubiquitin carboxyl-terminal hydrolase 7 (USP7)
Lung cancer [ICD-11: 2C25]
In total 2 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [125]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug P22077 Investigative
Target Regulation Up regulation
Cell Process Ubiquitination degradation
In-vitro Model
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H522 Lung adenocarcinoma Homo sapiens CVCL_1567
HSAEC (Human small airway epithelial cells)
RERF-LC-A1 Lung squamous cell carcinoma Homo sapiens CVCL_4402
NCI-H1882 Lung small cell carcinoma Homo sapiens CVCL_1504
NCl-H466 (Human lung cancer cell line)
In-vivo Model Equal numbers of A549 cells expressing either control or shFTO were injected subcutaneously, within 30 min of harvesting, over the right and left flanks in male nu/nu mice between 4 and 6 weeks of age.
Response Summary The m6A demethylase FTO promotes the growth of Non-small cell lung cancer cells by increasing the expression of USP7.Genetic knockdown or pharmacological inhibition (P5091 or P22027) of Ubiquitin carboxyl-terminal hydrolase 7 (USP7) reduced the proliferation rate of lung cancer cells and decreased the capacity of colony formation of lung cancer cells in vitro, whereas lung cancer cells growth inhibition by FTO knockdown is restored by overexertion of USP7.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [125]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug P5091 Investigative
Target Regulation Up regulation
Cell Process Ubiquitination degradation
In-vitro Model
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H522 Lung adenocarcinoma Homo sapiens CVCL_1567
HSAEC (Human small airway epithelial cells)
RERF-LC-A1 Lung squamous cell carcinoma Homo sapiens CVCL_4402
NCI-H1882 Lung small cell carcinoma Homo sapiens CVCL_1504
NCl-H466 (Human lung cancer cell line)
In-vivo Model Equal numbers of A549 cells expressing either control or shFTO were injected subcutaneously, within 30 min of harvesting, over the right and left flanks in male nu/nu mice between 4 and 6 weeks of age.
Response Summary The m6A demethylase FTO promotes the growth of Non-small cell lung cancer cells by increasing the expression of USP7.Genetic knockdown or pharmacological inhibition (P5091 or P22027) of Ubiquitin carboxyl-terminal hydrolase 7 (USP7) reduced the proliferation rate of lung cancer cells and decreased the capacity of colony formation of lung cancer cells in vitro, whereas lung cancer cells growth inhibition by FTO knockdown is restored by overexertion of USP7.
Ubiquitin-like protein ATG12 (ATG12)
Diabetes [ICD-11: 5A10-5A14]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [67]
Responsed Disease Diabetes [ICD-11: 5A10-5A14]
Responsed Drug Dac51 Investigative
In-vitro Model
MIN6 Mouse insulinoma Mus musculus CVCL_0431
Zinc finger E-box-binding homeobox 1 (ZEB1)
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [126]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
In-vitro Model
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
HL-60 Adult acute myeloid leukemia Homo sapiens CVCL_0002
In-vivo Model A total of 1 × 106 luciferase-labeled tumor cells were injected subcutaneously with SN-exo or Ctr-exo.
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [104]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Up regulation
In-vitro Model
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
C-4-II Human papillomavirus-related cervical squamous cell carcinoma Homo sapiens CVCL_1095
HT3
N.A. Mus musculus CVCL_A8FA
In-vivo Model Four-six-week-old male BALB/c nude mice were supplied by Vital River Laboratory Animal Technology Company (Beijing, China) and fed in a specific pathogen-free environment with a temperature of 25°C and a humidity of 60%. 2 × 106 Hela cells stably transfected with pSilencer vector or pSilencer/FTO were inoculated subcutaneously into the flanks of the nude mice. After 7 days, the width and length measurement of tumors was performed every 2 days. Nude mice were killed at 28 days after cell inoculation and then tumor tissues were weighed.
Zinc finger protein SNAI1 (SNAI1)
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [127]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Up regulation
In-vitro Model
Capan-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0026
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
PaTu 8988t Pancreatic adenocarcinoma Homo sapiens CVCL_1847
AsPC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
In-vivo Model Logarithmic phase PDAC cells (4 × 106/100 μl) were infected using lentiviruses possessing constructs. Then, the nude mice (n = 5 per group) were inoculated into the dorsal flank subcutaneously.
Deleted in lymphocytic leukemia 2 (DLEU2/LINC00022)
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [16]
Responsed Disease Esophageal squamous cell carcinoma [ICD-11: 2B70.1]
Target Regulation Down regulation
Pathway Response Cell cycle hsa04110
Ubiquitin mediated proteolysis hsa04120
Cell Process Ubiquitination degradation
Cell apoptosis
Decreased G0/G1 phase
In-vitro Model
HET-1A Normal Homo sapiens CVCL_3702
KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
KYSE-450 Esophageal squamous cell carcinoma Homo sapiens CVCL_1353
KYSE-70 Esophageal squamous cell carcinoma Homo sapiens CVCL_1356
TE-1 Esophageal squamous cell carcinoma Homo sapiens CVCL_1759
In-vivo Model The number of cells inoculated in each mouse was 4 × 106, 1 × 106, 2 × 106 and 1 × 106, respectively.
Response Summary The elevated FTO in esophageal squamous cell carcinoma decreased m6A methylation of Deleted in lymphocytic leukemia 2 (DLEU2/LINC00022) transcript, leading to the inhibition of LINC00022 decay via the m6A reader YTHDF2.
Growth arrest specific 5 (GAS5)
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [128]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation Down regulation
In-vitro Model
BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H322 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1556
NCI-H650 Lung adenocarcinoma Homo sapiens CVCL_1575
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H358 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1559
NCI-H838 Lung adenocarcinoma Homo sapiens CVCL_1594
NCI-H23 Lung adenocarcinoma Homo sapiens CVCL_1547
In-vivo Model Animal experiments were approved by the Hainan Affiliated Hospital of Hainan Medical University. Male BALB/c mice (Vital River, Beijing, China) were subcutaneously injected with H322 cells (1 × 106) transfected with ov-NC, ov-FTO, ov-GAS5 or ov-FTO + ov-GAS5 (n = 5/group). Tumor volume was measured every 7 days, and mice were sacrificed and the tumor tissues were removed for weighting and analyzing after 35 days. Also, tumor tissues were prepared into paraffin sections to carry out Ki67 immunohistochemistry (IHC) staining using SP Kit (Solarbio, Beijing, China) and TUNEL staining using Colorimetric TUNEL Apoptosis Assay Kit (Beyotime) basing on kit instructions.
HOXC13 antisense RNA (HOXC13-AS)
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [129]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Cell proliferation
Cell invasion
Epithelial-mesenchymal transition
In-vitro Model
C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
C-4-I Cervical squamous cell carcinoma Homo sapiens CVCL_2253
Ect1/E6E7 Normal Homo sapiens CVCL_3679
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
Response Summary FTO-stabilized HOXC13 antisense RNA (HOXC13-AS) epigenetically up-regulated FZD6 and activated Wnt/beta-catenin signaling to drive cervical cancer proliferation, invasion, and EMT, suggesting HOXC13-AS as a potential target for cervical cancer treatment.
Maternally expressed 3 (MEG3)
Acute ischemic stroke [ICD-11: 8B11]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [130]
Responsed Disease Acute ischemic stroke [ICD-11: 8B11]
Abortion [ICD-11: JA00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [131]
Responsed Disease Abortion [ICD-11: JA00.0]
In-vivo Model Sexually mature ICR mice, aged at least 10 weeks, were paired as one female and one male per cage to obtain pregnancies. The time of the vaginal plug sighting was denoted as day 0.5 of the pregnancy. The mice were divided into an FTO protein group and control group, with 10 pairs of mice in each group. Starting on day 0.5 of the pregnancy, mice in the FTO protein group were intraperitoneally injected daily with FTO protein (3.5 ng/kg), whereas those in the control group had daily intraperitoneal injections of equal volumes of saline. Female mice were euthanised on day 13.5 of the pregnancy (day 12.5-14.5), and the total numbers of normal and resorbed embryos were determined, along with the rate of embryo resorption.
Myosin heavy chain associated RNA transcript (MHRT)
Congestive heart failure [ICD-11: BD10]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [132]
Responsed Disease Congestive heart failure [ICD-11: BD10]
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model
Mouse myocardial cell line (Isolated from heart tissue)
In-vivo Model The mice were housed under standardized conditions and received normal diet. The mice were randomly divided into 5 groups (n = 6/each group): (1) Control group: normal mice served as control; (2) TAC-HF group: mice were subjected to transverse aortic constriction (TAC) to establish HF mouse model; (3) Sham group: sham-operated mice were subjected the same surgery without the placement of a ligature; (4) Doxorubicin-HF group: mice were intraperitoneally injected with doxorubicin to construct HF mouse model; and (5) PBS: mice were intraperitoneally injected with equal PBS as control.
Response Summary FTO overexpression inhibits H/R-indcued apoptosis in myocardial cells by regulating m6A modification of Myosin heavy chain associated RNA transcript (MHRT). FTO is a target gene for heart failure treatment.
Pvt1 oncogene (PVT1)
Kidney failure [ICD-11: GB6Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [66]
Responsed Disease Kidney failure [ICD-11: GB6Z]
Target Regulation Up regulation
In-vitro Model
NIT-1 Insulin tumor Mus musculus CVCL_3561
Response Summary m6A modification is co-regulated by METTL3 and FTO in cadmium-treated cells. LncRNA-MALAT1, Pvt1 oncogene (PVT1) and m6A modification could be key nodes for cadmium-induced oxidative damage, and highlight their importance as promising preventive and therapeutic targets in cadmium toxicity.
microRNA 145 (MIR145)
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [94]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Target Regulation Up regulation
In-vitro Model
GBM1 Glioblastoma Homo sapiens CVCL_DG57
GBM2 Glioblastoma Homo sapiens CVCL_DG58
GBM3 Glioblastoma Homo sapiens CVCL_DG59
Response Summary Loss of m6A RNA methylation and increased translation in human glioblastoma cells as well as a role for miRNAs in the modulation of m6A RNA demethylation in genes that are most efficiently translated during glioma stem cells differentiation. Ectopic expression of the RRACH-binding miR-145 induces loss of m6A, formation of FTO/AGO1/ILF3/microRNA 145 (MIR145) complexes on a clinically relevant tumor suppressor gene (CLIP3) and significant increase in its nascent translation.
microRNA 155 (MIR155)
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [133]
Responsed Disease Glioma [ICD-11: 2A00.0]
Responsed Drug Temozolomide Approved
In-vitro Model
A-172 Glioblastoma Homo sapiens CVCL_0131
HEK293T Normal Homo sapiens CVCL_0063
U251 (Fibroblasts or fibroblast like cells)
U87 (A primary glioblastoma cell line)
In-vivo Model Previously prepared U87 cells (5 × 106 cells, 60 uL) stably infected with miRNA were injected subcutaneously in the right flank of the mice, whereas control U87 cells infected with empty vector were injected in the left flank.
Response Summary FTO Inhibition Enhances the Antitumor Effect of Temozolomide by Targeting MYC-microRNA 155 (MIR155)/miR-23a Cluster-MXI1 Feedback Circuit in Glioma.
Traumatic brain injury induced by controlled cortical impact injury [ICD-11: NA07]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [134]
Responsed Disease Traumatic brain injury induced by controlled cortical impact injury [ICD-11: NA07]
Target Regulation Down regulation
microRNA 23a (MIR23A)
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [133]
Responsed Disease Glioma [ICD-11: 2A00.0]
Responsed Drug Temozolomide Approved
In-vitro Model
A-172 Glioblastoma Homo sapiens CVCL_0131
HEK293T Normal Homo sapiens CVCL_0063
U251 (Fibroblasts or fibroblast like cells)
U87 (A primary glioblastoma cell line)
In-vivo Model Previously prepared U87 cells (5 × 106 cells, 60 uL) stably infected with miRNA were injected subcutaneously in the right flank of the mice, whereas control U87 cells infected with empty vector were injected in the left flank.
Response Summary FTO Inhibition Enhances the Antitumor Effect of Temozolomide by Targeting MYC-miR-155/microRNA 23a (MIR23A) Cluster-MXI1 Feedback Circuit in Glioma.
microRNA 576 (MIR576)
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [78]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell migration
Cell invasion
In-vitro Model
5637 Bladder carcinoma Homo sapiens CVCL_0126
T24 Bladder carcinoma Homo sapiens CVCL_0554
UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
In-vivo Model Approximately 1 × 107 stably transfected T24 cells were subcutaneously injected into BALB/c nude mice. The length (L) and width (W) of the tumours were measured weekly using callipers, while their volume was calculated using the equation: V = (L × W2)/2. After 4 weeks of injections, the mice were euthanised, and the tumour tissues were removed and weighed.
Response Summary FTO promoted bladder cancer cell proliferation, migration and invasion via the FTO/microRNA 576 (MIR576)/CDK6 pathways in an m6A-dependent manner.
hsa-miR-129-5p
Malignant mixed epithelial mesenchymal tumour [ICD-11: 2B5D]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [63]
Responsed Disease Malignant mixed epithelial mesenchymal tumour of ovary [ICD-11: 2B5D.0]
Pathway Response Autophagy hsa04140
Cell Process Cell autophagy
In-vitro Model
SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
In-vivo Model The SKOV3 ovarian cancer cell line was transfected with LV2-1 or LV2-NC. Thereafter, BALB/c nude mice (6-week old) were intraperitoneally injected with SKOV3 cells. The mice were killed after 5 weeks, and the number of ascites was determined.
Response Summary CircRAB11FIP1 promoted autophagy flux of ovarian cancer through DSC1 and hsa-miR-129-5p. CircRAB11FIP1 can serve as the possible marker for EOC diagnosis and treatment. CircRAB11FIP1 regulated the mechanism of autophagy through m6A modification and direct binding to mRNA. CircRAB11FIP1 bound to the mRNA of FTO and promoted its expression. CircRAB11FIP1 directly bound to miR-129 and regulated its targets ATG7 and ATG14. CircRAB11FIP1 bound to desmocollin 1to facilitate its interaction with ATG101. CircRAB11FIP1 mediated mRNA expression levels of ATG5 and ATG7 depending on m6A.
hsa-miR-181b-3p
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Down regulation
Cell Process Cell invasion and migration
In-vitro Model
T-47D Invasive breast carcinoma Homo sapiens CVCL_0553
SK-BR-3 Breast adenocarcinoma Homo sapiens CVCL_0033
MDA-MB-453 Breast adenocarcinoma Homo sapiens CVCL_0418
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MCF-10A Normal Homo sapiens CVCL_0598
BT-549 Invasive breast carcinoma Homo sapiens CVCL_1092
BT-474 Invasive breast carcinoma Homo sapiens CVCL_0179
Response Summary FTO up-regulated ARL5B by inhibiting hsa-miR-181b-3p. The carcinogenic activity of FTO in promoting the invasion and migration of breast cancer cells via the FTO/miR-181b-3p/ARL5B signaling pathway.
hsa-miR-5581-3p
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [135]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Cell Process Cell migration
cell proliferation
In-vitro Model
UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
T24 Bladder carcinoma Homo sapiens CVCL_0554
SV-HUC-1 Normal Homo sapiens CVCL_3798
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model Four-week-old male BALB/c nude mice were used for animal experiments. UM-UC3 cells (2×106 cells per mouse) stably overexpressing miR-5581-3p and NC were injected into the mice to establish the subcutaneous implantation model. Tumor size was measured by a caliper every week, and tumor volume was calculated by the formula: V = (width2×length×0.52). As for the tumor metastasis model, UM-UC3 cells (1×106 cells per mouse) were injected into each mouse via the tail vein. The subcutaneous implantation model used 8 nude mice, whereas the tumor metastasis model used 10 nude mice. Assessment of tumor size and observation of metastasis tumors were done via intraperitoneal inoculation with 15mg/mL, XenoLight D-luciferin Potassium Salt (100 uL; PerkinElmer) with the IVIS Spectrum animal imaging Platform (PerkinElmer) in every mouse. Eventually, mice were sacrificed for tumors and metastases.
Response Summary FTO proved as an N6-methyladenosine (m6A) demethylase in decreasing m6A modification was confirmed to regulate the migration and proliferation in Bca, overexpressing hsa-miR-5581-3p partially rescued the effects of the overexpressing SMAD3 and FTO in BCa cells.
hsa_circ_0005630 (circ_RAB11FIP1)
Malignant mixed epithelial mesenchymal tumour [ICD-11: 2B5D]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [63]
Responsed Disease Malignant mixed epithelial mesenchymal tumour of ovary [ICD-11: 2B5D.0]
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cell autophagy
In-vitro Model
SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
In-vivo Model The SKOV3 ovarian cancer cell line was transfected with LV2-1 or LV2-NC. Thereafter, BALB/c nude mice (6-week old) were intraperitoneally injected with SKOV3 cells. The mice were killed after 5 weeks, and the number of ascites was determined.
Response Summary hsa_circ_0005630 (circRAB11FIP1) promoted autophagy flux of ovarian cancer through DSC1 and miR-129. CircRAB11FIP1 can serve as the possible marker for EOC diagnosis and treatment. CircRAB11FIP1 regulated the mechanism of autophagy through m6A modification and direct binding to mRNA. CircRAB11FIP1 bound to the mRNA of FTO and promoted its expression. CircRAB11FIP1 directly bound to miR-129 and regulated its targets ATG7 and ATG14. CircRAB11FIP1 bound to desmocollin 1to facilitate its interaction with ATG101. CircRAB11FIP1 mediated mRNA expression levels of ATG5 and ATG7 depending on m6A.
A disintegrin and metalloproteinase with thrombospondin motifs 15 (ADAMTS15)
Rheumatoid arthritis [ICD-11: FA20]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [136]
Responsed Disease Rheumatoid arthritis [ICD-11: FA20]
In-vivo Model Male Wistar rats were injected at approximately 1.5 cm distal to the base of the tail with emulsion consisting of collagen (2 mg/ml, Chondrex, USA) and complete Freund's adjuvant(CFA) (5 mg/ml, Chondrex, USA) (at the ratio of 1:1) in a volume of 200 μl per rat. 7 days later, a booster immunization was performed by injecting the same concentration of emulsion as the first immunization in a volume of 100 μl per rat. Subsequently, twice intra-articular injection of adenovirus (Control vector or shFTO, 2 × 108 PFU, 50 μl) (Genechem, Shanghai, China) were prescribed to rats at 8 and 15 days after the primary immunization. Arthritis progression was monitored every three days according to the previously described scoring system ranging from 0 to 4 (0, normal; 1, swelling or redness of paw or a single digit; 2, 2 joints involved; 3, 3 joints involved; 4, severe arthritis of the entire paw and digits). The arthritic score was independently calculated in a blinded manner and defined as the average score of hind paws.
A disintegrin and metalloproteinase with thrombospondin motifs 2 (ADAMTS2)
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [137]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Up regulation
In-vitro Model
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
AC008440.5 (AC008)
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [138]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Target Regulation Down regulation
In-vitro Model
Chondrocytes (Chondrocytes were isolated from human cartilage and cultured)
Response Summary FTO-mediated N6-methyladenosine demethylation downregulated AC008440.5 (AC008) transcription, while lower FTO expression led to upregulation of AC008 transcription in OA.
Apoptosis regulatory protein Siva (SIVA1)
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [139]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Fluorouracil Approved
Target Regulation Up regulation
In-vitro Model
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HEK293T Normal Homo sapiens CVCL_0063
MC-38 Mouse colon adenocarcinoma Mus musculus CVCL_B288
In-vivo Model For the tumor metastasis mouse model, 5-week-old C57BL/6 mice were randomly grouped and injected with 5 × 105 Control or shFTO stable MC38 cells via tail vein. Drug administration was adopted after 48 h. Drug administration (intraperitoneally): DMSO, 5-FU (50 mg/kg every 2 days) or Rhein (10 mg/kg every 2 days). To detect lung metastasis, mice were killed 2 weeks after tumor cell injection. Lung tissues were harvested and fixed with 4% PFA for paraffin-embedded section and lung metastases were detected with Nikon microscopy. For tumor intraperitoneal mouse model, 2 × 106 Dox-shCtrl, Dox-shFTO stable HCT8/5-FU cells were injected into 5-week-old male BALB/C nude mice. Drug administration was adopted after 48 h. Drug administration (intraperitoneally): DMSO, 5-FU (50 mg/kg every 2 days) or FB23-2 (10 mg/kg every 2 days). For tumor intraperitoneal mouse model, 5 × 105 shCtrl, shFTO-1, shFTO-2 stable MC38 cells were injected into 5-week-old C57BL/6 mice. Drug administration was adopted after 48 h. Drug administration (intraperitoneally): DMSO, 5-FU (50 mg/kg every 2 days) or Rhein (10 mg/kg every 2 days).
Autophagy-related protein 9A (ATG9A)
Diabetes [ICD-11: 5A10-5A14]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [67]
Responsed Disease Diabetes [ICD-11: 5A10-5A14]
Responsed Drug Dac51 Investigative
In-vitro Model
MIN6 Mouse insulinoma Mus musculus CVCL_0431
BDNF/NT-3 growth factors receptor (NTRK2)
Single episode depressive disorder, severe, without psychotic symptoms [ICD-11: 6A70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [140]
Responsed Disease Major depressive disorder [ICD-11: 6A70.3]
In-vitro Model
SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
In-vivo Model Rats were housed at 23°C and 55% humidity and were given ad libitum food and water. During acclimatization (1 week), rats were placed randomly (3/cage); however, after initial behavioral testing, they were grouped according to their behavioral phenotypes. All experiments were performed under a light cycle (8:00 AM and 10:00 AM). The protocol to induce LH behavior was approved by the Institutional Animal Care and Use Committee of the University of Alabama at Birmingham. The animal study also adhered to the international guidelines for the use and care of laboratory animals.
Beta-1 adrenergic receptor (ADRB1)
Obesity [ICD-11: 5B81]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [141]
Responsed Disease Obesity [ICD-11: 5B81]
Target Regulation Up regulation
cAMP-dependent protein kinase catalytic subunit gamma (PRKACG)
Macular disorders [ICD-11: 9B75]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [142]
Responsed Disease Macular disorders [ICD-11: 9B75.0]
Target Regulation Down regulation
CAP-Gly domain-containing linker protein 3 (CLIP3)
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [94]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Target Regulation Up regulation
Cell Process Cell differentiation
Carbohydrate-responsive element-binding protein (MLXIPL)
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [121]
Responsed Disease Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation Up regulation
In-vitro Model
Hepa 1-6 Hepatocellular carcinoma of the mouse Mus musculus CVCL_0327
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model Overexpression of FTO in the liver of 8-week-old mice was achieved by tail vein injection of adenoviral FTO (Ad-FTO) or control adenovirus (Ad-Ctrl) (5 × 107 pfu/g). Two weeks after injection, mice were sacrificed and tissues were collected. HFD-fed mice were also injected with Ad-FTO or Ad-Ctrl (5 × 107 pfu/g). After 3 weeks, mice were sacrificed and tissue samples were collected.
CD40 ligand (CD40L)
Immune-related diseases [ICD-11: 4B4Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [143]
Responsed Disease Immune-related diseases [ICD-11: 4B4Z]
Target Regulation Up regulation
Circ_GPR137B
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [144]
Responsed Disease Liver cancer [ICD-11: 2C12]
Target Regulation Up regulation
In-vitro Model
L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
HuH-6 Hepatoblastoma Homo sapiens CVCL_4381
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
SK-HEP-1 Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
In-vivo Model The mice were subcutaneously inoculated with 6 × 107 HepG2 cells stably transfected with pLV-circGPR137B and empty vectors or Sk-hep-1 cells stably transfected with pLV-sh-circGPR137B/sh-NC. HepG2 cells stably transfected with circGPR137B or pcDNA3.1 were cultured in complete medium. When the cells were 70% confluent, the medium was replaced with fresh medium to remove dead and detached cells. Subsequently, 6 × 107 cells were used to inject into mice via the tail vein. Each mouse was injected with 100ul (6× 106 cells).
Circ_SETD2
Pre-eclampsia [ICD-11: JA24]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [145]
Responsed Disease Pre-eclampsia [ICD-11: JA24]
Target Regulation Down regulation
In-vivo Model Pregnant rats were randomly assigned to 5 groups: normal pregnancy (normal) group, PE group, circSETD2 overexpression (PE + oe-circSETD2) group, METTL3 overexpression (PE + oe-METTL3) group, overexpression control (PE + oe-NC) group, joint treatment (PE + oe-METTL3 + si-circSETD2) group, and joint treatment control (PE + oe-METTL3 + si-NC) group, with 6 rats in each group. After continuous injection of L-NAME for 4 days, the rats in the overexpression and overexpression control groups were further injected with 30 μl lentivirus vector oe-circSETD2, oe-METTL3 or oe-NC solution (GenePharma, Shanghai, China) through the tail vein; after continuous injection of L-NAME for 4 days, the rats in the PE + oe-METTL3 + si-circSETD2 group were further injected with 30 μl lentiviral vector oe-circSETD2 and si-circSETD2 (GenePharma) at the virus titer of 5 × 107 PFU/mL. The rats were euthanized on the 16th day of pregnancy. Then, the chorionic trophoblast tissues were isolated from the placenta of pregnant rats and divided into 2 parts, with 1 part for extraction and detection of tissue RNA, and the other part fixed in the buffer containing 10% formalin, embedded in paraffin, and made into 5 μm sections.
Collagen alpha-1 (COL12A1)
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [137]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Up regulation
In-vitro Model
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
Collagen alpha-1 (COL1A1)
Keloid [ICD-11: EE60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [146]
Responsed Disease Keloid [ICD-11: EE60.0]
Target Regulation Up regulation
Cyclic AMP-responsive element-binding protein 1 (CREB1)
Single episode depressive disorder, severe, without psychotic symptoms [ICD-11: 6A70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [140]
Responsed Disease Major depressive disorder [ICD-11: 6A70.3]
In-vitro Model
SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
In-vivo Model Rats were housed at 23°C and 55% humidity and were given ad libitum food and water. During acclimatization (1 week), rats were placed randomly (3/cage); however, after initial behavioral testing, they were grouped according to their behavioral phenotypes. All experiments were performed under a light cycle (8:00 AM and 10:00 AM). The protocol to induce LH behavior was approved by the Institutional Animal Care and Use Committee of the University of Alabama at Birmingham. The animal study also adhered to the international guidelines for the use and care of laboratory animals.
Cyclic GMP-AMP synthase (CGAS)
Traumatic brain injury induced by controlled cortical impact injury [ICD-11: NA07]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [147]
Responsed Disease Traumatic brain injury induced by controlled cortical impact injury [ICD-11: NA07]
Target Regulation Down regulation
Pathway Response NF-kappa B signaling pathway hsa04064
In-vivo Model Briefly, mice were anesthetized, and the right common carotid artery (CCA) and external and internal carotid arteries were surgically exposed through a neck incision. Then, a filament was introduced into the CCA and advanced into the internal carotid artery until the tip reached the origin of the middle cerebral artery (MCA). Occlusion of the right MCA was induced either transiently for 60 min followed by a reperfusion period of different hours. Sham-operated mice received the same experimental surgery without a filament being inserted into the MCA. For experiments, mice were randomly divided into Sham groups (n = 6), MCAO/R-1 day (n = 6), MCAO/R-3 day (n = 6), and MCAO/R-5 day (n = 6). To investigate the effect of m6A modification on the MCAO/R injury in vivo, thirty-six mice were divided into four groups, including Sham group (n = 12), DMSO group (n = 12), Cycloleucine (Cyc) group (n = 6), and S-Adenosyl-L-homocysteine (SAH) group (n = 6). Cyc, a specific inhibitor of S-adenosyl-methionine mediated methylation (50 mM/kg, MedChemExpress), and SAH (50 mg/kg, Selleck), another m6A specific inhibitor which specifically inhibits the METTL3-METTL14 heterodimer complex, or DMSO (as control) were intraperitoneally injected into the mice for consecutive 3 days before MCAO injury. Three days after MCAO/R injury, the mice brains were collected for the following experiments.
Dickkopf-related protein 2 (DKK2)
Cardiomyopathy [ICD-11: BC43]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [148]
Responsed Disease Myocardial Fibrosis [ICD-11: BC43.20]
Target Regulation Up regulation
In-vivo Model He AMI model was induced by permanent ligation of the left coronary artery anterior descending with a 7-0 surgical suture as previously described , and then miR-636 antagomir (10 mg/kg; RiboBio) was injected through the tail vein of mice or the nanoparticles with DKK2 plasmids were administered intraperitoneally in a volume of 200 μL into AMI mice.
Dynamin-1-like protein (DRP1)
Acute ischemic stroke [ICD-11: 8B11]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [149]
Responsed Disease Acute ischemic stroke [ICD-11: 8B11]
Target Regulation Down regulation
In-vitro Model
Neuro-2a Mouse neuroblastoma Mus musculus CVCL_0470
Neuro-2a Mouse neuroblastoma Mus musculus CVCL_0470
E3 ubiquitin-protein ligase NEDD4 (NEDD4)
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [150]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Responsed Drug Gemcitabine Approved
In-vitro Model
Human Pancreatic Nestin-Expressing cells (Human Pancreatic Nestin-Expressing cells)
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
COLO 357 Pancreatic adenosquamous carcinoma Homo sapiens CVCL_0221
In-vivo Model Female athymic BALB/C nude mice received a subcutaneous injection of 5 × 106 cells into the axilla (4 weeks old, 18-20 g). The tumor volume (V) was calculated each week using the formula V = (W2 L)/2 after measuring the tumor width (W) and length (L). After the injection of cancer cells, for the gemcitabine treatment cohort, mice were injected with gemcitabine (120 mg/kg, Sigma-Aldrich) intraperitoneally and weekly according to previous studies .
Estrogen receptor (ESR1)
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [151]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
F-box only protein 32 (FBXO32)
Certain specified disorders of muscle [ICD-11: FB32]
In total 2 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [152]
Responsed Disease Certain specified disorders of muscle [ICD-11: FB32.Y]
Responsed Drug 3-deazidenosine Investigative
Target Regulation Down regulation
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [152]
Responsed Disease Certain specified disorders of muscle [ICD-11: FB32.Y]
Responsed Drug R-2HG Investigative
Target Regulation Down regulation
Ferritin heavy chain (FTH1)
Macular disorders [ICD-11: 9B75]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [153]
Responsed Disease Macular disorders [ICD-11: 9B75.04]
Ferroptosis suppressor protein 1 (AIFM2)
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [154]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
Forkhead box protein O6 (FOXO6)
Chronic glomerulonephritis [ICD-11: GB40]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [155]
Responsed Disease Chronic glomerulonephritis [ICD-11: GB40]
Target Regulation Down regulation
Glucocorticoid receptor (NR3C1)
Single episode depressive disorder, severe, without psychotic symptoms [ICD-11: 6A70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [140]
Responsed Disease Major depressive disorder [ICD-11: 6A70.3]
In-vitro Model
SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
In-vivo Model Rats were housed at 23°C and 55% humidity and were given ad libitum food and water. During acclimatization (1 week), rats were placed randomly (3/cage); however, after initial behavioral testing, they were grouped according to their behavioral phenotypes. All experiments were performed under a light cycle (8:00 AM and 10:00 AM). The protocol to induce LH behavior was approved by the Institutional Animal Care and Use Committee of the University of Alabama at Birmingham. The animal study also adhered to the international guidelines for the use and care of laboratory animals.
Glypican-4 (GPC4)
Uveitis [ICD-11: 9A96]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [156]
Responsed Disease Uveitis [ICD-11: 9A96]
Responsed Drug FB23-2 Investigative
Target Regulation Up regulation
In-vitro Model
HMC3
N.A. Homo sapiens CVCL_II76
GTPase HRas (HRAS)
Soft tissue sarcoma [ICD-11: XH4UM7]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [157]
Responsed Disease Soft tissue sarcoma [ICD-11: XH4UM7]
Target Regulation Up regulation
In-vitro Model
5637 Bladder carcinoma Homo sapiens CVCL_0126
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
T24 Bladder carcinoma Homo sapiens CVCL_0554
769-P Renal cell carcinoma Homo sapiens CVCL_1050
AsPC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
In-vivo Model A total of 5637 cells with ectopic expression of dm6ACRISPR systems were injected subcutaneously (1 × 107 cells/inoculum) into the flanks of 5-wk-old nude mice (Shanghai Model Organisms Center). Tumor formation/growth was assessed until the experimental endpoint, and tumor volume was calculated by the formula: (width)2 × length/2. For tail vein injection, 5637 cells with ectopic expression of dm6ACRISPR systems (5 × 106 cells/0.1 mL PBS) were injected into the lateral tail vein of 5-wk-old nude mice.
Histone-lysine N-methyltransferase SUV39H1 (SUV39H1)
Ageing-related disease [ICD-11: 9B10-9B60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [158]
Responsed Disease Ageing-related disease [ICD-11: 9B10-9B60]
Target Regulation Down regulation
Homeobox protein Hox-D1 (HOXD1)
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [159]
Responsed Disease Head and neck squamous carcinoma [ICD-11: 2B6E]
Target Regulation Up regulation
In-vitro Model
FaDu Hypopharyngeal squamous cell carcinoma Homo sapiens CVCL_1218
CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
SCC-4 Tongue squamous cell carcinoma Homo sapiens CVCL_1684
HOK Normal Hexagrammos otakii CVCL_YE19
hsa-miR-383-5p
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [160]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Down regulation
In-vitro Model
HPDE6c7 Normal Homo sapiens CVCL_0P38
Capan-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0237
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
hsa-miR-515-5p
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [161]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Insulin-like growth factor-binding protein 7 (IGFBP7)
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [162]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Interferon regulatory factor 8 (IRF8)
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [163]
Responsed Disease Acute Lymphoblastic Leukemia [ICD-11: 2B33.3]
Target Regulation Down regulation
Intraflagellar transport protein 80 homolog (IFT80)
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [164]
Responsed Disease Head and neck squamous carcinoma [ICD-11: 2B6E]
Target Regulation Down regulation
In-vitro Model
HN4 Clear cell renal cell carcinoma Homo sapiens CVCL_IS30
HN-6 Tongue squamous cell carcinoma Homo sapiens CVCL_8129
WSU-HN30 Pharyngeal squamous cell carcinoma Homo sapiens CVCL_5525
SCC-4 Tongue squamous cell carcinoma Homo sapiens CVCL_1684
SCC-9 Tongue squamous cell carcinoma Homo sapiens CVCL_1685
SCC-25 Tongue squamous cell carcinoma Homo sapiens CVCL_1682
CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
In-vivo Model To determine whether lnc-H2AFV-1 overexpression could enhance tumorigenicity in vivo, 1 × 106 HN6 cells stably transduced with LV-lnc-H2AFV-1 or LV-NC were subcutaneously injected into the right and left flanks of six mice.
Kremen protein 2 (KREMEN2)
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [165]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Target Regulation Down regulation
In-vitro Model
OVCAR-3 Ovarian serous adenocarcinoma Homo sapiens CVCL_0465
Caov-3 Ovarian serous adenocarcinoma Homo sapiens CVCL_0201
In-vivo Model 1 × 105 treated cells were subcutaneously injected into mice with normal drinking water. When the volume of subcutaneous tumors was about 150 mm3, the mice were kept with drinking water containing 1 mg/mL of Dox. After 3 weeks, the xenograft tumors were collected and used for follow-up experiments.
Leucine-rich repeat transmembrane protein FLRT3 (FLRT3)
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [166]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Responsed Drug Gefitinib Approved
Target Regulation Up regulation
long intergenic non-protein coding RNA 1139 (LINC01139)
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [167]
Responsed Disease Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
Target Regulation Up regulation
In-vitro Model
HEK293T Normal Homo sapiens CVCL_0063
HET-1A Normal Homo sapiens CVCL_3702
Long-chain-fatty-acid--CoA ligase 4 (ACSL4)
Vascular disorders of the liver [ICD-11: DB98]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [124]
Responsed Disease Vascular disorders of the liver [ICD-11: DB98.B]
Lysine-specific demethylase 5B (KDM5B)
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [168]
Responsed Disease Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
Target Regulation Up regulation
Microphthalmia-associated transcription factor (MITF)
Cushing syndrome [ICD-11: 5A70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [169]
Responsed Disease Cushing syndrome [ICD-11: 5A70.Y]
NADPH oxidase 2 (NOX2)
DOX-induced cardiotoxicity [ICD-11: BA00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [170]
Responsed Disease Blood Pressure [ICD-11: BA00]
Responsed Drug Nicotine Approved
In-vivo Model SCLC cells were collected, and cell suspensions were prepared at a concentration of 1 × 106 cells per 100 μL PBS and injected subcutaneously into nude mice. When the tumour volume reached 60 mm3, mice were randomly divided into control and treatment groups with five mice in each group. The mice in the treatment group were treated regularly, and chemotherapy drugs (CDDP 3 mg/kg and VP16 2 mg/kg) were administered via intraperitoneal injection.
Neurotrophic factor BDNF precursor form (BDNF)
Single episode depressive disorder, severe, without psychotic symptoms [ICD-11: 6A70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [140]
Responsed Disease Major depressive disorder [ICD-11: 6A70.3]
In-vitro Model
SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
In-vivo Model Rats were housed at 23°C and 55% humidity and were given ad libitum food and water. During acclimatization (1 week), rats were placed randomly (3/cage); however, after initial behavioral testing, they were grouped according to their behavioral phenotypes. All experiments were performed under a light cycle (8:00 AM and 10:00 AM). The protocol to induce LH behavior was approved by the Institutional Animal Care and Use Committee of the University of Alabama at Birmingham. The animal study also adhered to the international guidelines for the use and care of laboratory animals.
Nicotinamide N-methyltransferase (NNMT)
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [171]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Responsed Drug Cisplatin Approved
Nuclear factor of activated T-cells, cytoplasmic 1 (NFATC1)
Spinal deformities [ICD-11: FA70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [172]
Responsed Disease Spinal deformities [ICD-11: FA70.1]
Target Regulation Up regulation
In-vitro Model
C2C12 Normal Mus musculus CVCL_0188
Phosphatidylinositol 3-kinase regulatory subunit gamma (PIK3R3)
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [174]
Responsed Disease Cervical cancer [ICD-11: 2C77]
In-vivo Model Eight 4-week-old female nude mice were purchased from Gempharmatech Co. Ltd. and were randomly divided into two groups. In order to establish the in vivo lymph node metastasis model, 3 × 106 SiHa-lv-shFTO or SiHa-lv-shcon cells were slowly injected into the foot pads that containing abundant lymph nodes. After feeding for 20 weeks, we euthanized the nude mice. Lymph nodes in the groin area are dissected and embedded in paraffin for hematoxylin-eosin staining. Our animal experiment research was carried out strictly in accordance with the "Guidelines for the Welfare of Experimental Tumor Animals".
Phospholipid phosphatase 3 (PLPP3)
Acute ischemic stroke [ICD-11: 8B11]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [175]
Responsed Disease Acute ischemic stroke [ICD-11: 8B11]
Target Regulation Up regulation
Polyunsaturated fatty acid lipoxygenase ALOX12 (ALOX12)
Renal cell carcinoma [ICD-11: 2C90]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [73]
Responsed Disease Renal cell carcinoma [ICD-11: 2C90]
Responsed Drug Erianin Investigative
Target Regulation Up regulation
pri-miR-10a
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [58]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
Target Regulation Up regulation
In-vitro Model
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
U251 (Fibroblasts or fibroblast like cells)
U-118MG Astrocytoma Homo sapiens CVCL_0633
LN-229 Glioblastoma Homo sapiens CVCL_0393
A-172 Glioblastoma Homo sapiens CVCL_0131
In-vivo Model BALB/c male nude mice were 4 weeks old. GBM cells with stable overexpression or knockdown of FTO and ovNC or shNC were transduced with lentivirus expressing luciferase. The cells were intracranially injected at a density of 5 × 105/10 uL into every mouse to form an orthotopic xenograft model. Coordinates of injection were 1 mm anterior and 2.5 mm right to the bregma, at a depth of 3.5 mm (the right frontal lobes of the mouse). Every 6 days, bioluminescence imaging (IVIS Lumina Series III; PerkinElmer, Waltham, MA) was used to image the mouse. At 8 days, we randomly chose 5 mice from each group to euthanize them, and their brain tissues were fixed with paraformaldehyde for further study. Another 5 mice were used for survival time analysis. For DB2313 (563801; MedKoo) anti-tumor research, male nude mice were subcutaneously injected with 5 × 106 U87MG cells suspended in 0.1 mL PBS. After 7 days, mice were intraperitoneally injected with DB2313 at density of 10 mg/kg/day dissolved in PBS solvent containing 10% DMSO for 7 days. The other group treated with vehicle only was set as the control group.
Response Summary FTO inhibited growth, migration and invasion of GBM cells in vitro and in vivo.decreased FTO expression could induce the downregulation of MTMR3 expression by modulating the processing of pri-miR-10a in an m6A/HNRNPA2B1-dependent manner in GBM cells. Furthermore, the transcriptional activity of FTO was inhibited by the transcription factor SPI1.
pri-miR-3591
Osteoarthritis [ICD-11: FA05]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [176]
Responsed Disease Osteoarthritis [ICD-11: FA05]
Target Regulation Down regulation
Prolyl endopeptidase FAP (FAP)
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [177]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Responsed Drug VS-6063 Phase 2
In-vitro Model
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1650 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1483
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
BEAS-2B Normal Homo sapiens CVCL_0168
In-vivo Model The Laboratory Animal Center of Soochow University provided female BALB/c nude mice (5 weeks old). Mice were kept under specific pathogen-free conditions. They were injected intravenously (i.v.) with FTO-overexpressing and control A549 cells (1.8 × 106 cells/mouse) to establish the in vivo model of NSCLC metastasis, and were then gavaged with dimethyl sulfoxide (DMSO) (25 mg/kg, daily) or the FAK inhibitor defactinib (VS6063) (Cat#S7654, Selleck, USA) (25 mg/kg, daily) beginning in the fifth week after injection. The mice were euthanized eight weeks after being inoculated, and their lungs were taken out and preserved in Bouin's solution for macroscopic investigation of metastatic nodules. Hematoxylin and eosin (H&E) staining of lung tissues was used to look for micrometastatic foci.
Prostacyclin synthase (PTGIS)
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [166]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Responsed Drug Gefitinib Approved
Target Regulation Up regulation
Protein Atg16l2 (ATG16L2)
Diabetes [ICD-11: 5A10-5A14]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [67]
Responsed Disease Diabetes [ICD-11: 5A10-5A14]
Responsed Drug Dac51 Investigative
In-vitro Model
MIN6 Mouse insulinoma Mus musculus CVCL_0431
Protein c-Fos (FOS)
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [178]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Down regulation
In-vitro Model
Akata EBV-related Burkitt lymphoma Homo sapiens CVCL_0148
In-vivo Model To evaluate the tumorigenic effect of FTO, FTO knockdown or control AGS B95.8 cells (1 × 107 suspended in 150 μL of PBS) were subcutaneously injected into the flanks of B-NDG mice. The diameter and width of the tumours were measured every 4 days and used to estimate the tumour volumes by the standard formula: 0.5 × length × width2. At the end stage, the tumours were removed, imaged and weighed. To investigate the peritoneal dissemination ability of EBVaGC cells, intraperitoneal injection was performed. Briefly, 1 × 107 FTO silencing or control EBVaGC cells suspended in 0.4 mL of PBS were injected into the peritoneal cavity of each mouse. Eight weeks later, all the mice were sacrificed, and the abdominal and intestinal metastatic nodules were excised, counted, photographed and paraffin embedded. For the lung metastasis model, 200 μL of 1 × 106 luciferase-labelled EBVaGC cells from different groups were directly injected into the tail vein of B-NDG mice, and distant and lung metastasis were evaluated using bioluminescent imaging. After 6 or 8 weeks, the mice were euthanized, and the lungs were embedded in paraffin and subjected to haematoxylin and eosin (H&E) staining to record the micrometastatic nodules using a microscope. All animal experiments were approved by our Institutional Animal Care.
Protein wntless homolog (WLS)
Pain disorders [ICD-11: 8E43]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [179]
Responsed Disease Neuropathic pain [ICD-11: 8E43.0]
Target Regulation Down regulation
In-vitro Model
PC-12 Lung papillary adenocarcinoma Homo sapiens CVCL_S979
In-vivo Model Rats were anesthetized with isoflurane (1.5%-2.5%), and a lateral thigh incision was made. The left sciatic nerve and its three peripheral branches were isolated after sciatic nerve resection. A 5-0 suture was used to ligate the common peroneal and tibial nerves. Then, distal transverse incisions were made at the ligation. All surgical procedures were completed within 20 min, with special care taken to avoid damaging the sural nerve. The rats in the sham group underwent the same sciatic nerve exposure operation as the SNI group except for nerve ligation.
Sclerostin (SOST)
Diabetic [ICD-11: 5A14]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [180]
Responsed Disease Diabetic [ICD-11: 5A14]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model
BMSCs (BMSCs were obtained from the femurs and tibias of 2-3-week-old Sprague-Dawley male rats (Animal Center of Sun Yat-sen University))
MC3T3
N.A. Mus musculus CVCL_0D74
Thioredoxin-interacting protein (TXNIP)
Picornavirus infections presenting in the skin or mucous membranes [ICD-11: 1F05]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [181]
Responsed Disease Picornavirus infections presenting in the skin or mucous membranes [ICD-11: 1F05.0]
Target Regulation Down regulation
In-vitro Model
RD Embryonal rhabdomyosarcoma Homo sapiens CVCL_1649
Vero 76
N.A. Chlorocebus sabaeus CVCL_0603
In-vivo Model In this study, we introduced an animal model of EV71 infection (C4-ZZ1350) based on 3-day-old BALB/c mice inoculated with a lethal dose of EV71 strain (2 × 106 PFU/mouse) by the intraperitoneal (i.p.) route (n = 11 per group).
Threonylcarbamoyladenosine tRNA methylthiotransferase (CDKAL1)
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [182]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Responsed Drug Fluorouracil Approved
Target Regulation Up regulation
In-vitro Model
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
GES-1 Normal Homo sapiens CVCL_EQ22
Thrombospondin-2 (THBS2)
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [137]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Up regulation
In-vitro Model
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
TNFAIP3-interacting protein 1 (TNIP1)
Diabetes [ICD-11: 5A10-5A14]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [183]
Responsed Disease Diabetes [ICD-11: 5A10-5A14]
Target Regulation Down regulation
In-vivo Model Briefly, the 8-week-old C57BL/6 male mice were fed with high-fat diet for 4 weeks and then intraperitoneally injected STZ (Sigma-Aldrich, 50 mg/kg STZ after fasting for 6 hours). The STZ injection was conducted for 5 days while the mice drank 10% glucose solution during the treatment. The control mice were injected citrate buffer and fed normal chow. All mice were maintained on their respective diets till sacrifice. Fasting blood glucose was tested 1 week after the last STZ injection, and values of more than 16.7 mmol/L were considered diabetic.
Transducin-like enhancer protein 1 (TLE1)
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [184]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Responsed Drug Phenethyl isothiocyanate Investigative
In-vitro Model
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H226 Pleural epithelioid mesothelioma Homo sapiens CVCL_1544
In-vivo Model Five-week-old female BALB/c nude mice were purchased from the Cancer Institute of the Chinese Academy of Medical Science (Beijing, China). Mice were randomly divided into two groups (eight mice per group), and 3×106 H1299 or H1299-LV-FTO-KD cells were injected subcutaneously into the flank of each mouse. For each group, four mice were treated with PEITC (100 mg/kg) intraperitoneally every two days for 14 days beginning the fifth week after cell injection, while the other four mice were treated with PBS as a control. At the end of the experiment, mice were euthanized, and tumor tissues were dissected for further analysis. Tumor weights were measured, and volumes were calculated (V = D/2 × d2, V: volume; D: longitudinal diameter; d: latitudinal diameter).
Tyrosine-protein phosphatase non-receptor type substrate 1 (SIRPA)
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [166]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Responsed Drug Gefitinib Approved
Target Regulation Up regulation
Ubiquitin thioesterase OTUB1 (OTUB1)
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 2 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [185]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Responsed Drug Erastin Investigative
Target Regulation Up regulation
In-vitro Model
C666-1 Nasopharyngeal carcinoma Homo sapiens CVCL_7949
HONE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_8706
In-vivo Model Three- to four-week-old female BALB/c nude mice were obtained from Guangxi Medical University Laboratory Animal Center and maintained under SPF housing. NPC cells were resuspended in 100 μl of PBS and injected subcutaneously into the flanks of the nude mice. Mice were randomized to experimental groups 28 days after implantation and were injected intraperitoneally with the same volume of FB23-2 (2 mg/kg) or erastin (10 mg/kg) or vehicle every three days during radiation (4 Gy, once a week). The endpoint of all experiments was tumor size.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [185]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Responsed Drug FB23-2 Investigative
Target Regulation Up regulation
In-vitro Model
C666-1 Nasopharyngeal carcinoma Homo sapiens CVCL_7949
HONE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_8706
In-vivo Model Three- to four-week-old female BALB/c nude mice were obtained from Guangxi Medical University Laboratory Animal Center and maintained under SPF housing. NPC cells were resuspended in 100 μl of PBS and injected subcutaneously into the flanks of the nude mice. Mice were randomized to experimental groups 28 days after implantation and were injected intraperitoneally with the same volume of FB23-2 (2 mg/kg) or erastin (10 mg/kg) or vehicle every three days during radiation (4 Gy, once a week). The endpoint of all experiments was tumor size.
Unspecific Target Gene
Viral infections [ICD-11: 1D9Y]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [187]
Responsed Disease Viral infections [ICD-11: 1D9Y]
In-vitro Model
HEK293T Normal Homo sapiens CVCL_0063
Response Summary m6A is the most abundant internal modification described in eukaryotic mRNA and several viral RNA including human respiratory syncytial virus (HRSV) infection. METTL3/METTL14 m6A writer complex plays a negative role in HRSV infections protein synthesis and viral titers, while m6A erasers FTO and ALKBH5 had the opposite effect.
Solid tumour/cancer [ICD-11: 2A00-2F9Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [188]
Responsed Disease Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Pathway Response PI3K-Akt signaling pathway hsa04151
MAPK signaling pathway hsa04010
mTOR signaling pathway hsa04150
Cell Process Cell apoptosis
Response Summary FTO was implicated in multiple biological processes, such as cancer cell apoptosis, proliferation, migration, invasion, metastasis, cell-cycle, differentiation, stem cell self-renewal and so on.
Acute myeloid leukaemia [ICD-11: 2A60]
In total 2 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [191]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Responsed Drug Saikosaponins Investigative
Cell Process Cell apoptosis
Cell-cycle
In-vitro Model
C1498 Mouse leukemia Mus musculus CVCL_3494
HL-60 Adult acute myeloid leukemia Homo sapiens CVCL_0002
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
Kasumi-1 Myeloid leukemia with maturation Homo sapiens CVCL_0589
MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
MOLM-14 Adult acute myeloid leukemia Homo sapiens CVCL_7916
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
SKNO-1 Myeloid leukemia with maturation Homo sapiens CVCL_2196
U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
In-vivo Model Upon the development of leukemic disease (established using a white blood cell (WBC) count), 0.1 mg/kg or 0.5 mg/kg of SsD was intraperitoneally injected three times per week for three consecutive weeks.
Response Summary FTO-dependent m6A RNA methylation mediated the anti-leukemic actions of saikosaponin-d, thereby opening a window to develop SsD as an epitranscriptome-base drug for leukemia therapy. SsD showed a broadly-suppressed acute myeloid leukemia cell proliferation and promoted apoptosis and cell-cycle arrest both in vitro and in vivo.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [192]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Response Summary A prevalent eukaryotic N6-methyladensosine (m6A) post-transcriptional mark can be "erased" by the m6A demethylase FTO, which is commonly deregulated in acute myeloid leukemia (AML).
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [194]
Responsed Disease Leukaemia [ICD-11: 2B33.4]
In-vitro Model
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
Ku812 Chronic myeloid leukemia Homo sapiens CVCL_0379
Kasumi-1 Myeloid leukemia with maturation Homo sapiens CVCL_0589
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
In-vivo Model All mice had free access to food and water throughout the study. To test the oncogenic potential of FTO gene, K562 parental cells were transfected with FTO expression or control vectors for 6 h, and 5.0 × 106 transfected cells were subcutaneously injected into the bilateral flanks of the nude mice. For therapeutic experiments, K562 nilotinibR cells (1.5 × 106) were injected subcutaneously into the bilateral flanks of the nude mice. To retain the resistance phenotypes, these mice received 1 mg/kg nilotinib twice a week for 4 weeks till the tumor approached ~10 mm3. Then the tumor-bearing mice were randomly divided into groups of 3 animals and received intraperitoneal injection of either 5 mg/kg nilotinib, 10 mg/kg rhein alone or their combination in polyethylene glycol 400 (PEG400, Sigma #1546445) and saline (ratio 15:38:47), three injections each week for 5 times in total.
Response Summary Developing resistant phenotypes during tyrosine kinase inhibitor (TKI) therapy depends on m6A reduction resulting from FTO overexpression in leukemia cells.
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [195]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
In-vitro Model
MG-63 Osteosarcoma Homo sapiens CVCL_0426
In-vivo Model According to the method published previously , exponentially growing MG63 and MG63/DXR were harvested, counted with trypan blue to show cells with at least 95% viability, and then resuspended at a final amount from 5 × 106 to 5 × 103 in 100 uL Matrigel (Corning, NY, USA) before being injected subcutaneously into 5-week-old female nude mice.The mice were monitored once every 3 days until the 60th day, and euthanized humanely after the experiment.
Response Summary The transcriptome-wide m6A methylome of osteosarcoma cells enriched by chemotherapy, revealing a tight relationship between m6A methylation and the emergence and maintaining of OSCs.
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [196]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Response Summary Aberrant expression of demethylase genes, FTO and ALKBH1, has a distinct prognostic value in Gastric cancer patients, indicating that FTO and ALKBH1 play vital roles in GC progression and metastasis.
Colorectal cancer [ICD-11: 2B91]
In total 2 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [199]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Berberine Phase 4
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model 5 × 105 HCT116 CSCs were subcutaneously injected into the mice similarly as nude mice. Seven days later, 5, 10, or 20 mg/kg Berberine was intraperitoneally injected. The same volume of PBS was injected and considered as negative control.
Response Summary Berberine effectively decreased m6A methylation by decreasing beta-catenin and subsequently increased FTO suggests a role of Berberine in modulating stemness and malignant behaviors in colorectal cancer.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [34]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Cell Process Cell proliferation
Cell apoptosis
In-vitro Model
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model RC cells SW480 at logarithmic growth phase were prepared into cell suspension with a concentration of about 1 × 107/100 L, which was then injected into the left axilla of nude mice with a 1 ml syringe to establish a subcutaneous mouse xenograft model. Once the tumor volume reached about 50 mm3, the nude mice were injected with miR-96 antagomir or NC antagomir (10 nmol once every 5 days for 5 weeks). After 5 weeks, the mice were euthanized, after which the subcutaneous transplanted tumor was removed, and weighed.
Response Summary MiR-96 antagomir could potentially retard the cancerogenesis in colorectal cancer via AMPK subunit alpha-2 (AMPKAlpha2/PRKAA2)-dependent inhibition of FTO and blocking FTO-mediated m6A modification of MYC.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [200]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Cell Process Cell apoptosis
Cell invasion
In-vitro Model
BEL-7402 Endocervical adenocarcinoma Homo sapiens CVCL_5492
BEL-7404 Endocervical adenocarcinoma Homo sapiens CVCL_6568
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
MHCC97-L Adult hepatocellular carcinoma Homo sapiens CVCL_4973
LM Extrarenal rhabdoid tumor of the liver Homo sapiens CVCL_B3QF
QGY-7703 Endocervical adenocarcinoma Homo sapiens CVCL_6715
SMMC-7721 Endocervical adenocarcinoma Homo sapiens CVCL_0534
In-vivo Model Male BALB/c nude mice (5 weeks old) were subcutaneously inoculated in the right axillary fossa with 200 uL (1 × 106 cells) of SIRT1-overexpressing Hep3B cells, SIRT1- and FTO-overexpressing Hep3B cells, shRNA-SIRT1-transfected HepG2 cells, shRNA-SIRT1- and shRNA-FTO-transfected HepG2 cells, and control cells.
Response Summary SIRT1 destabilizes FTO, steering the m6A of downstream molecules and subsequent mRNA expression in hepatocellular carcinoma tumorigenesis. A crucial component of small ubiquitin-related modifiers (SUMOs) E3 ligase, RANBP2, is activated by SIRT1, and it is indispensable for FTO SUMOylation at Lysine (K)-216 site that promotes FTO degradation.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [202]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Cell Process Cell Progression
In-vitro Model
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
Response Summary FTO facilitates lung adenocarcinoma cell progression by activating cell migration through m6A demethylation.
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [203]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Target Regulation Up regulation
Pathway Response cAMP signaling pathway hsa04024
In-vitro Model
COV362 Ovarian serous adenocarcinoma Homo sapiens CVCL_2420
HEK293T Normal Homo sapiens CVCL_0063
OVCAR-5 Ovarian serous adenocarcinoma Homo sapiens CVCL_1628
SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
In-vivo Model Female nude, athymic, BALB/c-nu/nu mice (6-7 weeks old; Harlan) were injected subcutaneously (s.c.) with serially diluted numbers (5,000, 10,000, or 20,000) of OVCAR5_GFP or OVCAR5_FTO cells mixed with Matrigel (Fisher Scientific). Mice were monitored bi-weekly and time to tumor initiation and tumor growth were recorded.
Response Summary FTO-Dependent N 6-Methyladenosine Modifications Inhibit Ovarian Cancer Stem Cell Self-Renewal by Blocking cAMP Signaling. cAMP pathway as a new FTO target in CSCs, associated with tumor inhibiting functions, and provide key new information on the role of m6A modifications regulated by FTO in the fine tuning of cellular fate in HGSOC.
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [204]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Cell Process Cell migration
Cell invasion
In-vitro Model
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
DU145 Prostate carcinoma Homo sapiens CVCL_0105
Response Summary Knockdown of HNRNPA2B1 or FTO prominently inhibited prostate cancer cells migration and invasion in vitro experiment. Determined CBLL1, FTO, YTHDC1, HNRNPA2B1 as crucial m6A regulators of prostate cancer.
Renal cell carcinoma [ICD-11: 2C90]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [206]
Responsed Disease clear cell renal cell carcinoma [ICD-11: 2C90.0]
Response Summary The m6A-demethylases ALKBH5 and FTO are dysregulated in clear cell renal cell carcinoma and could be used as prognostic biomarkers. ALKBH5 mRNA, as well as ALKBH5 and FTO protein expressions, was significantly downregulated in ccRCC compared to normal tissue and most of the other studied tumour entities.
Diabetes [ICD-11: 5A10-5A14]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [209]
Responsed Disease Diabetes [ICD-11: 5A10-5A14]
Response Summary The content of m6A was highly associated with the risk of T2DM, and the increased mRNA expression of FTO is responsible for the reduction of m6A, which can further cause the complications of T2DM.
Obesity [ICD-11: 5B81]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [210]
Responsed Disease Obesity [ICD-11: 5B81]
In-vitro Model
N1E-115 Mouse neuroblastoma Mus musculus CVCL_0451
NIH 3T3 Normal Mus musculus CVCL_0594
In-vivo Model For high-fat-diet treatment, 3-week-old male mice were randomly divided into three groups: two experimental groups freely fed with HFD of 60% fat, 20% carbohydrate, and 20% protein (Cat#: D12492, Research Diets) or KD of 89.5% fat, 0.1% carbohydrate, and 10.4% protein (Cat#: D12369B, Research Diets), and the control group fed with SD of 10% fat, 70% carbohydrate, and 20% protein (Cat#: D12450B, Research Diets), respectively. The mice were allowed free access to water and food.For fasting treatment, 3-month-old male mice were randomly divided into two groups: the fasting group with only free access to water for 48 h and the control group allowed free access to water and SD.
Response Summary FTO fails to bind to its own promoter that promotes FTO expression in the hypothalamus of high-fat diet-induced obese and 48-h fasting mice, suggesting a disruption of the stable expression of this gene.ketogenic diet-derived ketone body beta-hydroxybutyrate (BHB) transiently increases FTO expression in both mouse hypothalamus and cultured cells.
Metabolic disorders [ICD-11: 5D2Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [211]
Responsed Disease Metabolic disorders [ICD-11: 5D2Z]
Pathway Response AMPK signaling pathway hsa04152
Cell Process Lipid metabolism
In-vitro Model
C2C12 Normal Mus musculus CVCL_0188
In-vivo Model Sixteen 10-wk-old male C57BL/6 J mice [wild-type (WT) mice] and six 10-wk-old male obese C57BL/6Job/ob (OB) mice were purchased from Nanjing Biomedical Research Institute of Nanjing University. WT mice were randomly divided into 2 groups (8 mice/group): normal chow diet (ND) and high-fat diet (HFD) groups. The ND group was fed with a normal chow diet containing10% fat, 20% protein and 70% carbohydrate. The HFD group was fed a HFD containing 45% fat, 20% protein and 35% carbohydrate. OB mice were fed with ND. All mice were housed at 22 ± 1 ℃ under a 12-h light cycle with free access to water and diet during the experiment.
Response Summary FTO-dependent demethylation of mRNA m6A methylation was involved in the regulation of skeletal muscle lipid accumulation by the AMPK signalling pathway.
Secondary stereotypy [ICD-11: 8A07]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [212]
Responsed Disease Secondary stereotypy [ICD-11: 8A07]
Response Summary Inhibition of m6A RNA demethylation by small-molecule drugs, as presented here, has therapeutic potential and provides tools for the identification of disease-modifying m6A RNAs in neurogenesis and neuroregeneration. Small-molecule inhibitors of the RNA m6A demethylases FTO potently support the survival of dopamine neurons.
Alzheimer disease [ICD-11: 8A20]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [213]
Responsed Disease Alzheimer disease [ICD-11: 8A20]
Cell Process Synaptic or neuron development and growth
Response Summary The alterations of m6A RNA methylation in alzheimer's disease and in C57BL/6 mice were investigated using high-throughput sequencing. The expression of the m6A methyltransferase METTL3 was elevated and that of the m6A demethylase FTO was decreased in AD mice.
Acute ischemic stroke [ICD-11: 8B11]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [215]
Responsed Disease Acute ischemic stroke [ICD-11: 8B11]
In-vivo Model 36 male C57BL/6J mice (20-22 g, 2-month-old) were purchased from SPF (Beijing) biotechnology co., Ltd (Beijing, China) and maintained in the specific pathogen-free (SPF) animal laboratory with a 12/12 h light/dark cycle with free access to food and water. The mice were randomly assigned into six groups (n = 6 per group): (1) sham-operated group (Sham), (2) MCAO 6 h, (3) MCAO 12 h, (4) MCAO 1 d, (5) MCAO 3 d, and (6) MCAO 7 d.
Neurological disorders due to toxicity [ICD-11: 8D43]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [216]
Responsed Disease Neurological disorders due to toxicity [ICD-11: 8D43]
Responsed Drug Arsenite Phase 2
In-vitro Model
PC-12 Adh Rat adrenal gland pheochromocytoma Rattus norvegicus CVCL_F659
In-vivo Model The animals were kept in standard laboratory polycarbonate cages in controlled ambient temperature at 23℃ ± 1℃ with relative humidity of 50% ± 10%, and a light-dark cycle of 12/12 h. The mice had free access to standardized pellet food and tap water. After 1-week of habituation, the animals were randomly divided into the following 4 groups: control group, 0.5 mg/l arsenite group, 5 mg/l arsenite group and 50 mg/l arsenite group (n = 16 per group). The mice were exposed to arsenite via drinking water for 6 months.
Response Summary Targeting the m6A demethylase FTO in the prevention or intervention against arsenite-related neurodegenerative diseases.
Visual impairment [ICD-11: 9D90]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [217]
Responsed Disease Vision impairment [ICD-11: 9D90]
In-vitro Model
HUVEC-C Normal Homo sapiens CVCL_2959
In-vivo Model After general anesthesia with an intraperitoneal injection of ketamine (80 mg/kg) and xylazine (4 mg/kg), topical application of 0.5% proparacaine ophthalmic solution was conducted. Three sutures (10-0 nylon) were placed intrastromally between the limbus and corneal center at the 4, 8, and 12 o'clock positions. Topical norfloxacin was applied after surgery.
Response Summary FTO regulates pathological ocular angiogenesis by controlling endothelial cell function in an m6A-YTHDF2-dependent manner. Pathological ocular angiogenesis commonly results in visual impairment or even blindness.
Ototoxic hearing loss [ICD-11: AB53]
In total 2 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [218]
Responsed Disease Ototoxic hearing loss [ICD-11: AB53]
Responsed Drug Cisplatin Approved
Cell Process Oxidative stress
Cell autophagy
In-vitro Model
HEI-OC1 Normal Mus musculus CVCL_D899
Response Summary MA2, which is a highly selective inhibitor of FTO, has a protective effect and improves the viability of HEI-OC1 cells after cisplatin treatment, and they provide new insights into potential therapeutic targets for the amelioration of cisplatin-induced ototoxicity.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [218]
Responsed Disease Ototoxic hearing loss [ICD-11: AB53]
Responsed Drug Ethyl ester form of meclofenamic acid Approved
Cell Process Oxidative stress
Cell autophagy
In-vitro Model
HEI-OC1 Normal Mus musculus CVCL_D899
Response Summary MA2, which is a highly selective inhibitor of FTO, has a protective effect and improves the viability of HEI-OC1 cells after cisplatin treatment, and they provide new insights into potential therapeutic targets for the amelioration of cisplatin-induced ototoxicity.
Presbycusis [ICD-11: AB54]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [219]
Responsed Disease Presbycusis [ICD-11: AB54]
Cardiomyopathy [ICD-11: BC43]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [220]
Responsed Disease Diabetic cardiomyopathy [ICD-11: BC43.7]
In-vivo Model Leptin receptor-deficient (db/db) mice and control mice (db/ +) were purchased from Shanghai Model Organisms Center, which genetic background is C57BL/6J. All mice were used for experiments at 8-12 weeks old and were housed in constant 24 degrees cages with a 12 h alternating light/dark cycle and free access to water and food. To construct a diabetic heart disease model (DCM), mice were continuously fed to 24 weeks of age, then euthanized, hearts collected in 1.5 ml RNase-free centrifuge tubes, immediately immersed in liquid nitrogen to prevent RNA degradation, and finally stored at 80℃. Five pairs of db/db and db/ + heart samples were selected for RNA sequencing, and the remaining samples were saved for validation.
Response Summary Overexpression of FTO in diabetic cardiomyopathy(DCM) model mice improved cardiac function by reducing myocardial fibrosis and myocyte hypertrophy.
Congestive heart failure [ICD-11: BD10]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [221]
Responsed Disease Congestive heart failure [ICD-11: BD10]
In-vivo Model We quantified m6A levels in RNA extracted from failing human (both ischemic and non-ischemic), pig and mouse (post-myocardial infarction ischemic) hearts and compared them to m6A in non-failing human and sham surgical controls respectively. We detected significantly elevated levels of m6A in both total and polyA+ RNA extracted from human, pig and mouse failing left ventricular (LV) explants compared to non-failing or sham.
Response Summary FTO-dependent cardiac m6A methylome in cardiac contraction during heart failure and provides a novel mechanistic insight into the therapeutic mechanisms of FTO.
Aortic aneurysm or dissection [ICD-11: BD50]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [222]
Responsed Disease Abdominal aortic aneurysm [ICD-11: BD50.4]
Cell Process Inflammatory infiltrates
Neovascularization
In-vitro Model
PBMCs (Human peripheral blood mononuclear cells (PBMCs) are isolated from peripheral blood and identified as any blood cell with a round nucleus)
SMCs (Aneurysmal smooth muscle cells)
Response Summary YTHDF3 represented an even greater risk of rupture. Regarding the cellular location, METTL14 seemed to be associated with inflammatory infiltrates and neovascularization. Furthermore, a strong correlation was seen between FTO and aneurysmal smooth muscle cells (SMCs), YTHDF3, and macrophage infiltrate. The results also reveal the important roles of m6A modulators, including YTHDF3, FTO, and METTL14, in the pathogenesis of human human abdominal aortic aneurysm(AAA) and provide a new view on m6A modification in AAA.
Diseases of the circulatory system [ICD-11: BE2Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [223]
Responsed Disease Diseases of the circulatory system [ICD-11: BE2Z]
Responsed Drug Sunitinib Approved
In-vitro Model
hiPSCs (Urinary epithelial cell-derived hiPSCs)
CMECs (Cardiac Microvascular Endothelial Cells )
CFs (Cardiac Fibroblasts)
Response Summary The RNA demethylase FTO was downregulated, whereas METTL14 and WTAP were upregulated. Furthermore, gain- and loss-of-function studies substantiated that FTO is cardioprotective in TKI(Sunitinib).
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [224]
Responsed Disease Non-alcoholic fatty liver disease [ICD-11: DB92]
Responsed Drug Betaine Approved
In-vivo Model Eight adult female C57BL/6 mice from the same pool of litters were housed at 22 ± 1 ℃ with 12-h light cycle and were mated with their male siblings. The female mice were fed with a low-fat diet supplemented with betaine from mating and throughout gestation and lactation. Litters were culled to five males per dam. Thirty offspring weaned at the age of day 21 and then were randomly assigned to three groups fed with either a low-fat diet (LF), high-fat diet (HF), or high-fat diet supplemented with betaine (HB) for 6 weeks.
Response Summary A novel FTO-dependent function of m(6)A is involve in the hepatoprotective effects of betaine. betaine supplementation across adolescence could protect mice from high-fat-induced lipid accumulation NAFLD in the liver. Moreover, FTO-dependent m6A demethylation is affected by betaine. A novel FTO-dependent function of m(6)A may involve in the hepatoprotective effects of betaine.
Liver disease [ICD-11: DB9Z]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [225]
Responsed Disease Liver disease [ICD-11: DB9Z]
Pathway Response PPAR signaling pathway hsa03320
Cell Process Fatty degeneration
In-vivo Model A total of 24 male mice were randomly allocated to LFD (low-fat diet), LFDR (low-fat diet + resveratrol), HFD (high-fat diet), and HFDR (high-fat diet + resveratrol) groups for 12 weeks (n = 6/group).
Response Summary The beneficial effect of resveratrol on lipid metabolism disorder under HFD is due to a decrease of m6A RNA methylation and an increase of PPARalpha mRNA, providing mechanistic insights into the function of resveratrol in alleviating the disturbance of lipid metabolism in mice. The resveratrol in HFD increased the transcript levels of methyltransferase like 3 (METTL3), alkB homolog 5 (ALKBH5), fat mass and obesity associated protein (FTO), and YTH domain family 2 (YTHDF2), whereas it decreased the level of YTH domain family 3 (YTHDF3) and m6A abundance in mice liver.
Menopausal disorder [ICD-11: GA30]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [226]
Responsed Disease Premature ovarian failure [ICD-11: GA30.6]
Cell Process Cell proliferation
Cell apoptosis
In-vitro Model
Hgc (Primary human ovarian granulosa cells)
In-vivo Model To build the mouse model for POI, cyclophosphamide (CTX) (Sigma, St. Louis, MO) was used a high-dose treatment (120 mg/kg, 2 weeks).
Response Summary The decreased mRNA and protein expression levels of FTO are responsible for the increase in m6A in POI, which can further increase the risk of complications of POI. FACS was used to measure the levels of proliferation and apoptosis, and siRNA was used to establish FTO and ALKBH5 knockdown cell lines. The m6A content in the RNA from POI patients and POI mice was significantly higher than control groups and that POI was characterized by the content of m6A.
Chronic kidney disease [ICD-11: GB61]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [228]
Responsed Disease Chronic kidney disease [ICD-11: GB61]
In-vitro Model
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
T-lymphocyte cell line (A type of lymphocyte)
Response Summary Targeting RNA m6A modification is a novel strategy for the treatment of chronic kidney diseases and autophagy. Knockdown of FTO or inhibit the m6A by 3-deazaadenosine blocks the effects of indoxyl sulfate on autophagy activation in cells.
Sex development malformative disorder [ICD-11: LD2A]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [229]
Responsed Disease Sex development malformative disorder [ICD-11: LD2A]
Pathway Response MAPK signaling pathway hsa04010
Cell Process Cell apoptosis
In-vitro Model
TM3 Normal Mus musculus CVCL_4326
Response Summary The inhibition of FTO-mediated up-regulation of m6A could be involved in MEHP-induced Leydig cell apoptosis.
Ankyrin repeat and SOCS box protein 2 (ASB2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 8.19E-01
p-value: 3.80E-03
More Results Click to View More RNA-seq Results
Tretinoin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [2]
Responsed Disease Acute myeloid leukaemia ICD-11: 2A60
Target Regulation Down regulation
Cell Process RNA stability
RNA degradation (hsa03018)
In-vitro Model K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KOCL-48 Childhood acute monocytic leukemia Homo sapiens CVCL_6867
Mono-Mac-6 Adult acute monocytic leukemia Homo sapiens CVCL_1426
Response Summary FTO enhances leukemic oncogene-mediated cell transformation and leukemogenesis, and inhibits all-trans-retinoic acid (ATRA)-induced AML cell differentiation, through regulating expression of targets such as Ankyrin repeat and SOCS box protein 2 (ASB2) and RARA by reducing m6A levels in these mRNA transcripts.
Apoptosis regulator Bcl-2 (BCL2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: -6.55E-01
p-value: 1.57E-02
More Results Click to View More RNA-seq Results
Meclofenamic acid [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [4]
Responsed Disease Breast cancer ICD-11: 2C60
Pathway Response Apoptosis hsa04210
PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation
Cell apoptosis
Response Summary Studies of the aberrant expression of m6A mediators in breast cancer revealed that they were associated with different BC subtypes and functions, such as proliferation, apoptosis, stemness, the cell cycle, migration, and metastasis, through several factors and signaling pathways, such as Apoptosis regulator Bcl-2 (BCL2) and the PI3K/Akt pathway, among others. Fat mass and obesity-associated protein (FTO) was identified as the first m6A demethylase, and a series of inhibitors that target FTO were reported to have potential for the treatment of BC by inhibiting cell proliferation and promoting apoptosis.
R-2HG [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [4]
Responsed Disease Breast cancer ICD-11: 2C60
Pathway Response Apoptosis hsa04210
PI3K-Akt signaling pathway hsa04151
Cell Process Cell proliferation
Cell apoptosis
Response Summary Studies of the aberrant expression of m6A mediators in breast cancer revealed that they were associated with different BC subtypes and functions, such as proliferation, apoptosis, stemness, the cell cycle, migration, and metastasis, through several factors and signaling pathways, such as Apoptosis regulator Bcl-2 (BCL2) and the PI3K/Akt pathway, among others. Fat mass and obesity-associated protein (FTO) was identified as the first m6A demethylase, and a series of inhibitors that target FTO were reported to have potential for the treatment of BC by inhibiting cell proliferation and promoting apoptosis.
ATP-binding cassette sub-family C member 10 (ABCC10)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Mouse hippocampus Mus musculus
Treatment: FTO knockout mice hippocampus
Control: Wild type hippocampus
GSE94098
Regulation
logFC: 6.58E-01
p-value: 2.09E-04
More Results Click to View More RNA-seq Results
Gefitinib [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [5]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
Target Regulation Up regulation
Pathway Response ABC transporters hsa02010
In-vitro Model PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
In-vivo Model Mice were randomized into three groups (n = 7/group), 1 × 107 PC9 cells absorbed exosomes were subcutaneously injected into the Bilateral groin of mice. Treatment began 1 week following injection, the mice were intraperitoneally injected with gefitinib (30 mg/kg/day).
Response Summary Not only FTO knockdown enhanced the gefitinib sensitivity of GR cells but also FTO reduction in donor exosomes alleviated the acquired resistance of recipient non-small cell lung cancer PC9 cells. FTO/YTHDF2/ATP-binding cassette sub-family C member 10 (ABCC10) axis played a role in intercellular transmission of GR cell-derived exosome-mediated gefitinib resistance.
C-X-C chemokine receptor type 4 (CXCR4)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 9.72E-01
p-value: 3.86E-03
More Results Click to View More RNA-seq Results
PMID31239444-anti-PD1 antibody [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [7]
Responsed Disease Melanoma ICD-11: 2C30
Target Regulation Up regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Cell Process mRNA decay
In-vitro Model B16-F10 Mouse melanoma Mus musculus CVCL_0159
CHL-1 Melanoma Homo sapiens CVCL_1122
624-mel Melanoma Homo sapiens CVCL_8054
NHEM (Normal Human Epidermal Melanocytes)
SK-MEL-30 Cutaneous melanoma Homo sapiens CVCL_0039
WM115 Melanoma Homo sapiens CVCL_0040
WM35 Melanoma Homo sapiens CVCL_0580
WM3670 Melanoma Homo sapiens CVCL_6799
WM793 Melanoma Homo sapiens CVCL_8787
In-vivo Model When the tumors reached a volume of 80-100 mm3, mice were treated with anti-PD-1 or isotype control antibody (200 ug/mouse) by i.p. injection, every other day for three times. For IFNγ blockade treatment, C57BL/6 mice were treated with anti-IFNγ antibody or isotype control IgG (250 ug/mouse) every other day after tumor cell inoculation.
Response Summary These findings demonstrate a crucial role of FTO as an m6A demethylase in promoting melanoma tumorigenesis and anti-PD-1 resistance, and suggest that the combination of FTO inhibition with anti-PD-1 blockade reduces the resistance to immunotherapy in melanoma. Knockdown of FTO increases m6A methylation in the critical protumorigenic melanoma cell-intrinsic genes including PD-1 (PDCD1), C-X-C chemokine receptor type 4 (CXCR4), and SOX10, leading to increased RNA decay through the m6A reader YTHDF2.
CCAAT/enhancer-binding protein alpha (CEBPA)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 6.07E-01
p-value: 3.92E-03
More Results Click to View More RNA-seq Results
R-2HG [Investigative]
In total 2 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [9]
Responsed Disease Glioma ICD-11: 2A00.0
Target Regulation Down regulation
Cell Process Glutamine metabolism
Cell apoptosis
In-vitro Model 8-MG-BA Glioblastoma Homo sapiens CVCL_1052
A-172 Glioblastoma Homo sapiens CVCL_0131
DK-MG Glioblastoma Homo sapiens CVCL_1173
GaMG Glioblastoma Homo sapiens CVCL_1226
HEL Erythroleukemia Homo sapiens CVCL_0001
Jurkat T acute lymphoblastic leukemia Homo sapiens CVCL_0065
KOCL-45 B acute lymphoblastic leukemia Homo sapiens CVCL_3993
KOCL-48 Childhood acute monocytic leukemia Homo sapiens CVCL_6867
KOCL-50 B acute lymphoblastic leukemia Homo sapiens CVCL_6866
KOCL-51 B acute lymphoblastic leukemia Homo sapiens CVCL_6865
KOCL-69 B acute lymphoblastic leukemia Homo sapiens CVCL_3995
KOPN-1 B acute lymphoblastic leukemia Homo sapiens CVCL_3937
LN-18 Glioblastoma Homo sapiens CVCL_0392
LN-229 Glioblastoma Homo sapiens CVCL_0393
MA9.3 (MA9.3)
MA9.6ITD (MLL-AF9 plus FLT3-ITD)
MA9.6RAS (MLL-AF9 plus NRasG12D)
MA9.6 (MLL-AF9)
MA9.6ITD (MLL-AF9 plus FLT3-ITD)
MA9.6RAS (MLL-AF9 plus NRasG12D)
ME-1 [Human leukemia] Adult acute myeloid leukemia Homo sapiens CVCL_2110
ML-2 Adult acute myeloid leukemia Homo sapiens CVCL_1418
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
PL21 Familial adenomatous polyposis Homo sapiens CVCL_JM48
T98G Glioblastoma Homo sapiens CVCL_0556
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
In-vivo Model For R-2HG injection mouse models, sensitive (NOMO-1 and MA9.3ITD) or resistant (MA9.3RAS) cells were injected into NSGS or NRGS intravenously, and then R-2HG (6mg/kg body weight) or PBS were injected once daily through tail vein for 12 consecutive days starting from day 11 post xeno-transplantation.
Response Summary This work demonstrates anti-tumor effects of 2HG in inhibiting proliferation/survival of FTO-high cancer cells via targeting FTO/m6A/MYC/CCAAT/enhancer-binding protein alpha (CEBPA) signaling.High levels of FTO sensitize leukemia cells to R-2HG, whereas hyperactivation of MYC signaling confers resistance that can be reversed by the inhibition of MYC signaling. R-2HG also displays anti-tumor activity in glioma. High levels of FTO sensitize leukemic cells to R-2HG, whereas hyperactivation of MYC signaling confers resistance that can be reversed by the inhibition of MYC signaling.
Experiment 2 Reporting the m6A-centered Drug Response of This Target Gene [9]
Responsed Disease Leukaemia ICD-11: 2B33.4
Target Regulation Down regulation
Cell Process Glutamine metabolism
Cell apoptosis
In-vitro Model 8-MG-BA Glioblastoma Homo sapiens CVCL_1052
A-172 Glioblastoma Homo sapiens CVCL_0131
DK-MG Glioblastoma Homo sapiens CVCL_1173
GaMG Glioblastoma Homo sapiens CVCL_1226
HEL Erythroleukemia Homo sapiens CVCL_0001
Jurkat T acute lymphoblastic leukemia Homo sapiens CVCL_0065
KOCL-45 B acute lymphoblastic leukemia Homo sapiens CVCL_3993
KOCL-48 Childhood acute monocytic leukemia Homo sapiens CVCL_6867
KOCL-50 B acute lymphoblastic leukemia Homo sapiens CVCL_6866
KOCL-51 B acute lymphoblastic leukemia Homo sapiens CVCL_6865
KOCL-69 B acute lymphoblastic leukemia Homo sapiens CVCL_3995
KOPN-1 B acute lymphoblastic leukemia Homo sapiens CVCL_3937
LN-18 Glioblastoma Homo sapiens CVCL_0392
LN-229 Glioblastoma Homo sapiens CVCL_0393
MA9.3 (MA9.3)
MA9.6ITD (MLL-AF9 plus FLT3-ITD)
MA9.6RAS (MLL-AF9 plus NRasG12D)
MA9.6 (MLL-AF9)
MA9.6ITD (MLL-AF9 plus FLT3-ITD)
MA9.6RAS (MLL-AF9 plus NRasG12D)
ME-1 [Human leukemia] Adult acute myeloid leukemia Homo sapiens CVCL_2110
ML-2 Adult acute myeloid leukemia Homo sapiens CVCL_1418
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
PL21 Familial adenomatous polyposis Homo sapiens CVCL_JM48
T98G Glioblastoma Homo sapiens CVCL_0556
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
In-vivo Model For R-2HG injection mouse models, sensitive (NOMO-1 and MA9.3ITD) or resistant (MA9.3RAS) cells were injected into NSGS or NRGS intravenously, and then R-2HG (6mg/kg body weight) or PBS were injected once daily through tail vein for 12 consecutive days starting from day 11 post xeno-transplantation.
Response Summary This work demonstrates anti-tumor effects of 2HG in inhibiting proliferation/survival of FTO-high cancer cells via targeting FTO/m6A/MYC/CCAAT/enhancer-binding protein alpha (CEBPA) signaling.High levels of FTO sensitize leukemia cells to R-2HG, whereas hyperactivation of MYC signaling confers resistance that can be reversed by the inhibition of MYC signaling. R-2HG also displays anti-tumor activity in glioma. High levels of FTO sensitize leukemic cells to R-2HG, whereas hyperactivation of MYC signaling confers resistance that can be reversed by the inhibition of MYC signaling.
Cyclic AMP-dependent transcription factor ATF-4 (ATF4)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: -1.42E+00
p-value: 2.68E-47
More Results Click to View More RNA-seq Results
Asparagine inhibitor [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [12]
Responsed Disease Colorectal cancer ICD-11: 2B91
Pathway Response mTOR signaling pathway hsa04150
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. ATF4 transcriptionally upregulated DDIT4 to suppress Cyclic AMP-dependent transcription factor ATF-4 (ATF4), which induced pro-survival autophagy during glutaminolysis inhibition.
Chloroquine [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [12]
Responsed Disease Colorectal cancer ICD-11: 2B91
Pathway Response mTOR signaling pathway hsa04150
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. ATF4 transcriptionally upregulated DDIT4 to suppress Cyclic AMP-dependent transcription factor ATF-4 (ATF4), which induced pro-survival autophagy during glutaminolysis inhibition.
Meclofenamate sodium [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [12]
Responsed Disease Colorectal cancer ICD-11: 2B91
Pathway Response mTOR signaling pathway hsa04150
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. Cyclic AMP-dependent transcription factor ATF-4 (ATF4) transcriptionally upregulated DDIT4 to suppress mTOR, which induced pro-survival autophagy during glutaminolysis inhibition.
Rapamycin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [12]
Responsed Disease Colorectal cancer ICD-11: 2B91
Pathway Response mTOR signaling pathway hsa04150
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. Cyclic AMP-dependent transcription factor ATF-4 (ATF4) transcriptionally upregulated DDIT4 to suppress mTOR, which induced pro-survival autophagy during glutaminolysis inhibition.
CB-839 [Phase 2]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [12]
Responsed Disease Colorectal cancer ICD-11: 2B91
Pathway Response mTOR signaling pathway hsa04150
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. Cyclic AMP-dependent transcription factor ATF-4 (ATF4) transcriptionally upregulated DDIT4 to suppress mTOR, which induced pro-survival autophagy during glutaminolysis inhibition.
GLS-IN-968 [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [12]
Responsed Disease Colorectal cancer ICD-11: 2B91
Pathway Response mTOR signaling pathway hsa04150
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. ATF4 transcriptionally upregulated DDIT4 to suppress Cyclic AMP-dependent transcription factor ATF-4 (ATF4), which induced pro-survival autophagy during glutaminolysis inhibition.
Cyclin-A2 (CCNA2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Cerebral cortex Mus musculus
Treatment: METTL3 (f/f, Emx1-cre) cerebral cortex
Control: Wild type cerebral cortex
GSE154992
Regulation
logFC: 7.89E-01
p-value: 6.22E-11
More Results Click to View More RNA-seq Results
Epigallocatechin gallate [Phase 3]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [13]
Responsed Disease Obesity ICD-11: 5B81
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process Adipogenesis
In-vitro Model 3T3-L1 Normal Mus musculus CVCL_0123
Response Summary m6A-dependent Cyclin-A2 (CCNA2) and CDK2 expressions mediated by FTO and YTHDF2 contributed to EGCG-induced adipogenesis inhibition.
Cyclin-dependent kinase 2 (CDK2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line B16-OVA cell line Mus musculus
Treatment: shFTO B16-OVA cells
Control: shNC B16-OVA cells
GSE154952
Regulation
logFC: 7.39E-01
p-value: 1.49E-28
More Results Click to View More RNA-seq Results
Epigallocatechin gallate [Phase 3]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [13]
Responsed Disease Obesity ICD-11: 5B81
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process Adipogenesis
In-vitro Model 3T3-L1 Normal Mus musculus CVCL_0123
Response Summary m6A-dependent CCNA2 and Cyclin-dependent kinase 2 (CDK2) expressions mediated by FTO and YTHDF2 contributed to EGCG-induced adipogenesis inhibition.
DNA damage-inducible transcript 3 protein (DDIT3/CHOP)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 7.94E-01
p-value: 7.54E-04
More Results Click to View More RNA-seq Results
Cisplatin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [19]
Responsed Disease Gastric cancer ICD-11: 2B72
Target Regulation Down regulation
Pathway Response mTOR signaling pathway hsa04150
Apoptosis hsa04210
Cell Process Cell apoptosis
In-vitro Model AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
Response Summary Omeprazole pretreatment could enhance the inhibitory effect of 5-Fu, DDP and TAX on gastric cancer cells. FTO inhibition induced by omeprazole enhanced the activation of mTORC1 signal pathway that inhibited the prosurvival autophagy so as to improve the antitumor efficiency of chemotherapeutic drugs on GC cells. Meanwhile, transcript level of DNA damage-inducible transcript 3 protein (DDIT3), which is an apoptosis-related tumor suppressor gene downstream of mTORC1, was regulated by omeprazole-induced FTO silence through an m6A-dependent mechanism. m6A modification and its eraser FTO plays a role in the improvement of chemosensitivity mediated by proton pump inhibitor omeprazole.
Fluorouracil [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [19]
Responsed Disease Gastric cancer ICD-11: 2B72
Target Regulation Down regulation
Pathway Response mTOR signaling pathway hsa04150
Apoptosis hsa04210
Cell Process Cell apoptosis
In-vitro Model AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
Response Summary Omeprazole pretreatment could enhance the inhibitory effect of 5-Fu, DDP and TAX on gastric cancer cells. FTO inhibition induced by omeprazole enhanced the activation of mTORC1 signal pathway that inhibited the prosurvival autophagy so as to improve the antitumor efficiency of chemotherapeutic drugs on GC cells. Meanwhile, transcript level of DNA damage-inducible transcript 3 protein (DDIT3), which is an apoptosis-related tumor suppressor gene downstream of mTORC1, was regulated by omeprazole-induced FTO silence through an m6A-dependent mechanism. m6A modification and its eraser FTO plays a role in the improvement of chemosensitivity mediated by proton pump inhibitor omeprazole.
Paclitaxel [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [19]
Responsed Disease Gastric cancer ICD-11: 2B72
Target Regulation Down regulation
Pathway Response mTOR signaling pathway hsa04150
Apoptosis hsa04210
Cell Process Cell apoptosis
In-vitro Model AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
Response Summary Omeprazole pretreatment could enhance the inhibitory effect of 5-Fu, DDP and TAX on gastric cancer cells. FTO inhibition induced by omeprazole enhanced the activation of mTORC1 signal pathway that inhibited the prosurvival autophagy so as to improve the antitumor efficiency of chemotherapeutic drugs on GC cells. Meanwhile, transcript level of DNA damage-inducible transcript 3 protein (DDIT3), which is an apoptosis-related tumor suppressor gene downstream of mTORC1, was regulated by omeprazole-induced FTO silence through an m6A-dependent mechanism. m6A modification and its eraser FTO plays a role in the improvement of chemosensitivity mediated by proton pump inhibitor omeprazole.
Frizzled-10 (FZD10)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Mouse hippocampus Mus musculus
Treatment: FTO knockout mice hippocampus
Control: Wild type hippocampus
GSE94098
Regulation
logFC: -6.03E-01
p-value: 7.74E-04
More Results Click to View More RNA-seq Results
PARPi [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [21]
Responsed Disease Malignant mixed epithelial mesenchymal tumour of ovary ICD-11: 2B5D.0
Target Regulation Down regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model UWB1.289 Ovarian carcinoma Homo sapiens CVCL_B079
PEO1 Ovarian cystadenocarcinoma Homo sapiens CVCL_2686
In-vivo Model 2 × 107 PARP inhibitor resistant PEO1 cells were suspended in 200 uL PBS : Matrigel (1:1) unilaterally injected subcutaneously into the right dorsal flank of 6-8 week-old female immunocompromised non-obese diabetic/severe combined immunodeficiency (NOD/SCID) gamma (NSG) mice. When the average tumor size reached ~100 mm3, the mice were then randomized into four groups and treated with vehicle control, Olaparib (50 mg/kg), XAV939 (5 mg/kg) or a combination daily for 18 days.
Response Summary Downregulation of m6A demethylases FTO and ALKBH5 was sufficient to increase Frizzled-10 (FZD10) mRNA m6A modification and reduce PARPi sensitivity, the finding elucidates a novel regulatory mechanism of PARPi resistance in EOC by showing that m6A modification of FZD10 mRNA contributes to PARPi resistance in BRCA-deficient EOC cells via upregulation of Wnt/Bete-catenin pathway.
Heat shock factor protein 1 (HSF1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: -7.09E-01
p-value: 1.48E-02
More Results Click to View More RNA-seq Results
Bortezomib [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [25]
Responsed Disease Multiple myeloma ICD-11: 2A83.1
Target Regulation Up regulation
In-vitro Model RPMI-8226 Plasma cell myeloma Homo sapiens CVCL_0014
MM1.R Plasma cell myeloma Homo sapiens CVCL_8794
In-vivo Model A total of 3×106 RPMI8226/MM1R-Luc cells were intravenously injected into NCG mice to establish a disseminated human MM xenograft model. The in vivo antitumor effect of the FTO inhibitor MA2 combined with or without the first-line chemotherapeutic agent BTZ was evaluated as follows: 3 days post xenotransplantation, MA2 (20 mg/kg), or vehicle control was injected intraperitoneally (i.p.) daily for 10 days, and BTZ was injected intraperitoneally on days 1, 4, 8, and 11. Mouse serum was collected at specified time points during the treatment, and the tumor burden was monitored by detecting myeloma cell-secreted Lambda light chains via a Human Lambda ELISA Kit (Bethyl Laboratories, No. E88-116). Tumor development was monitored weekly after treatment with an in vivo imaging system (IVIS, SI Imaging, Lago, and LagoX). Luciferin (150 mg/kg, YEASEN, Shanghai, China) was injected intraperitoneally into the mice.
Response Summary FTO significantly promotes MM cell proliferation, migration, and invasion by targeting Heat shock factor protein 1 (HSF1)/HSPs in a YTHDF2-dependent manner. FTO inhibition, especially when combined with bortezomib (BTZ) treatment, synergistically inhibited myeloma bone tumor formation and extramedullary spread in NCG mice.
Intercellular adhesion molecule 1 (ICAM1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 1.83E+00
p-value: 2.17E-03
More Results Click to View More RNA-seq Results
Atorvastatin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [29]
Responsed Disease Vascular diseases ICD-11: BE2Z
Target Regulation Up regulation
In-vitro Model THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
HUVEC-C Normal Homo sapiens CVCL_2959
HEK293T Normal Homo sapiens CVCL_0063
Response Summary FTO overexpression significantly upregulated the mRNA and protein levels of VCAM-1 and Intercellular adhesion molecule 1 (ICAM1), downregulated those of KLF2 and eNOS, and strongly attenuated the atorvastatin-mediated induction of KLF2 and eNOS expression. FTO could serve as a novel molecular target to modulate endothelial function in vascular diseases.
Krueppel-like factor 2 (KLF2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line B16F10 cell line Mus musculus
Treatment: FTO knockout B16F10 cells
Control: B16F10 cells
GSE134388
Regulation
logFC: -1.68E+00
p-value: 3.25E-02
More Results Click to View More RNA-seq Results
Atorvastatin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [29]
Responsed Disease Vascular diseases ICD-11: BE2Z
Target Regulation Down regulation
In-vitro Model THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
HUVEC-C Normal Homo sapiens CVCL_2959
HEK293T Normal Homo sapiens CVCL_0063
Response Summary FTO overexpression significantly upregulated the mRNA and protein levels of VCAM-1 and ICAM-1, downregulated those of Krueppel-like factor 2 (KLF2) and eNOS, and strongly attenuated the atorvastatin-mediated induction of KLF2 and eNOS expression. FTO could serve as a novel molecular target to modulate endothelial function in vascular diseases.
Leukocyte immunoglobulin-like receptor subfamily B member 4 (LILRB4)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Mouse liver Mus musculus
Treatment: FTO knockout mouse liver tissue
Control: Wild type mouse liver tissue
GSE125785
Regulation
logFC: 1.12E+00
p-value: 2.09E-02
More Results Click to View More RNA-seq Results
Meclofenamic acid [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [30]
Responsed Disease Acute myeloid leukaemia ICD-11: 2A60
Target Regulation Down regulation
Pathway Response B cell receptor signaling pathway hsa04662
Cell Process Immune Evasion
In-vitro Model MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
In-vivo Model For each experiment, 6- to 8-week-old mice were used and randomly allocated to each group. For xenograft mouse, 0.1 × 106 MA9.3ITD cells were transplanted into NRGS recipient mice intravenously. Drug treatment was started from 10 days after transplantation. CS2 was administered through intraperitoneal (i.p.) injection at 5mg/kg/day, every other day. CS1 dissolved in saturated Beta-cyclodextrin (C0926, Sigma-Aldrich) solution was delivered by intravenous injection (i.v.). Successful engraftment was observed following 4 weeks post inoculation displaying a level of about 5% human CD33+ cells in peripheral. To generate PDX mouse models, 1 × 106 AML patient derived BMMNCs were transplanted into NRGS recipient mice intravenously, and drug treatment was started from 7 days later. CS2, FB23-2, and free CS1 were administered through i.p. injection at 5 mg/kg/day, while Micelle (900661, Sigma-Aldrich) packaged CS1 was delivered by i.v. injection at 5mg/kg/day. Both CS1 and CS2 were injected every other day for a total of ten times.
Response Summary Genetic depletion and pharmacological inhibition of FTO dramatically attenuate leukemia stem/initiating cell self-renewal and reprogram immune response by suppressing expression of immune checkpoint genes, especially Leukocyte immunoglobulin-like receptor subfamily B member 4 (LILRB4). FTO inhibitors, such as rhein, meclofenamic acid (MA), MO-I-500, fluorescein, and R-2HG, can inhibit acute myeloid leukemia cell viability. CS1 and CS2 displayed a much higher efficacy in inhibiting AML cell viability.
R-2HG [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [30]
Responsed Disease Acute myeloid leukaemia ICD-11: 2A60
Target Regulation Down regulation
Pathway Response B cell receptor signaling pathway hsa04662
Cell Process Immune Evasion
In-vitro Model MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
In-vivo Model For each experiment, 6- to 8-week-old mice were used and randomly allocated to each group. For xenograft mouse, 0.1 × 106 MA9.3ITD cells were transplanted into NRGS recipient mice intravenously. Drug treatment was started from 10 days after transplantation. CS2 was administered through intraperitoneal (i.p.) injection at 5mg/kg/day, every other day. CS1 dissolved in saturated Beta-cyclodextrin (C0926, Sigma-Aldrich) solution was delivered by intravenous injection (i.v.). Successful engraftment was observed following 4 weeks post inoculation displaying a level of about 5% human CD33+ cells in peripheral. To generate PDX mouse models, 1 × 106 AML patient derived BMMNCs were transplanted into NRGS recipient mice intravenously, and drug treatment was started from 7 days later. CS2, FB23-2, and free CS1 were administered through i.p. injection at 5 mg/kg/day, while Micelle (900661, Sigma-Aldrich) packaged CS1 was delivered by i.v. injection at 5mg/kg/day. Both CS1 and CS2 were injected every other day for a total of ten times.
Response Summary Genetic depletion and pharmacological inhibition of FTO dramatically attenuate leukemia stem/initiating cell self-renewal and reprogram immune response by suppressing expression of immune checkpoint genes, especially Leukocyte immunoglobulin-like receptor subfamily B member 4 (LILRB4). FTO inhibitors, such as rhein, meclofenamic acid (MA), MO-I-500, fluorescein, and R-2HG, can inhibit acute myeloid leukemia cell viability. CS1 and CS2 displayed a much higher efficacy in inhibiting AML cell viability.
Myc proto-oncogene protein (MYC)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: -6.81E-01
p-value: 3.45E-03
More Results Click to View More RNA-seq Results
R-2HG [Investigative]
In total 2 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [9]
Responsed Disease Glioma ICD-11: 2A00.0
Target Regulation Down regulation
Cell Process Glutamine metabolism
Cell apoptosis
In-vitro Model 8-MG-BA Glioblastoma Homo sapiens CVCL_1052
A-172 Glioblastoma Homo sapiens CVCL_0131
DK-MG Glioblastoma Homo sapiens CVCL_1173
GaMG Glioblastoma Homo sapiens CVCL_1226
HEL Erythroleukemia Homo sapiens CVCL_0001
Jurkat T acute lymphoblastic leukemia Homo sapiens CVCL_0065
KOCL-45 B acute lymphoblastic leukemia Homo sapiens CVCL_3993
KOCL-48 Childhood acute monocytic leukemia Homo sapiens CVCL_6867
KOCL-50 B acute lymphoblastic leukemia Homo sapiens CVCL_6866
KOCL-51 B acute lymphoblastic leukemia Homo sapiens CVCL_6865
KOCL-69 B acute lymphoblastic leukemia Homo sapiens CVCL_3995
KOPN-1 B acute lymphoblastic leukemia Homo sapiens CVCL_3937
LN-18 Glioblastoma Homo sapiens CVCL_0392
LN-229 Glioblastoma Homo sapiens CVCL_0393
MA9.3 (MA9.3)
MA9.6ITD (MLL-AF9 plus FLT3-ITD)
MA9.6RAS (MLL-AF9 plus NRasG12D)
MA9.6 (MLL-AF9)
MA9.6ITD (MLL-AF9 plus FLT3-ITD)
MA9.6RAS (MLL-AF9 plus NRasG12D)
ME-1 [Human leukemia] Adult acute myeloid leukemia Homo sapiens CVCL_2110
ML-2 Adult acute myeloid leukemia Homo sapiens CVCL_1418
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
PL21 Familial adenomatous polyposis Homo sapiens CVCL_JM48
T98G Glioblastoma Homo sapiens CVCL_0556
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
In-vivo Model For R-2HG injection mouse models, sensitive (NOMO-1 and MA9.3ITD) or resistant (MA9.3RAS) cells were injected into NSGS or NRGS intravenously, and then R-2HG (6mg/kg body weight) or PBS were injected once daily through tail vein for 12 consecutive days starting from day 11 post xeno-transplantation.
Response Summary This work demonstrates anti-tumor effects of 2HG in inhibiting proliferation/survival of FTO-high cancer cells via targeting FTO/m6A/Myc proto-oncogene protein (MYC)/CEBPA signaling.High levels of FTO sensitize leukemia cells to R-2HG, whereas hyperactivation of MYC signaling confers resistance that can be reversed by the inhibition of MYC signaling. R-2HG also displays anti-tumor activity in glioma. High levels of FTO sensitize leukemic cells to R-2HG, whereas hyperactivation of MYC signaling confers resistance that can be reversed by the inhibition of MYC signaling.
Experiment 2 Reporting the m6A-centered Drug Response of This Target Gene [9]
Responsed Disease Leukaemia ICD-11: 2B33.4
Target Regulation Down regulation
Cell Process Glutamine metabolism
Cell apoptosis
In-vitro Model 8-MG-BA Glioblastoma Homo sapiens CVCL_1052
A-172 Glioblastoma Homo sapiens CVCL_0131
DK-MG Glioblastoma Homo sapiens CVCL_1173
GaMG Glioblastoma Homo sapiens CVCL_1226
HEL Erythroleukemia Homo sapiens CVCL_0001
Jurkat T acute lymphoblastic leukemia Homo sapiens CVCL_0065
KOCL-45 B acute lymphoblastic leukemia Homo sapiens CVCL_3993
KOCL-48 Childhood acute monocytic leukemia Homo sapiens CVCL_6867
KOCL-50 B acute lymphoblastic leukemia Homo sapiens CVCL_6866
KOCL-51 B acute lymphoblastic leukemia Homo sapiens CVCL_6865
KOCL-69 B acute lymphoblastic leukemia Homo sapiens CVCL_3995
KOPN-1 B acute lymphoblastic leukemia Homo sapiens CVCL_3937
LN-18 Glioblastoma Homo sapiens CVCL_0392
LN-229 Glioblastoma Homo sapiens CVCL_0393
MA9.3 (MA9.3)
MA9.6ITD (MLL-AF9 plus FLT3-ITD)
MA9.6RAS (MLL-AF9 plus NRasG12D)
MA9.6 (MLL-AF9)
MA9.6ITD (MLL-AF9 plus FLT3-ITD)
MA9.6RAS (MLL-AF9 plus NRasG12D)
ME-1 [Human leukemia] Adult acute myeloid leukemia Homo sapiens CVCL_2110
ML-2 Adult acute myeloid leukemia Homo sapiens CVCL_1418
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
PL21 Familial adenomatous polyposis Homo sapiens CVCL_JM48
T98G Glioblastoma Homo sapiens CVCL_0556
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
In-vivo Model For R-2HG injection mouse models, sensitive (NOMO-1 and MA9.3ITD) or resistant (MA9.3RAS) cells were injected into NSGS or NRGS intravenously, and then R-2HG (6mg/kg body weight) or PBS were injected once daily through tail vein for 12 consecutive days starting from day 11 post xeno-transplantation.
Response Summary This work demonstrates anti-tumor effects of 2HG in inhibiting proliferation/survival of FTO-high cancer cells via targeting FTO/m6A/Myc proto-oncogene protein (MYC)/CEBPA signaling.High levels of FTO sensitize leukemia cells to R-2HG, whereas hyperactivation of MYC signaling confers resistance that can be reversed by the inhibition of MYC signaling. R-2HG also displays anti-tumor activity in glioma. High levels of FTO sensitize leukemic cells to R-2HG, whereas hyperactivation of MYC signaling confers resistance that can be reversed by the inhibition of MYC signaling.
44/ZLD115 [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [99]
Target Regulation Up regulation
In-vitro Model NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
KG-1 Adult acute myeloid leukemia Homo sapiens CVCL_0374
FB23 [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [99]
Target Regulation Up regulation
In-vitro Model NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
KG-1 Adult acute myeloid leukemia Homo sapiens CVCL_0374
Neutral amino acid transporter B(0) (SLC1A5)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: -1.02E+00
p-value: 5.80E-30
More Results Click to View More RNA-seq Results
GLS-IN-968 [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [41]
Responsed Disease Renal cell carcinoma ICD-11: 2C90
Target Regulation Up regulation
Pathway Response Central carbon metabolism in cancer hsa05230
HIF-1 signaling pathway hsa04066
Central carbon metabolism in cancer hsa05230
Metabolic pathways hsa01100
VEGF signaling pathway hsa04370
In-vitro Model UMRC2-vec (CCRCC isogenic cell lines that are VHL-deficient)
Response Summary Genetic inactivation of FTO using multiple orthogonal approaches revealed that FTO inhibition selectively reduces the growth and survival of VHL-deficient cells in vitro and in vivo. Integrated analysis of transcriptome-wide m6A-seq and mRNA-seq analysis identified the glutamine transporter Neutral amino acid transporter B(0) (SLC1A5) as an FTO target that promotes metabolic reprogramming and survival of VHL-deficient ccRCC cells. GLS1 inhibitors that target mitochondrial glutaminase and the conversion of glutamine to glutamate are currently being evaluated in early-phase clinical trials in ccRCC. These findings identify FTO as a potential HIF-independent therapeutic target for the treatment of VHL-deficient renal cell carcinoma.
PDH kinase 1 (PDK1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: -7.19E-01
p-value: 8.18E-03
More Results Click to View More RNA-seq Results
Temozolomide [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [43]
Responsed Disease Glioblastoma ICD-11: 2A00.00
Target Regulation Up regulation
Pathway Response Citrate cycle hsa00020
Central carbon metabolism in cancer hsa05230
Cell Process Aerobic glycolysis
Cell apoptosis
In-vitro Model LN-18 Glioblastoma Homo sapiens CVCL_0392
LN-229 Glioblastoma Homo sapiens CVCL_0393
SHG-44 Astrocytoma Homo sapiens CVCL_6728
U251 (Fibroblasts or fibroblast like cells)
U87 (A primary glioblastoma cell line)
Response Summary Long noncoding RNA just proximal to X-inactive specific transcript facilitates aerobic glycolysis and temozolomide chemoresistance by promoting stability of PDH kinase 1 (PDK1) mRNA in an m6A-dependent manner in glioblastoma multiforme cells. JPX interacted with N6-methyladenosine (m6A) demethylase FTO alpha-ketoglutarate dependent dioxygenase (FTO) and enhanced FTO-mediated PDK1 mRNA demethylation.
Sequestosome-1 (SQSTM1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: 6.53E-01
p-value: 1.38E-07
More Results Click to View More RNA-seq Results
Rapamycin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [53]
Target Regulation Down regulation
Pathway Response Autophagy hsa04140
Cell Process RNA stability
Cell autophagy
In-vitro Model HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Response Summary The m6A changes caused by FTO influence the stability of ULK1 transcripts, likely through a YTHDF2-dependent manner.Under both basal and rapamycin-induced autophagy conditions, depletion of FTO significantly reduced the formation of GFP-LC3B puncta. The level of Sequestosome-1 (SQSTM1)/SQSTM1 (an autophagy substrate) was higher in FTO-knockdown cells than that in control cells. FTO specifically upregulates the ULK1 protein abundance. ULK1 mRNA undergoes m6A modification in the 3'-UTR and the m6A-marked ULK1 transcripts can further be targeted for degradation by YTHDF2.
Canagliflozin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [117]
Responsed Disease Macroscopic changes of size of the kidney ICD-11: MF54.0
Target Regulation Down regulation
In-vitro Model HK2 Normal Acipenser baerii CVCL_YE28
Serine/threonine-protein kinase ULK1 (ULK1/ATG1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line 253J cell line Homo sapiens
Treatment: siFTO 253J cells
Control: 253J cells
GSE150239
Regulation
logFC: -6.13E-01
p-value: 1.25E-06
More Results Click to View More RNA-seq Results
Rapamycin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [53]
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process RNA stability
Cell autophagy
In-vitro Model HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Response Summary The m6A changes caused by FTO influence the stability of ULK1 transcripts, likely through a YTHDF2-dependent manner.Under both basal and rapamycin-induced autophagy conditions, depletion of FTO significantly reduced the formation of GFP-LC3B puncta. The level of p62/SQSTM1 (an autophagy substrate) was higher in FTO-knockdown cells than that in control cells. FTO specifically upregulates the Serine/threonine-protein kinase ULK1 (ULK1) protein abundance. ULK1 mRNA undergoes m6A modification in the 3'-UTR and the m6A-marked ULK1 transcripts can further be targeted for degradation by YTHDF2.
Cisplatin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [55]
Responsed Disease Gastric cancer ICD-11: 2B72
Target Regulation Up regulation
In-vitro Model GES-1 Normal Homo sapiens CVCL_EQ22
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
In-vivo Model A total of 5 × 106 cells in 200 ul PBS were injected subcutaneously into the flanks of nude mice. After injection, cisplatin treatment was initiated on day 5. Mice were injected with 5 mg/kg cisplatin or PBS solution in the abdominal cavity once a week for 3 weeks.
Response Summary Knockdown of FTO reversed cisplatin resistance of SGC-7901/DDP cells both in vitro and in vivo, which was attributed to the inhibition of Serine/threonine-protein kinase ULK1 (ULK1)-mediated autophagy. These findings indicate that the FTO/ULK1 axis exerts crucial roles in cisplatin resistance of gastric cancer.
Superoxide dismutase [Mn], mitochondrial (SOD2)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line NB4 cell line Homo sapiens
Treatment: shFTO NB4 cells
Control: shNS NB4 cells
GSE103494
Regulation
logFC: 8.09E-01
p-value: 6.85E-03
More Results Click to View More RNA-seq Results
Bortezomib [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [56]
Responsed Disease Multiple myeloma ICD-11: 2A83.1
Target Regulation Down regulation
Response Summary FTO promotes Bortezomib resistance via m6A-dependent destabilization of Superoxide dismutase [Mn], mitochondrial (SOD2) expression in multiple myeloma.
Transcription factor SOX-10 (SOX10)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Cerebral cortex Mus musculus
Treatment: METTL3 (f/f, Emx1-cre) cerebral cortex
Control: Wild type cerebral cortex
GSE154992
Regulation
logFC: -8.13E-01
p-value: 2.61E-03
More Results Click to View More RNA-seq Results
PMID31239444-anti-PD1 antibody [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [7]
Responsed Disease Melanoma ICD-11: 2C30
Target Regulation Up regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Cell Process mRNA decay
In-vitro Model B16-F10 Mouse melanoma Mus musculus CVCL_0159
CHL-1 Melanoma Homo sapiens CVCL_1122
624-mel Melanoma Homo sapiens CVCL_8054
NHEM (Normal Human Epidermal Melanocytes)
SK-MEL-30 Cutaneous melanoma Homo sapiens CVCL_0039
WM115 Melanoma Homo sapiens CVCL_0040
WM35 Melanoma Homo sapiens CVCL_0580
WM3670 Melanoma Homo sapiens CVCL_6799
WM793 Melanoma Homo sapiens CVCL_8787
In-vivo Model When the tumors reached a volume of 80-100 mm3, mice were treated with anti-PD-1 or isotype control antibody (200 ug/mouse) by i.p. injection, every other day for three times. For IFNγ blockade treatment, C57BL/6 mice were treated with anti-IFNγ antibody or isotype control IgG (250 ug/mouse) every other day after tumor cell inoculation.
Response Summary These findings demonstrate a crucial role of FTO as an m6A demethylase in promoting melanoma tumorigenesis and anti-PD-1 resistance, and suggest that the combination of FTO inhibition with anti-PD-1 blockade reduces the resistance to immunotherapy in melanoma. Knockdown of FTO increases m6A methylation in the critical protumorigenic melanoma cell-intrinsic genes including PD-1 (PDCD1), CXCR4, and Transcription factor SOX-10 (SOX10), leading to increased RNA decay through the m6A reader YTHDF2.
Vascular cell adhesion protein 1 (VCAM1)
Representative RNA-seq result indicating the expression of this target gene regulated by FTO
Cell Line Mouse hippocampus Mus musculus
Treatment: FTO knockout mice hippocampus
Control: Wild type hippocampus
GSE94098
Regulation
logFC: 6.17E-01
p-value: 3.60E-03
More Results Click to View More RNA-seq Results
Atorvastatin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [29]
Responsed Disease Vascular diseases ICD-11: BE2Z
Target Regulation Up regulation
In-vitro Model THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
HUVEC-C Normal Homo sapiens CVCL_2959
HEK293T Normal Homo sapiens CVCL_0063
Response Summary FTO overexpression significantly upregulated the mRNA and protein levels of Vascular cell adhesion protein 1 (VCAM1) and ICAM-1, downregulated those of KLF2 and eNOS, and strongly attenuated the atorvastatin-mediated induction of KLF2 and eNOS expression. FTO could serve as a novel molecular target to modulate endothelial function in vascular diseases.
Autophagy protein 5 (ATG5)
Dac51 [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [67]
Responsed Disease Diabetes ICD-11: 5A10-5A14
In-vitro Model MIN6 Mouse insulinoma Mus musculus CVCL_0431
Cellular tumor antigen p53 (TP53/p53)
Erianin [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [73]
Responsed Disease Renal cell carcinoma ICD-11: 2C90
Target Regulation Up regulation
Cisplatin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [74]
Responsed Disease Acute kidney failure ICD-11: GB60
Target Regulation Down regulation
Pathway Response Apoptosis hsa04210
Cell Process Cell apoptosis
In-vitro Model HK2 Normal Acipenser baerii CVCL_YE28
In-vivo Model Induced AKI in c57BL/6 mice by intraperitoneal cisplatin injection and treated the animal with vehicle or an FTO inhibitor meclofenamic acid (MA) for 3 days.
Response Summary Meclofenamic acid increased Cellular tumor antigen p53 (TP53/p53) mRNA and protein levels in AKI both in vitro and in vivo, and FTO overexpression reduced p53 expression and reversed the MA-induced p53 increase in cisplatin-induced acute kidney injury Acute kidney injury.
Meclofenamic acid [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [74]
Responsed Disease Acute kidney failure ICD-11: GB60
Target Regulation Down regulation
Pathway Response Apoptosis hsa04210
Cell Process Cell apoptosis
In-vitro Model HK2 Normal Acipenser baerii CVCL_YE28
In-vivo Model Induced AKI in c57BL/6 mice by intraperitoneal cisplatin injection and treated the animal with vehicle or an FTO inhibitor meclofenamic acid (MA) for 3 days.
Response Summary Meclofenamic acid increased Cellular tumor antigen p53 (TP53/p53) mRNA and protein levels in AKI both in vitro and in vivo, and FTO overexpression reduced p53 expression and reversed the MA-induced p53 increase in cisplatin-induced Acute kidney injury.
Constitutive NOS (eNOS)
Atorvastatin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [29]
Responsed Disease Vascular diseases ICD-11: BE2Z
Target Regulation Down regulation
In-vitro Model THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
HUVEC-C Normal Homo sapiens CVCL_2959
HEK293T Normal Homo sapiens CVCL_0063
Response Summary FTO overexpression significantly upregulated the mRNA and protein levels of VCAM-1 and ICAM-1, downregulated those of KLF2 and Constitutive NOS (eNOS), and strongly attenuated the atorvastatin-mediated induction of KLF2 and eNOS expression. FTO could serve as a novel molecular target to modulate endothelial function in vascular diseases.
Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1)
Rapamycin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [82]
Responsed Disease Oral squamous cell carcinoma ICD-11: 2B6E.0
Target Regulation Up regulation
Pathway Response Autophagy hsa04140
Cell Process Cell autophagy
Response Summary Rapamycin inhibited FTO activity, and directly targeted Eukaryotic translation initiation factor 4 gamma 1 (EIF4G1) transcripts and mediated their expression in an m6A-dependent manner in oral squamous cell carcinoma. After FTO silencing, YTHDF2 captured eIF4G1 transcripts containing m6A, resulting in mRNA degradation and decreased expression of eIF4G1 protein, thereby promoting autophagy and reducing tumor occurrence.
Forkhead box protein O3 (FOXO3)
Cytarabine [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [85]
Responsed Disease Acute myeloid leukaemia ICD-11: 2A60
Target Regulation Down regulation
In-vitro Model MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
HL-60 Adult acute myeloid leukemia Homo sapiens CVCL_0002
In-vivo Model Cg-Prkdcscid Il2rgtm1Vst/Vst (NPG) mice (6 weeks old) were divided into three groups and implanted with 4 × 106 cells of control (MV4-11 NC) or FTO-knockdown (MV4-11 KD-1 or KD-2) by tail vein injection, respectively.
Mammalian target of rapamycin complex 1 (mTORC1)
Cisplatin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [19]
Responsed Disease Gastric cancer ICD-11: 2B72
Target Regulation Down regulation
Pathway Response mTOR signaling pathway hsa04150
Cell Process Cell apoptosis
In-vitro Model AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
Response Summary Omeprazole pretreatment could enhance the inhibitory effect of 5-Fu, DDP and TAX on gastric cancer cells. FTO inhibition induced by omeprazole enhanced the activation of Mammalian target of rapamycin complex 1 (mTORC1) signal pathway that inhibited the prosurvival autophagy so as to improve the antitumor efficiency of chemotherapeutic drugs on GC cells. Meanwhile, transcript level of DDIT3, which is an apoptosis-related tumor suppressor gene downstream of mTORC1, was regulated by omeprazole-induced FTO silence through an m6A-dependent mechanism. m6A modification and its eraser FTO plays a role in the improvement of chemosensitivity mediated by proton pump inhibitor omeprazole.
Fluorouracil [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [19]
Responsed Disease Gastric cancer ICD-11: 2B72
Target Regulation Down regulation
Pathway Response mTOR signaling pathway hsa04150
Cell Process Cell apoptosis
In-vitro Model AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
Response Summary Omeprazole pretreatment could enhance the inhibitory effect of 5-Fu, DDP and TAX on gastric cancer cells. FTO inhibition induced by omeprazole enhanced the activation of Mammalian target of rapamycin complex 1 (mTORC1) signal pathway that inhibited the prosurvival autophagy so as to improve the antitumor efficiency of chemotherapeutic drugs on GC cells. Meanwhile, transcript level of DDIT3, which is an apoptosis-related tumor suppressor gene downstream of mTORC1, was regulated by omeprazole-induced FTO silence through an m6A-dependent mechanism. m6A modification and its eraser FTO plays a role in the improvement of chemosensitivity mediated by proton pump inhibitor omeprazole.
Paclitaxel [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [19]
Responsed Disease Gastric cancer ICD-11: 2B72
Target Regulation Down regulation
Pathway Response mTOR signaling pathway hsa04150
Cell Process Cell apoptosis
In-vitro Model AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
Response Summary Omeprazole pretreatment could enhance the inhibitory effect of 5-Fu, DDP and TAX on gastric cancer cells. FTO inhibition induced by omeprazole enhanced the activation of Mammalian target of rapamycin complex 1 (mTORC1) signal pathway that inhibited the prosurvival autophagy so as to improve the antitumor efficiency of chemotherapeutic drugs on GC cells. Meanwhile, transcript level of DDIT3, which is an apoptosis-related tumor suppressor gene downstream of mTORC1, was regulated by omeprazole-induced FTO silence through an m6A-dependent mechanism. m6A modification and its eraser FTO plays a role in the improvement of chemosensitivity mediated by proton pump inhibitor omeprazole.
Programmed cell death 1 (PD-1)
PMID31239444-anti-PD1 antibody [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [7]
Responsed Disease Melanoma ICD-11: 2C30
Target Regulation Up regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Cell Process mRNA decay
In-vitro Model B16-F10 Mouse melanoma Mus musculus CVCL_0159
CHL-1 Melanoma Homo sapiens CVCL_1122
624-mel Melanoma Homo sapiens CVCL_8054
NHEM (Normal Human Epidermal Melanocytes)
SK-MEL-30 Cutaneous melanoma Homo sapiens CVCL_0039
WM115 Melanoma Homo sapiens CVCL_0040
WM35 Melanoma Homo sapiens CVCL_0580
WM3670 Melanoma Homo sapiens CVCL_6799
WM793 Melanoma Homo sapiens CVCL_8787
In-vivo Model When the tumors reached a volume of 80-100 mm3, mice were treated with anti-PD-1 or isotype control antibody (200 ug/mouse) by i.p. injection, every other day for three times. For IFNγ blockade treatment, C57BL/6 mice were treated with anti-IFNγ antibody or isotype control IgG (250 ug/mouse) every other day after tumor cell inoculation.
Response Summary These findings demonstrate a crucial role of FTO as an m6A demethylase in promoting melanoma tumorigenesis and anti-PD-1 resistance, and suggest that the combination of FTO inhibition with anti-PD-1 blockade reduces the resistance to immunotherapy in melanoma. Knockdown of FTO increases m6A methylation in the critical protumorigenic melanoma cell-intrinsic genes including Programmed cell death 1 (PD-1) (PDCD1), CXCR4, and SOX10, leading to increased RNA decay through the m6A reader YTHDF2.
Retinoic acid receptor alpha (RARA)
Tretinoin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [2]
Responsed Disease Acute myeloid leukaemia ICD-11: 2A60
Target Regulation Down regulation
Cell Process RNA stability
RNA degradation (hsa03018)
In-vitro Model K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KOCL-48 Childhood acute monocytic leukemia Homo sapiens CVCL_6867
Mono-Mac-6 Adult acute monocytic leukemia Homo sapiens CVCL_1426
Response Summary FTO enhances leukemic oncogene-mediated cell transformation and leukemogenesis, and inhibits all-trans-retinoic acid (ATRA)-induced AML cell differentiation, through regulating expression of targets such as ASB2 and Retinoic acid receptor alpha (RARA) by reducing m6A levels in these mRNA transcripts.
Serine/threonine-protein kinase mTOR (MTOR)
Asparagine inhibitor [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [12]
Responsed Disease Colorectal cancer ICD-11: 2B91
Pathway Response mTOR signaling pathway hsa04150
Autophagy hsa04140
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. ATF4 transcriptionally upregulated DDIT4 to suppress Serine/threonine-protein kinase mTOR (MTOR), which induced pro-survival autophagy during glutaminolysis inhibition.
Chloroquine [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [12]
Responsed Disease Colorectal cancer ICD-11: 2B91
Pathway Response mTOR signaling pathway hsa04150
Autophagy hsa04140
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. ATF4 transcriptionally upregulated DDIT4 to suppress Serine/threonine-protein kinase mTOR (MTOR), which induced pro-survival autophagy during glutaminolysis inhibition.
Meclofenamate sodium [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [12]
Responsed Disease Colorectal cancer ICD-11: 2B91
Pathway Response mTOR signaling pathway hsa04150
Autophagy hsa04140
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. Serine/threonine-protein kinase mTOR (MTOR) transcriptionally upregulated DDIT4 to suppress mTOR, which induced pro-survival autophagy during glutaminolysis inhibition.
Rapamycin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [12]
Responsed Disease Colorectal cancer ICD-11: 2B91
Pathway Response mTOR signaling pathway hsa04150
Autophagy hsa04140
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. Serine/threonine-protein kinase mTOR (MTOR) transcriptionally upregulated DDIT4 to suppress mTOR, which induced pro-survival autophagy during glutaminolysis inhibition.
CB-839 [Phase 2]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [12]
Responsed Disease Colorectal cancer ICD-11: 2B91
Pathway Response mTOR signaling pathway hsa04150
Autophagy hsa04140
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. Serine/threonine-protein kinase mTOR (MTOR) transcriptionally upregulated DDIT4 to suppress mTOR, which induced pro-survival autophagy during glutaminolysis inhibition.
GLS-IN-968 [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [12]
Responsed Disease Colorectal cancer ICD-11: 2B91
Pathway Response mTOR signaling pathway hsa04150
Autophagy hsa04140
Cell Process RNA decay
Cell growth and death
Cell autophagy
In-vitro Model HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary In colorectal cancer, Glutaminolysis inhibition upregulated ATF4 expression in an m6A-dependent manner to activate pro-survival autophagy through transcriptional activation of the mTOR inhibitor DDIT4. Determined the relationship between FTO alpha-ketoglutarate dependent dioxygenase (FTO), YTH N6-methyladenosine RNA binding protein 2 (YTHDF2), and ATF4. ATF4 transcriptionally upregulated DDIT4 to suppress Serine/threonine-protein kinase mTOR (MTOR), which induced pro-survival autophagy during glutaminolysis inhibition.
Signal transducer and activator of transcription 3 (STAT3)
Doxil [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [119]
Responsed Disease Breast cancer ICD-11: 2C60
In-vitro Model MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Hs 578T Invasive breast carcinoma Homo sapiens CVCL_0332
Response Summary Decreased doxorubicin resistance by Signal transducer and activator of transcription 3 (STAT3) knockdown was abolished by FTO overexpression and decreased doxorubicin sensitivity by STAT3 overexpression was reversed by FTO knockdown, indicating that FTO was implicated in STAT3-mediated doxorubicin resistance and impairment of doxorubicin sensitivity of BC cells.
Ubiquitin carboxyl-terminal hydrolase 7 (USP7)
P22077 [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [125]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
Target Regulation Up regulation
Cell Process Ubiquitination degradation
In-vitro Model A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H522 Lung adenocarcinoma Homo sapiens CVCL_1567
HSAEC (Human small airway epithelial cells)
RERF-LC-A1 Lung squamous cell carcinoma Homo sapiens CVCL_4402
NCI-H1882 Lung small cell carcinoma Homo sapiens CVCL_1504
NCl-H466 (Human lung cancer cell line)
In-vivo Model Equal numbers of A549 cells expressing either control or shFTO were injected subcutaneously, within 30 min of harvesting, over the right and left flanks in male nu/nu mice between 4 and 6 weeks of age.
Response Summary The m6A demethylase FTO promotes the growth of Non-small cell lung cancer cells by increasing the expression of USP7.Genetic knockdown or pharmacological inhibition (P5091 or P22027) of Ubiquitin carboxyl-terminal hydrolase 7 (USP7) reduced the proliferation rate of lung cancer cells and decreased the capacity of colony formation of lung cancer cells in vitro, whereas lung cancer cells growth inhibition by FTO knockdown is restored by overexertion of USP7.
P5091 [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [125]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
Target Regulation Up regulation
Cell Process Ubiquitination degradation
In-vitro Model A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H522 Lung adenocarcinoma Homo sapiens CVCL_1567
HSAEC (Human small airway epithelial cells)
RERF-LC-A1 Lung squamous cell carcinoma Homo sapiens CVCL_4402
NCI-H1882 Lung small cell carcinoma Homo sapiens CVCL_1504
NCl-H466 (Human lung cancer cell line)
In-vivo Model Equal numbers of A549 cells expressing either control or shFTO were injected subcutaneously, within 30 min of harvesting, over the right and left flanks in male nu/nu mice between 4 and 6 weeks of age.
Response Summary The m6A demethylase FTO promotes the growth of Non-small cell lung cancer cells by increasing the expression of USP7.Genetic knockdown or pharmacological inhibition (P5091 or P22027) of Ubiquitin carboxyl-terminal hydrolase 7 (USP7) reduced the proliferation rate of lung cancer cells and decreased the capacity of colony formation of lung cancer cells in vitro, whereas lung cancer cells growth inhibition by FTO knockdown is restored by overexertion of USP7.
Ubiquitin-like protein ATG12 (ATG12)
Dac51 [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [67]
Responsed Disease Diabetes ICD-11: 5A10-5A14
In-vitro Model MIN6 Mouse insulinoma Mus musculus CVCL_0431
microRNA 155 (MIR155)
Temozolomide [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [133]
Responsed Disease Glioma ICD-11: 2A00.0
In-vitro Model A-172 Glioblastoma Homo sapiens CVCL_0131
HEK293T Normal Homo sapiens CVCL_0063
U251 (Fibroblasts or fibroblast like cells)
U87 (A primary glioblastoma cell line)
In-vivo Model Previously prepared U87 cells (5 × 106 cells, 60 uL) stably infected with miRNA were injected subcutaneously in the right flank of the mice, whereas control U87 cells infected with empty vector were injected in the left flank.
Response Summary FTO Inhibition Enhances the Antitumor Effect of Temozolomide by Targeting MYC-microRNA 155 (MIR155)/miR-23a Cluster-MXI1 Feedback Circuit in Glioma.
microRNA 23a (MIR23A)
Temozolomide [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [133]
Responsed Disease Glioma ICD-11: 2A00.0
In-vitro Model A-172 Glioblastoma Homo sapiens CVCL_0131
HEK293T Normal Homo sapiens CVCL_0063
U251 (Fibroblasts or fibroblast like cells)
U87 (A primary glioblastoma cell line)
In-vivo Model Previously prepared U87 cells (5 × 106 cells, 60 uL) stably infected with miRNA were injected subcutaneously in the right flank of the mice, whereas control U87 cells infected with empty vector were injected in the left flank.
Response Summary FTO Inhibition Enhances the Antitumor Effect of Temozolomide by Targeting MYC-miR-155/microRNA 23a (MIR23A) Cluster-MXI1 Feedback Circuit in Glioma.
Apoptosis regulatory protein Siva (SIVA1)
Fluorouracil [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [139]
Responsed Disease Colorectal cancer ICD-11: 2B91
Target Regulation Up regulation
In-vitro Model HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HEK293T Normal Homo sapiens CVCL_0063
MC-38 Mouse colon adenocarcinoma Mus musculus CVCL_B288
In-vivo Model For the tumor metastasis mouse model, 5-week-old C57BL/6 mice were randomly grouped and injected with 5 × 105 Control or shFTO stable MC38 cells via tail vein. Drug administration was adopted after 48 h. Drug administration (intraperitoneally): DMSO, 5-FU (50 mg/kg every 2 days) or Rhein (10 mg/kg every 2 days). To detect lung metastasis, mice were killed 2 weeks after tumor cell injection. Lung tissues were harvested and fixed with 4% PFA for paraffin-embedded section and lung metastases were detected with Nikon microscopy. For tumor intraperitoneal mouse model, 2 × 106 Dox-shCtrl, Dox-shFTO stable HCT8/5-FU cells were injected into 5-week-old male BALB/C nude mice. Drug administration was adopted after 48 h. Drug administration (intraperitoneally): DMSO, 5-FU (50 mg/kg every 2 days) or FB23-2 (10 mg/kg every 2 days). For tumor intraperitoneal mouse model, 5 × 105 shCtrl, shFTO-1, shFTO-2 stable MC38 cells were injected into 5-week-old C57BL/6 mice. Drug administration was adopted after 48 h. Drug administration (intraperitoneally): DMSO, 5-FU (50 mg/kg every 2 days) or Rhein (10 mg/kg every 2 days).
Autophagy-related protein 9A (ATG9A)
Dac51 [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [67]
Responsed Disease Diabetes ICD-11: 5A10-5A14
In-vitro Model MIN6 Mouse insulinoma Mus musculus CVCL_0431
E3 ubiquitin-protein ligase NEDD4 (NEDD4)
Gemcitabine [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [150]
Responsed Disease Pancreatic cancer ICD-11: 2C10
In-vitro Model Human Pancreatic Nestin-Expressing cells (Human Pancreatic Nestin-Expressing cells)
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
COLO 357 Pancreatic adenosquamous carcinoma Homo sapiens CVCL_0221
In-vivo Model Female athymic BALB/C nude mice received a subcutaneous injection of 5 × 106 cells into the axilla (4 weeks old, 18-20 g). The tumor volume (V) was calculated each week using the formula V = (W2 L)/2 after measuring the tumor width (W) and length (L). After the injection of cancer cells, for the gemcitabine treatment cohort, mice were injected with gemcitabine (120 mg/kg, Sigma-Aldrich) intraperitoneally and weekly according to previous studies .
F-box only protein 32 (FBXO32)
3-deazidenosine [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [152]
Responsed Disease Certain specified disorders of muscle ICD-11: FB32.Y
Target Regulation Down regulation
R-2HG [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [152]
Responsed Disease Certain specified disorders of muscle ICD-11: FB32.Y
Target Regulation Down regulation
Glypican-4 (GPC4)
FB23-2 [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [156]
Responsed Disease Uveitis ICD-11: 9A96
Target Regulation Up regulation
In-vitro Model
HMC3
N.A. Homo sapiens CVCL_II76
Leucine-rich repeat transmembrane protein FLRT3 (FLRT3)
Gefitinib [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [166]
Responsed Disease Non-small cell lung cancer ICD-11: 2C25.Y
Target Regulation Up regulation
NADPH oxidase 2 (NOX2)
Nicotine [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [170]
Responsed Disease Blood Pressure ICD-11: BA00
In-vivo Model SCLC cells were collected, and cell suspensions were prepared at a concentration of 1 × 106 cells per 100 μL PBS and injected subcutaneously into nude mice. When the tumour volume reached 60 mm3, mice were randomly divided into control and treatment groups with five mice in each group. The mice in the treatment group were treated regularly, and chemotherapy drugs (CDDP 3 mg/kg and VP16 2 mg/kg) were administered via intraperitoneal injection.
Nicotinamide N-methyltransferase (NNMT)
Cisplatin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [171]
Responsed Disease Ovarian cancer ICD-11: 2C73
Peroxiredoxin-5, mitochondrial (PRDX5)
FB23-2 [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [173]
Target Regulation Down regulation
In-vitro Model HaCaT Normal Homo sapiens CVCL_0038
Polyunsaturated fatty acid lipoxygenase ALOX12 (ALOX12)
Erianin [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [73]
Responsed Disease Renal cell carcinoma ICD-11: 2C90
Target Regulation Up regulation
Prolyl endopeptidase FAP (FAP)
VS-6063 [Phase 2]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [177]
Responsed Disease Non-small cell lung cancer ICD-11: 2C25.Y
In-vitro Model NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1650 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1483
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
BEAS-2B Normal Homo sapiens CVCL_0168
In-vivo Model The Laboratory Animal Center of Soochow University provided female BALB/c nude mice (5 weeks old). Mice were kept under specific pathogen-free conditions. They were injected intravenously (i.v.) with FTO-overexpressing and control A549 cells (1.8 × 106 cells/mouse) to establish the in vivo model of NSCLC metastasis, and were then gavaged with dimethyl sulfoxide (DMSO) (25 mg/kg, daily) or the FAK inhibitor defactinib (VS6063) (Cat#S7654, Selleck, USA) (25 mg/kg, daily) beginning in the fifth week after injection. The mice were euthanized eight weeks after being inoculated, and their lungs were taken out and preserved in Bouin's solution for macroscopic investigation of metastatic nodules. Hematoxylin and eosin (H&E) staining of lung tissues was used to look for micrometastatic foci.
Prostacyclin synthase (PTGIS)
Gefitinib [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [166]
Responsed Disease Non-small cell lung cancer ICD-11: 2C25.Y
Target Regulation Up regulation
Protein Atg16l2 (ATG16L2)
Dac51 [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [67]
Responsed Disease Diabetes ICD-11: 5A10-5A14
In-vitro Model MIN6 Mouse insulinoma Mus musculus CVCL_0431
Threonylcarbamoyladenosine tRNA methylthiotransferase (CDKAL1)
Fluorouracil [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [182]
Responsed Disease Gastric cancer ICD-11: 2B72
Target Regulation Up regulation
In-vitro Model MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
GES-1 Normal Homo sapiens CVCL_EQ22
Transducin-like enhancer protein 1 (TLE1)
Phenethyl isothiocyanate [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [184]
Responsed Disease Non-small cell lung cancer ICD-11: 2C25.Y
In-vitro Model NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H226 Pleural epithelioid mesothelioma Homo sapiens CVCL_1544
In-vivo Model Five-week-old female BALB/c nude mice were purchased from the Cancer Institute of the Chinese Academy of Medical Science (Beijing, China). Mice were randomly divided into two groups (eight mice per group), and 3×106 H1299 or H1299-LV-FTO-KD cells were injected subcutaneously into the flank of each mouse. For each group, four mice were treated with PEITC (100 mg/kg) intraperitoneally every two days for 14 days beginning the fifth week after cell injection, while the other four mice were treated with PBS as a control. At the end of the experiment, mice were euthanized, and tumor tissues were dissected for further analysis. Tumor weights were measured, and volumes were calculated (V = D/2 × d2, V: volume; D: longitudinal diameter; d: latitudinal diameter).
Tyrosine-protein phosphatase non-receptor type substrate 1 (SIRPA)
Gefitinib [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [166]
Responsed Disease Non-small cell lung cancer ICD-11: 2C25.Y
Target Regulation Up regulation
Ubiquitin thioesterase OTUB1 (OTUB1)
Erastin [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [185]
Responsed Disease Nasopharyngeal carcinoma ICD-11: 2B6B
Target Regulation Up regulation
In-vitro Model C666-1 Nasopharyngeal carcinoma Homo sapiens CVCL_7949
HONE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_8706
In-vivo Model Three- to four-week-old female BALB/c nude mice were obtained from Guangxi Medical University Laboratory Animal Center and maintained under SPF housing. NPC cells were resuspended in 100 μl of PBS and injected subcutaneously into the flanks of the nude mice. Mice were randomized to experimental groups 28 days after implantation and were injected intraperitoneally with the same volume of FB23-2 (2 mg/kg) or erastin (10 mg/kg) or vehicle every three days during radiation (4 Gy, once a week). The endpoint of all experiments was tumor size.
FB23-2 [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [185]
Responsed Disease Nasopharyngeal carcinoma ICD-11: 2B6B
Target Regulation Up regulation
In-vitro Model C666-1 Nasopharyngeal carcinoma Homo sapiens CVCL_7949
HONE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_8706
In-vivo Model Three- to four-week-old female BALB/c nude mice were obtained from Guangxi Medical University Laboratory Animal Center and maintained under SPF housing. NPC cells were resuspended in 100 μl of PBS and injected subcutaneously into the flanks of the nude mice. Mice were randomized to experimental groups 28 days after implantation and were injected intraperitoneally with the same volume of FB23-2 (2 mg/kg) or erastin (10 mg/kg) or vehicle every three days during radiation (4 Gy, once a week). The endpoint of all experiments was tumor size.
Unspecific Target Gene
Arsenite [Phase 2]
In total 2 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [186]
Cell Process Cell apoptosis
In-vitro Model HBE (Human bronchial epithelial cell line)
Response Summary m6A modification on RNA was significantly increased in arsenite-transformed cells and this modification was synergistically regulated by METTL3, METTL14, WTAP and FTO. Demonstrated the significant role of m6A in the prevention of tumor occurrence and progression induced by arsenite.
Experiment 2 Reporting the m6A-centered Drug Response of This Target Gene [216]
Responsed Disease Neurological disorders due to toxicity ICD-11: 8D43
In-vitro Model PC-12 Adh Rat adrenal gland pheochromocytoma Rattus norvegicus CVCL_F659
In-vivo Model The animals were kept in standard laboratory polycarbonate cages in controlled ambient temperature at 23℃ ± 1℃ with relative humidity of 50% ± 10%, and a light-dark cycle of 12/12 h. The mice had free access to standardized pellet food and tap water. After 1-week of habituation, the animals were randomly divided into the following 4 groups: control group, 0.5 mg/l arsenite group, 5 mg/l arsenite group and 50 mg/l arsenite group (n = 16 per group). The mice were exposed to arsenite via drinking water for 6 months.
Response Summary Targeting the m6A demethylase FTO in the prevention or intervention against arsenite-related neurodegenerative diseases.
Saikosaponins [Investigative]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [191]
Responsed Disease Acute myeloid leukaemia ICD-11: 2A60
Cell Process Cell apoptosis
Cell-cycle
In-vitro Model C1498 Mouse leukemia Mus musculus CVCL_3494
HL-60 Adult acute myeloid leukemia Homo sapiens CVCL_0002
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
Kasumi-1 Myeloid leukemia with maturation Homo sapiens CVCL_0589
MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
MOLM-14 Adult acute myeloid leukemia Homo sapiens CVCL_7916
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
SKNO-1 Myeloid leukemia with maturation Homo sapiens CVCL_2196
U-937 Adult acute monocytic leukemia Homo sapiens CVCL_0007
In-vivo Model Upon the development of leukemic disease (established using a white blood cell (WBC) count), 0.1 mg/kg or 0.5 mg/kg of SsD was intraperitoneally injected three times per week for three consecutive weeks.
Response Summary FTO-dependent m6A RNA methylation mediated the anti-leukemic actions of saikosaponin-d, thereby opening a window to develop SsD as an epitranscriptome-base drug for leukemia therapy. SsD showed a broadly-suppressed acute myeloid leukemia cell proliferation and promoted apoptosis and cell-cycle arrest both in vitro and in vivo.
Berberine [Phase 4]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [199]
Responsed Disease Colorectal cancer ICD-11: 2B91
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model 5 × 105 HCT116 CSCs were subcutaneously injected into the mice similarly as nude mice. Seven days later, 5, 10, or 20 mg/kg Berberine was intraperitoneally injected. The same volume of PBS was injected and considered as negative control.
Response Summary Berberine effectively decreased m6A methylation by decreasing beta-catenin and subsequently increased FTO suggests a role of Berberine in modulating stemness and malignant behaviors in colorectal cancer.
Cisplatin [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [218]
Responsed Disease Ototoxic hearing loss ICD-11: AB53
Cell Process Oxidative stress
Cell autophagy
In-vitro Model HEI-OC1 Normal Mus musculus CVCL_D899
Response Summary MA2, which is a highly selective inhibitor of FTO, has a protective effect and improves the viability of HEI-OC1 cells after cisplatin treatment, and they provide new insights into potential therapeutic targets for the amelioration of cisplatin-induced ototoxicity.
Ethyl ester form of meclofenamic acid [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [218]
Responsed Disease Ototoxic hearing loss ICD-11: AB53
Cell Process Oxidative stress
Cell autophagy
In-vitro Model HEI-OC1 Normal Mus musculus CVCL_D899
Response Summary MA2, which is a highly selective inhibitor of FTO, has a protective effect and improves the viability of HEI-OC1 cells after cisplatin treatment, and they provide new insights into potential therapeutic targets for the amelioration of cisplatin-induced ototoxicity.
Sunitinib [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [223]
Responsed Disease Diseases of the circulatory system ICD-11: BE2Z
In-vitro Model hiPSCs (Urinary epithelial cell-derived hiPSCs)
CMECs (Cardiac Microvascular Endothelial Cells )
CFs (Cardiac Fibroblasts)
Response Summary The RNA demethylase FTO was downregulated, whereas METTL14 and WTAP were upregulated. Furthermore, gain- and loss-of-function studies substantiated that FTO is cardioprotective in TKI(Sunitinib).
Betaine [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [224]
Responsed Disease Non-alcoholic fatty liver disease ICD-11: DB92
In-vivo Model Eight adult female C57BL/6 mice from the same pool of litters were housed at 22 ± 1 ℃ with 12-h light cycle and were mated with their male siblings. The female mice were fed with a low-fat diet supplemented with betaine from mating and throughout gestation and lactation. Litters were culled to five males per dam. Thirty offspring weaned at the age of day 21 and then were randomly assigned to three groups fed with either a low-fat diet (LF), high-fat diet (HF), or high-fat diet supplemented with betaine (HB) for 6 weeks.
Response Summary A novel FTO-dependent function of m(6)A is involve in the hepatoprotective effects of betaine. betaine supplementation across adolescence could protect mice from high-fat-induced lipid accumulation NAFLD in the liver. Moreover, FTO-dependent m6A demethylation is affected by betaine. A novel FTO-dependent function of m(6)A may involve in the hepatoprotective effects of betaine.
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
RNA modification
m6A Target: RNA cytosine C(5)-methyltransferase NSUN2 (NSUN2)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00016
Epigenetic Regulator RNA cytosine C(5)-methyltransferase NSUN2 (NSUN2)
Regulated Target Secreted frizzled related protein 1 (SFRP1)
Crosstalk relationship m6A → m5C
Disease Rheumatoid arthritis
m6A Target: Myc proto-oncogene protein (MYC)
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT00027
Epigenetic Regulator tRNA methyltransferase 10 homolog A (TRMT10A)
Regulated Target tRNA-Gln (anticodon TTG) 1-1 (TRQ-TTG1-1)
Crosstalk relationship m1G → m6A
Drug AVI-5126
Crosstalk ID: M6ACROT00029
Epigenetic Regulator tRNA methyltransferase 10 homolog A (TRMT10A)
Regulated Target tRNA-Arg (anticodon CCG) 1-1 (TRR-CCG1-1)
Crosstalk relationship m1G → m6A
Drug AVI-5126
Crosstalk ID: M6ACROT00031
Epigenetic Regulator tRNA methyltransferase 10 homolog A (TRMT10A)
Regulated Target tRNA-Thr (anticodon CGT) 1-1 (TRT-CGT1-1)
Crosstalk relationship m1G → m6A
Drug AVI-5126
Crosstalk ID: M6ACROT00045
Epigenetic Regulator tRNA methyltransferase 10 homolog A (TRMT10A)
Regulated Target Myc proto-oncogene protein (MYC)
Crosstalk relationship m1G → m6A
Drug AVI-5126
m6A Target: Forkhead box protein D1 (FOXD1)
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT00033
Epigenetic Regulator tRNA methyltransferase 10 homolog A (TRMT10A)
Regulated Target tRNA-Gln (anticodon TTG) 1-1 (TRQ-TTG1-1)
Crosstalk relationship m1G → m6A
Crosstalk ID: M6ACROT00035
Epigenetic Regulator tRNA methyltransferase 10 homolog A (TRMT10A)
Regulated Target tRNA-Arg (anticodon CCG) 1-1 (TRR-CCG1-1)
Crosstalk relationship m1G → m6A
Crosstalk ID: M6ACROT00037
Epigenetic Regulator tRNA methyltransferase 10 homolog A (TRMT10A)
Regulated Target tRNA-Thr (anticodon CGT) 1-1 (TRT-CGT1-1)
Crosstalk relationship m1G → m6A
Crosstalk ID: M6ACROT00046
Epigenetic Regulator tRNA methyltransferase 10 homolog A (TRMT10A)
Regulated Target Forkhead box protein D1 (FOXD1)
Crosstalk relationship m1G → m6A
m6A Target: Small ribosomal subunit protein mS38 (AURKAIP1)
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT00039
Epigenetic Regulator tRNA methyltransferase 10 homolog A (TRMT10A)
Regulated Target tRNA-Gln (anticodon TTG) 1-1 (TRQ-TTG1-1)
Crosstalk relationship m1G → m6A
Crosstalk ID: M6ACROT00041
Epigenetic Regulator tRNA methyltransferase 10 homolog A (TRMT10A)
Regulated Target tRNA-Arg (anticodon CCG) 1-1 (TRR-CCG1-1)
Crosstalk relationship m1G → m6A
Crosstalk ID: M6ACROT00043
Epigenetic Regulator tRNA methyltransferase 10 homolog A (TRMT10A)
Regulated Target tRNA-Thr (anticodon CGT) 1-1 (TRT-CGT1-1)
Crosstalk relationship m1G → m6A
Crosstalk ID: M6ACROT00047
Epigenetic Regulator tRNA methyltransferase 10 homolog A (TRMT10A)
Regulated Target Small ribosomal subunit protein mS38 (AURKAIP1)
Crosstalk relationship m1G → m6A
m6A Target: Copper-transporting ATPase 1 (ATP7A)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00048
Epigenetic Regulator tRNA methyltransferase 10 homolog A (TRMT10A)
Regulated Target Copper-transporting ATPase 1 (ATP7A)
Crosstalk relationship m1G → m6A
m6A Target: DNA excision repair protein ERCC-5 (ERCC5)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00049
Epigenetic Regulator tRNA methyltransferase 10 homolog A (TRMT10A)
Regulated Target DNA excision repair protein ERCC-5 (ERCC5)
Crosstalk relationship m1G → m6A
m6A Target: NAD-dependent protein deacetylase sirtuin-1 (SIRT1)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00479
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 155 (MIR155)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00518
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 221 (MIR221)
Crosstalk relationship A-to-I → m6A
m6A Target: Protein c-Fos (FOS)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00519
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 221 (MIR221)
Crosstalk relationship A-to-I → m6A
m6A Target: Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00536
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 26a-1 (MIR26A1)
Crosstalk relationship m6A → A-to-I
m6A Target: hsa-mir-22
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT00633
Epigenetic Regulator Double-stranded RNA-specific editase B2 (ADARB2)
Regulated Target NACHT, LRR and PYD domains-containing protein 3 (NLRP3)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00634
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target Zinc finger protein SNAI1 (SNAI1)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00635
Epigenetic Regulator RNA cytosine C(5)-methyltransferase NSUN2 (NSUN2)
Regulated Target H19 imprinted maternally expressed transcript (H19)
Crosstalk relationship m5C → m6A
m6A Target: microRNA 576 (MIR576)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00655
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00656
Epigenetic Regulator H/ACA ribonucleoprotein complex subunit DKC1 (DKC1)
Regulated Target Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A)
Crosstalk relationship m6A → Pseudouridine
DNA modification
m6A Target: Peroxisome proliferator-activated receptor alpha (PPARalpha/PPARA)
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT02019
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Renal ischemia-reperfusion injury
Drug 5-azacytidine
Crosstalk ID: M6ACROT02020
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Renal ischemia-reperfusion injury
Drug 5-azacytidine
Crosstalk ID: M6ACROT02021
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Renal ischemia-reperfusion injury
Drug 5-azacytidine
m6A Target: Suppressor of cytokine signaling 3 (SOCS3)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02052
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Ossification of spinal ligaments
m6A Target: Glucocorticoid receptor (NR3C1)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02078
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Major depressive disorder
Crosstalk ID: M6ACROT02082
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Major depressive disorder
m6A Target: Cyclic AMP-responsive element-binding protein 1 (CREB1)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02079
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Major depressive disorder
Crosstalk ID: M6ACROT02083
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Major depressive disorder
m6A Target: BDNF/NT-3 growth factors receptor (NTRK2)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02080
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Major depressive disorder
Crosstalk ID: M6ACROT02084
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Major depressive disorder
m6A Target: Neurotrophic factor BDNF precursor form (BDNF)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02081
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Major depressive disorder
Crosstalk ID: M6ACROT02085
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship DNA modification → m6A
Disease Major depressive disorder
m6A Target: Insulin-like growth factor-binding protein 7 (IGFBP7)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02111
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Insulin-like growth factor-binding protein 7 (IGFBP7)
Crosstalk relationship DNA modification → m6A
Disease Gastric cancer
Crosstalk ID: M6ACROT02112
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Insulin-like growth factor-binding protein 7 (IGFBP7)
Crosstalk relationship DNA modification → m6A
Disease Gastric cancer
Histone modification
m6A Target: HOXC13 antisense RNA (HOXC13-AS)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03068
Epigenetic Regulator CREB-binding protein (CREBBP)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship m6A → Histone modification
Disease Cervical cancer
m6A Target: Cyclin-dependent kinase 2 (CDK2)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03086
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship Histone modification → m6A
Disease Diabetic retinopathy
Drug FB23-2
m6A Target: Ferroptosis suppressor protein 1 (AIFM2)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03124
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
Drug Vorinostat
Crosstalk ID: M6ACROT05215
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
Drug Trichostatin A
m6A Target: Histone-lysine N-methyltransferase SUV39H1 (SUV39H1)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03179
Epigenetic Regulator Histone-lysine N-methyltransferase SUV39H1 (SUV39H1)
Regulated Target Histone H3 lysine 9 trimethylation (H3K9me3)
Crosstalk relationship m6A → Histone modification
Disease Ageing-related disease
Crosstalk ID: M6ACROT06001
Epigenetic Regulator Histone-lysine N-methyltransferase SUV39H1 (SUV39H1)
Regulated Target Histone H3 lysine 9 trimethylation (H3K9me3)
Crosstalk relationship m6A → Histone modification
Disease Ageing-related disease
m6A Target: Lysine-specific demethylase 5B (KDM5B)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03198
Epigenetic Regulator Lysine-specific demethylase 5B (KDM5B)
Regulated Target Histone H3 lysine 4 dimethylation (H3K4me2)
Crosstalk relationship m6A → Histone modification
Disease Pancreatic ductal adenocarcinoma
Crosstalk ID: M6ACROT03199
Epigenetic Regulator Lysine-specific demethylase 5B (KDM5B)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship m6A → Histone modification
Disease Pancreatic ductal adenocarcinoma
m6A Target: Histone-lysine N-methyltransferase EHMT2 (G9a)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03231
Epigenetic Regulator Histone-lysine N-methyltransferase EHMT2 (EHMT2)
Regulated Target Histone H3 lysine 9 dimethylation (H3K9me2)
Crosstalk relationship m6A → Histone modification
Disease Neuropathic pain
m6A Target: Myc proto-oncogene protein (MYC)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03431
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
Crosstalk ID: M6ACROT03447
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
m6A Target: Cyclic AMP-dependent transcription factor ATF-4 (ATF4)
In total 6 item(s) under this m6A target
Crosstalk ID: M6ACROT03432
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
Drug Rapamycin
Crosstalk ID: M6ACROT03433
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
Drug GLS-IN-968
Crosstalk ID: M6ACROT03434
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
Drug CB-839
Crosstalk ID: M6ACROT03435
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
Drug Meclofenamate sodium
Crosstalk ID: M6ACROT03436
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
Drug Chloroquine
Crosstalk ID: M6ACROT03437
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
Drug Asparagine inhibitor
m6A Target: Serine/threonine-protein kinase mTOR (MTOR)
In total 6 item(s) under this m6A target
Crosstalk ID: M6ACROT03438
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
Drug Rapamycin
Crosstalk ID: M6ACROT03439
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
Drug GLS-IN-968
Crosstalk ID: M6ACROT03440
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
Drug CB-839
Crosstalk ID: M6ACROT03441
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
Drug Meclofenamate sodium
Crosstalk ID: M6ACROT03442
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
Drug Chloroquine
Crosstalk ID: M6ACROT03443
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
Drug Asparagine inhibitor
m6A Target: Glucose-6-phosphate dehydrogenase (G6PD)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03444
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
m6A Target: Poly [ADP-ribose] polymerase 1 (PARP1)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03445
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
m6A Target: Myeloid zinc finger 1 (MZF1)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03446
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
m6A Target: Metastasis-associated protein MTA1 (MTA1)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03448
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
m6A Target: Apoptosis regulatory protein Siva (SIVA1)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03449
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
Drug Fluorouracil
m6A Target: Hexokinase-2 (HK2)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03450
Epigenetic Regulator Histone deacetylase 1 (HDAC1)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Colorectal cancer
m6A Target: Maternally expressed 3 (MEG3)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05951
Epigenetic Regulator Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship m6A → Histone modification
Disease Abortion
Non-coding RNA
m6A Target: Nuclear factor erythroid 2-related factor 2 (NFE2L2)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05072
Epigenetic Regulator Urothelial cancer associated 1 (UCA1)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease DOX-induced cardiotoxicity
m6A Target: Dynamin-1-like protein (DRP1)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05099
Epigenetic Regulator ZNFX1 antisense RNA 1 (ZFAS1)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Acute ischemic stroke
m6A Target: Circ_GPR137B
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05119
Epigenetic Regulator hsa-miR-4739
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
Crosstalk ID: M6ACROT05120
Epigenetic Regulator Circ_GPR137B
Regulated Target hsa-miR-4739
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
m6A Target: Dickkopf-related protein 2 (DKK2)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05125
Epigenetic Regulator Circ_CELF1
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Myocardial Fibrosis
m6A Target: Myc proto-oncogene protein (MYC)
In total 10 item(s) under this m6A target
Crosstalk ID: M6ACROT05127
Epigenetic Regulator hsa-let-7b-5p
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Acute myeloid leukaemia
Crosstalk ID: M6ACROT05163
Epigenetic Regulator Long intergenic non-protein coding RNA 858 (LINC00858)
Regulated Target Zinc finger protein 184 (ZNF184)
Crosstalk relationship ncRNA → m6A
Disease Esophageal Squamous Cell Carcinoma
Crosstalk ID: M6ACROT05181
Epigenetic Regulator hsa-miR-218-5p
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
Crosstalk ID: M6ACROT05182
Epigenetic Regulator hsa_circ_0001739 (Circ_ZNF277)
Regulated Target hsa-miR-218-5p
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
Crosstalk ID: M6ACROT05183
Epigenetic Regulator AC159540.1
Regulated Target hsa-miR-218-5p
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
Crosstalk ID: M6ACROT05237
Epigenetic Regulator hsa-miR-607
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Crosstalk ID: M6ACROT05251
Epigenetic Regulator hsa_circ_0072309 (Circ_LIFR)
Regulated Target hsa-miR-607
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Crosstalk ID: M6ACROT05320
Epigenetic Regulator hsa-miR-96
Regulated Target Protein kinase AMP-activated catalytic subunit alpha 2 (PRKAA2)
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
Crosstalk ID: M6ACROT05437
Epigenetic Regulator MicroRNA 23a (MIR23A)
Regulated Target Max-interacting protein 1 (MXI1)
Crosstalk relationship m6A → ncRNA
Disease Brain cancer
Drug Temozolomide
Crosstalk ID: M6ACROT05438
Epigenetic Regulator MicroRNA 155 (MIR155)
Regulated Target Max-interacting protein 1 (MXI1)
Crosstalk relationship m6A → ncRNA
Disease Brain cancer
Drug Temozolomide
m6A Target: Estrogen receptor (ESR1)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05171
Epigenetic Regulator hsa-miR-3492
Regulated Target Estrogen receptor (ESR1)
Crosstalk relationship m6A → ncRNA
Disease Colorectal cancer
m6A Target: Intraflagellar transport protein 80 homolog (IFT80)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05179
Epigenetic Regulator H2AZ2 pseudogene 1 (H2AZ2P1)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Head and neck squamous carcinoma
m6A Target: Zinc finger protein SNAI1 (SNAI1)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05201
Epigenetic Regulator GATA6 antisense RNA 1 (head to head) (GATA6-AS1)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Pancreatic cancer
m6A Target: Zinc finger E-box-binding homeobox 1 (ZEB1)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05225
Epigenetic Regulator piR-17560
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Breast cancer
m6A Target: Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2a/ATP2A2)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05226
Epigenetic Regulator Cardiac conduction regulatory RNA (CCRR)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Acute myocardial infarction
m6A Target: Ubiquitin carboxyl-terminal hydrolase 7 (USP7)
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT05235
Epigenetic Regulator hsa-miR-607
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Drug P5091
Crosstalk ID: M6ACROT05236
Epigenetic Regulator hsa-miR-607
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Crosstalk ID: M6ACROT05249
Epigenetic Regulator hsa_circ_0072309 (Circ_LIFR)
Regulated Target hsa-miR-607
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Drug P5091
Crosstalk ID: M6ACROT05250
Epigenetic Regulator hsa_circ_0072309 (Circ_LIFR)
Regulated Target hsa-miR-607
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
m6A Target: Transcription factor E2F1 (E2F1)
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT05238
Epigenetic Regulator hsa-miR-607
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Crosstalk ID: M6ACROT05242
Epigenetic Regulator hsa-miR-607
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Crosstalk ID: M6ACROT05252
Epigenetic Regulator hsa_circ_0072309 (Circ_LIFR)
Regulated Target hsa-miR-607
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Crosstalk ID: M6ACROT05256
Epigenetic Regulator hsa_circ_0072309 (Circ_LIFR)
Regulated Target hsa-miR-607
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
m6A Target: Programmed cell death 1 ligand 1 (CD274/PD-L1)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05239
Epigenetic Regulator hsa-miR-607
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Crosstalk ID: M6ACROT05253
Epigenetic Regulator hsa_circ_0072309 (Circ_LIFR)
Regulated Target hsa-miR-607
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
m6A Target: ATP-binding cassette sub-family C member 10 (ABCC10)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05240
Epigenetic Regulator hsa-miR-607
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Drug Gefitinib
Crosstalk ID: M6ACROT05254
Epigenetic Regulator hsa_circ_0072309 (Circ_LIFR)
Regulated Target hsa-miR-607
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Drug Gefitinib
m6A Target: Protein kinase C-binding protein NELL2 (NELL2)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05241
Epigenetic Regulator hsa-miR-607
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Crosstalk ID: M6ACROT05255
Epigenetic Regulator hsa_circ_0072309 (Circ_LIFR)
Regulated Target hsa-miR-607
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
m6A Target: Growth arrest specific 5 (GAS5)
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05243
Epigenetic Regulator hsa-miR-607
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Crosstalk ID: M6ACROT05257
Epigenetic Regulator hsa_circ_0072309 (Circ_LIFR)
Regulated Target hsa-miR-607
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Crosstalk ID: M6ACROT05646
Epigenetic Regulator Growth arrest specific 5 (GAS5)
Regulated Target Bromodomain-containing protein 4 (BRD4)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
m6A Target: Prolyl endopeptidase FAP (FAP)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05244
Epigenetic Regulator hsa-miR-607
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Drug VS-6063
Crosstalk ID: M6ACROT05258
Epigenetic Regulator hsa_circ_0072309 (Circ_LIFR)
Regulated Target hsa-miR-607
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Drug VS-6063
m6A Target: Transducin-like enhancer protein 1 (TLE1)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05245
Epigenetic Regulator hsa-miR-607
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Drug Phenethyl isothiocyanate
Crosstalk ID: M6ACROT05259
Epigenetic Regulator hsa_circ_0072309 (Circ_LIFR)
Regulated Target hsa-miR-607
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Drug Phenethyl isothiocyanate
m6A Target: Leucine-rich repeat transmembrane protein FLRT3 (FLRT3)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05246
Epigenetic Regulator hsa-miR-607
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Drug Gefitinib
Crosstalk ID: M6ACROT05260
Epigenetic Regulator hsa_circ_0072309 (Circ_LIFR)
Regulated Target hsa-miR-607
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Drug Gefitinib
m6A Target: Prostacyclin synthase (PTGIS)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05247
Epigenetic Regulator hsa-miR-607
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Drug Gefitinib
Crosstalk ID: M6ACROT05261
Epigenetic Regulator hsa_circ_0072309 (Circ_LIFR)
Regulated Target hsa-miR-607
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Drug Gefitinib
m6A Target: Tyrosine-protein phosphatase non-receptor type substrate 1 (SIRPA)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05248
Epigenetic Regulator hsa-miR-607
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Drug Gefitinib
Crosstalk ID: M6ACROT05262
Epigenetic Regulator hsa_circ_0072309 (Circ_LIFR)
Regulated Target hsa-miR-607
Crosstalk relationship ncRNA → m6A
Disease Non-small cell lung cancer
Drug Gefitinib
m6A Target: Pyruvate kinase PKM (PKM2/PKM)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05314
Epigenetic Regulator FTO intronic transcript 1 (FTO-IT1)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
m6A Target: Glucose transporter type 1 (SLC2A1)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05315
Epigenetic Regulator FTO intronic transcript 1 (FTO-IT1)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
m6A Target: Forkhead box protein O3 (FOXO3)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05338
Epigenetic Regulator hsa-miR-27a-3p
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Glioblastoma multiforme
m6A Target: PPAR-gamma coactivator 1-alpha (PGC-1a/PPARGC1A)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05346
Epigenetic Regulator MicroRNA 155 (MIR155)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Clear cell renal cell carcinoma
m6A Target: Myosin heavy chain associated RNA transcript (MHRT)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05472
Epigenetic Regulator Myosin heavy chain associated RNA transcript (MHRT)
Crosstalk relationship m6A → ncRNA
Disease Congestive heart failure
Drug Doxorubicin
m6A Target: Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05477
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Crosstalk relationship m6A → ncRNA
Disease Kidney failure
Crosstalk ID: M6ACROT05514
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Crosstalk relationship m6A → ncRNA
Disease Bladder cancer
Crosstalk ID: M6ACROT05567
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Regulated Target MicroRNA 384 (MIR384)
Crosstalk relationship m6A → ncRNA
Disease Bladder cancer
m6A Target: Pvt1 oncogene (PVT1)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05478
Epigenetic Regulator Pvt1 oncogene (PVT1)
Crosstalk relationship m6A → ncRNA
Disease Kidney failure
m6A Target: Deleted in lymphocytic leukemia 2 (DLEU2/LINC00022)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05519
Epigenetic Regulator Deleted in lymphocytic leukemia 2 (DLEU2/LINC00022)
Regulated Target Cyclin-dependent kinase inhibitor 1 (CDKN1A)
Crosstalk relationship m6A → ncRNA
Disease Esophageal Squamous Cell Carcinoma
m6A Target: HOXC13 antisense RNA (HOXC13-AS)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05520
Epigenetic Regulator HOXC13 antisense RNA (HOXC13-AS)
Crosstalk relationship m6A → ncRNA
Disease Cervical cancer
m6A Target: microRNA 576 (MIR576)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05536
Epigenetic Regulator MicroRNA 576 (MIR576)
Regulated Target Cyclin-dependent kinase 6 (CDK6)
Crosstalk relationship m6A → ncRNA
Disease Bladder cancer
m6A Target: hsa-miR-181b-3p
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05579
Epigenetic Regulator hsa-miR-181b-3p
Regulated Target ADP-ribosylation factor-like protein 5B (ARL5B)
Crosstalk relationship m6A → ncRNA
Disease Breast cancer
m6A Target: pri-miR-10a
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05603
Epigenetic Regulator pri-miR-10a
Regulated Target Myotubularin related protein 3 (MTMR3)
Crosstalk relationship m6A → ncRNA
Disease Brain cancer
m6A Target: AC008440.5 (AC008)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05619
Epigenetic Regulator AC008440.5 (AC008)
Regulated Target hsa-miR-328-3p
Crosstalk relationship m6A → ncRNA
Disease Osteoarthritis
m6A Target: microRNA 155 (MIR155)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05651
Epigenetic Regulator MicroRNA 155 (MIR155)
Crosstalk relationship m6A → ncRNA
Disease Traumatic brain injury induced by controlled cortical impact injury
m6A Target: Circ_SETD2
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05658
Epigenetic Regulator Circ_SETD2
Regulated Target hsa-miR-181a-5p
Crosstalk relationship m6A → ncRNA
Disease Pre-eclampsia
m6A Target: pri-miR-3591
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05685
Epigenetic Regulator MicroRNA 3591
Regulated Target Protein kinase AMP-activated catalytic subunit alpha 2 (PRKAA2)
Crosstalk relationship m6A → ncRNA
Disease Osteoarthritis
m6A Target: Maternally expressed 3 (MEG3)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05727
Epigenetic Regulator Maternally expressed 3 (MEG3)
Crosstalk relationship m6A → ncRNA
Disease Acute ischemic stroke
Crosstalk ID: M6ACROT05830
Epigenetic Regulator Maternally expressed 3 (MEG3)
Regulated Target Histone-lysine N-methyltransferase EZH2 (EZH2)
Crosstalk relationship m6A → ncRNA
Disease Abortion
m6A Target: Long intergenic non-protein coding RNA 1139 (LINC01139)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05748
Epigenetic Regulator Long intergenic non-protein coding RNA 1139 (LINC01139)
Regulated Target Minichromosome maintenance complex component 3 (MCM3)
Crosstalk relationship m6A → ncRNA
Disease Esophageal Squamous Cell Carcinoma
m6A Target: hsa-miR-515-5p
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05772
Epigenetic Regulator hsa-miR-515-5p
Regulated Target Toll-like receptor 4 (TLR4)
Crosstalk relationship m6A → ncRNA
Disease Osteoarthritis
m6A Target: hsa-miR-383-5p
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05775
Epigenetic Regulator hsa-miR-383-5p
Regulated Target Integrin subunit alpha 3 (ITGA3)
Crosstalk relationship m6A → ncRNA
Disease Pancreatic cancer
m6A Target: hsa-mir-22
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05779
Epigenetic Regulator hsa-mir-22
Crosstalk relationship m6A → ncRNA
m6A Target: microRNA 7-1 (MIR7-1)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05780
Epigenetic Regulator MicroRNA 7-1 (MIR7-1)
Crosstalk relationship m6A → ncRNA
m6A Target: MIRLET7E
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05781
Epigenetic Regulator MIRLET7E
Crosstalk relationship m6A → ncRNA
m6A Target: Autophagy protein 5 (ATG5)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05872
Epigenetic Regulator Circ_RAB11FIP1
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Ovarian cancer
m6A Target: Ubiquitin-like modifier-activating enzyme ATG7 (ATG7)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05873
Epigenetic Regulator Circ_RAB11FIP1
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Ovarian cancer
m6A Target: CAP-Gly domain-containing linker protein 3 (CLIP3)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05874
Epigenetic Regulator MicroRNA 145 (MIR145)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Glioblastoma
m6A Target: PDH kinase 1 (PDK1)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05968
Epigenetic Regulator Long non-coding RNA just proximal to the X-inactive specific transcript (JPX)
Regulated Target FTO alpha-ketoglutarate dependent dioxygenase (FTO)
Crosstalk relationship ncRNA → m6A
Disease Glioblastoma multiforme
Drug Temozolomide
Xenobiotics Compound(s) Regulating the m6A Methylation Regulator
Compound Name MA2 Approved
Synonyms
Ethyl ester form of meclofenamic acid (MA)
    Click to Show/Hide
Description
MA2, which is a highly selective inhibitor of FTO, has a protective effect and improves the viability of HEI-OC1 cells after cisplatin treatment, and they provide new insights into potential therapeutic targets for the amelioration of cisplatin-inducedototoxicity.
[218]
Compound Name Rapamycin Approved
Synonyms
Rapamune; Rapamycin (Sirolimus); AY-22989; Rapammune; sirolimusum; WY-090217; RAPA; Antibiotic AY 22989; AY 22989; UNII-W36ZG6FT64; CCRIS 9024; CHEBI:9168; SILA 9268A; W36ZG6FT64; HSDB 7284; C51H79NO13; NSC 226080; DE-109; NCGC00021305-05; DSSTox_CID_3582; DSSTox_RID_77091; DSSTox_GSID_23582; Cypher; Supralimus; Wy 090217; Perceiva; RAP; RPM; Rapamycin from Streptomyces hygroscopicus; SIIA 9268A; LCP-Siro; MS-R001; Rapamune (TN); Rapamycin (TN); Sirolimus (RAPAMUNE); Rapamycin C-7, analog 4; Sirolimus (USAN/INN); Sirolimus [USAN:BAN:INN]; Sirolimus, Rapamune,Rapamycin; Heptadecahydro-9,27-dihydroxy-3-[(1R)-2-[(1S,3R,4R)-4-hydroxy; 23,27-Epoxy-3H-pyrido(2,1-c)(1,4)oxaazacyclohentriacontine; 23,27-Epoxy-3H-pyrido[2,1-c][1,4]oxaazacyclohentriacontine; 23,27-epoxy-3H-pyrido[2,1-c][1,4]oxaazacyclohentriacontine-1,5,11,28,29; 3H-pyrido(2,1-c)(1,4)oxaazacyclohentriacontine-1,5,11,28,29(4H,6H,31H)-pentone; Sirolimus (MTOR inhibitor)
    Click to Show/Hide
External link
Description
The m6A changes caused by FTO influence the stability of ULK1 transcripts, likely through a YTHDF2-dependent manner.Under both basal and rapamycin-induced autophagy conditions, depletion of FTO significantly reduced the formation of GFP-LC3B puncta. The level ofp62/SQSTM1 (an autophagy substrate) was higher in FTO-knockdown cells than that in control cells. FTO specifically upregulates the ULK1 protein abundance. ULK1 mRNA undergoes m6A modification in the 3'-UTR and the m6A-marked ULK1 transcripts can further be targeted for degradation by YTHDF2.
[53]
Compound Name Meclofenamic Acid Approved
Synonyms
Arquel; Meclofenamate; Acide meclofenamique; Acido meclofenamico; Acidum meclofenamicum; Meclophenamic acid; CL 583; INF 4668; Acide meclofenamique [INN-French]; Acido meclofenamico [INN-Spanish]; Acidum meclofenamicum [INN-Latin]; INF-4668; Meclomen (free acid); Meclofenamic acid (USAN/INN); Meclofenamic acid [USAN:INN:BAN]; N-(2,6-Dichloro-3-methylphenyl)anthranilic acid; N-(2,6-Dichloro-m-tolyl)anthranilic acid; N-(3-Methyl-2,6-dichlorophenyl)anthranilic acid; 2-((2,6-Dichloro-3-methylphenyl)amino)benzoic acid; 2-(2,6-Dichloro-3-methylphenyl)aminobenzoic acid; 2-(2,6-dichloro-3-methylanilino)benzoic acid; 2-[(2,6-dichloro-3-methylphenyl)amino]benzoic acid
    Click to Show/Hide
External link
Description
Genetic depletion and pharmacological inhibition of FTO dramatically attenuate leukemia stem/initiating cell self-renewal and reprogram immune response by suppressing expression of immune checkpoint genes, especiallyLILRB4. FTO inhibitors, such as rhein, meclofenamic acid (MA), MO-I-500, fluorescein, and R-2HG, can inhibitacute myeloid leukemia cell viability. CS1 and CS2 displayed a much higher efficacy in inhibiting AML cell viability.
[30]
Compound Name Fluorescite Approved
Synonyms
Funduscein-25; Ak-fluor 10%; Ak-fluor 25%; Fluorescite
    Click to Show/Hide
External link
Description
Genetic depletion and pharmacological inhibition of FTO dramatically attenuate leukemia stem/initiating cell self-renewal and reprogram immune response by suppressing expression of immune checkpoint genes, especiallyLILRB4. FTO inhibitors, such as rhein, meclofenamic acid (MA), MO-I-500, fluorescein, and R-2HG, can inhibitacute myeloid leukemia cell viability. CS1 and CS2 displayed a much higher efficacy in inhibiting AML cell viability.
[30]
Compound Name Comtan Approved
Synonyms
Comtan; Comtess; Entacapona; Entacaponum; Novartis brand of entacapone; Orion brand of entacapone; KB475572; OR 611; COM-998; Comtan (TN); Entacapona [INN-Spanish]; Entacapone [USAN:INN]; Entacaponum [INN-Latin]; OR-611; Stalevo (TN); Entacapone (JAN/USAN/INN); N,N-diethyl-2-cyano-3-(3,4-dihydroxy-5-nitrophenyl) acrylamide; (2E)-2-cyano-3-(3,4-dihydroxy-5-nitrophenyl)-N,N-diethylprop-2-enamide; (E)-2-Cyano-3-(3,4-dihydroxy-5-nitrophenyl)-N,N-diethyl-2-propenamide; (E)-2-cyano-3-(3,4-dihydroxy-5-nitro-phenyl)-N,N-diethyl-prop-2-enamide; (E)-2-cyano-3-(3,4-dihydroxy-5-nitrophenyl)-N,N-diethylprop-2-enamide; (E)-alpha-Cyano-N,N-diethyl-3,4-dihydroxy-5-nitrocinnamamide; 2-Cyano-N,N-diethyl-3-(3,4-dihydroxy-5-nitrophenyl)propenamide
    Click to Show/Hide
External link
Description
Studies of the aberrant expression of m6A mediators inbreast cancer revealed that they were associated with different BC subtypes and functions, such as proliferation, apoptosis, stemness, the cell cycle, migration, and metastasis, through several factors and signaling pathways, such asBcl-2 and the PI3K/Akt pathway, among others. Fat mass and obesity-associated protein (FTO) was identified as the first m6A demethylase, and a series of inhibitors that target FTO were reported to have potential for the treatment of BC by inhibiting cell proliferation and promoting apoptosis.
[4]
Compound Name Berberine Phase 4
Synonyms
Berberin; Umbellatine; UNII-0I8Y3P32UF; 0I8Y3P32UF; CHEBI:16118; EINECS 218-229-1; Berberal; BRN 3570374; ST055798; 9,10-Dimethoxy-2,3-(methylenedioxy)-7,8,13,13a-tetrahydroberbinium; Benzo(g)-1,3-benzodioxolo(5,6-a)quinolizinium, 5,6-dihydro-9,10-dimethoxy-; 9,10-dimethoxy-5,6-dihydro[1,3]dioxolo[4,5-g]isoquino[3,2-a]isoquinolin-7-ium; Berbamine sulphate acid; CHEMBL12089; 7,8,13,13a-tetradehydro-9,10-dimethoxy-2,3-(methylenedioxy)berbinium; BERBINIUM, 7,8,13,13a-TETRAHYDRO-9,10-DIMETHOXY-2,3-(METHYLE
    Click to Show/Hide
External link
Description
Berberine effectively decreased m6A methylation by decreasing beta-catenin and subsequently increased FTO suggests a role of Berberine in modulating stemness and malignant behaviors incolorectal cancer.
[199]
Compound Name Bisantrene Phase 3
Synonyms
Bisantrenum; CL 216942; CHEMBL25336; NSC 337766; 39C34M111K; N-[(E)-[10-[(E)-(4,5-dihydro-1H-imidazol-2-ylhydrazinylidene)methyl]anthracen-9-yl]methylideneamino]-4,5-dihydro-1H-imidazol-2-amine; 9,10-Bis((2-(4,5-dihydro-1H-imidazol-2-yl)hydrazono)methyl)anthracene; Bisantrene [INN]; Bisantrenum [INN-Latin]; 9,10-Bis(2-(4,5-dihydro-1H-imidazol-2-yl)hydrazono)methyl)anthracene; Bisantreno [INN-Spanish]; NSC337766; NSC-337766; BRN 0966309; 9,10-Anthracenedicarboxaldehyde, bis((4,5-dihydro-1H-imidazol-2-yl)hydrazone)-; 9,10-Anthracendicarbaldehyde bis(2-imidazolin-2-ylhydrazon); 9,10-Anthracenedicarboxaldehyde, bis[(4,5-dihydro-1H-imidazol-2-yl)hydrazone], dihydrochloride; SCHEMBL8906393; 9,10-bis((E)-(2-(4,5-dihydro-1H-imidazol-2-yl)hydrazono)methyl)anthracene; EX-A2382; ZINC1550957; BDBM50060768; CCG-35603; MFCD01743164; CS-6132; AS-75775; N-[(E)-[10-[(E)-(4,5-dihydro-1H-imidazol-2-ylhydrazono)methyl]-9-anthryl]methyleneamino]-4,5-dihydro-1H-imidazol-2-amine; HY-100875; 186B342; BRD-K64298650-300-01-5; 9,10-Anthracenedicarboxaldehyde Bis(2-imidazolin-2-yl-hydrazone); 9,10-Anthracenedicarbaldehyde bis(4,5-dihydro-1H-imidazol-2-ylhydrazone); anthracene-9,10 bis-carbaldehyde 4,5-dihydro-1H-imidazol-2-ylhydrazone; 9,10-anthracenedicarboxaldehyde Bis[(4,5-dihydro-1H-imidazol-2yl)hydrazone); 9,10-Anthracenedicarboxaldehyde, bis(4,5-dihydro-1H-imidazol-2-ylhydrazone),dihydrochloride; N-Anthracen-9-yl methylene N''-[(bis)4,5-dihydro-1H-imidazole-2-yl)-hydrazine; N-Anthracen-bis-9,10-ylmethylene-N''-(4,5-dihydro-1H-imidazol-2-yl)-hydrazine(bisantrene); 10-imino(4,5-dihydro-1H-2-imidazolamine)methyl-9-anthrylmethan-(4,5-dihydro-1H-2-imidazolamine)imine; Bis((4,5-dihydro-1H-imidazol-2-yl)hydrazone)-9,10-anthracenedicarboxaldehyde dihydrochloride; x N-4,5-dihydro-1H-2-imidazolamine-10-iminomethyl-9-anthrylmethanimine-4,5-dihydro-1H-2-imidazolamine (Bisantrene)
    Click to Show/Hide
External link
Description
Genetic depletion and pharmacological inhibition of FTO dramatically attenuate leukemia stem/initiating cell self-renewal and reprogram immune response by suppressing expression of immune checkpoint genes, especiallyLILRB4. FTO inhibitors, such as rhein, meclofenamic acid (MA), MO-I-500, fluorescein, and R-2HG, can inhibitacute myeloid leukemia cell viability. CS1 and CS2 displayed a much higher efficacy in inhibiting AML cell viability.
[30]
Compound Name Brequinar Phase 2
Synonyms
6-Fluoro-2-(2'-fluoro-[1,1'-biphenyl]-4-yl)-3-methylquinoline-4-carboxylic acid; brequinarum [Latin]; Brequinar [INN]; Biphenquinate; 6-fluoro-2-(2'-fluorobiphenyl-4-yl)-3-methylquinoline-4-carboxylic acid; Brequinarum [INN-Latin]; UNII-5XL19F49H6; C23H15F2NO2; NSC-368390; NSC 368390; 6-fluoro-2-[4-(2-fluorophenyl)phenyl]-3-methylquinoline-4-carboxylic acid; PHEZJEYUWHETKO-UHFFFAOYSA-N; Dup 785; 5XL19F49H6; 6-FLUORO-2-(2'-FLUORO-1,1'-BIPHENYL-4-YL)-3-METHYLQUINOLINE-4-CARBOXYLIC ACID; brequinarum
    Click to Show/Hide
External link
Description
Genetic depletion and pharmacological inhibition of FTO dramatically attenuate leukemia stem/initiating cell self-renewal and reprogram immune response by suppressing expression of immune checkpoint genes, especiallyLILRB4. FTO inhibitors, such as rhein, meclofenamic acid (MA), MO-I-500, fluorescein, and R-2HG, can inhibitacute myeloid leukemia cell viability. CS1 and CS2 displayed a much higher efficacy in inhibiting AML cell viability.
[30]
Compound Name 3DZA Terminated
Synonyms
Cc3Ado; BW-91Y78; 3DZA; 4-Amino-1-beta-D-ribofuranosyl-1H-imidazo[4,5-c]pyridine
    Click to Show/Hide
External link
Description
Studies of the aberrant expression of m6A mediators inbreast cancer revealed that they were associated with different BC subtypes and functions, such as proliferation, apoptosis, stemness, the cell cycle, migration, and metastasis, through several factors and signaling pathways, such asBcl-2 and the PI3K/Akt pathway, among others. Fat mass and obesity-associated protein (FTO) was identified as the first m6A demethylase, and a series of inhibitors that target FTO were reported to have potential for the treatment of BC by inhibiting cell proliferation and promoting apoptosis.
[4]
Compound Name FB23 Investigative
Synonyms
FB23; 2243736-35-6; 2-[[2,6-bis(chloranyl)-4-(3,5-dimethyl-1,2-oxazol-4-yl)phenyl]amino]benzoic acid; CHEMBL4572939; SCHEMBL23261118; BCP33227; EX-A3402; FB-23;FB 23; s6291; HY-137187; CS-0136974; A936869; 2-[[2,6-Dichloro-4-(3,5-dimethyl-4-isoxazolyl)phenyl]amino]benzoic acid; 8S3
    Click to Show/Hide
External link
Activity
IC50 = 60 nM
[230]
Compound Name (Z)-3-(3,4-dihydroxy-5-nitrophenyl)-2-pyrazin-2-ylprop-2-enenitrile Investigative
Synonyms
CHEMBL4448030; SCHEMBL20100848
    Click to Show/Hide
External link
Activity
IC50 <= 250 nM
[231]
Compound Name 5-[(Z)-1-cyano-2-(3,4-dihydroxy-5-nitrophenyl)ethenyl]pyrazine-2-carboxylic acid Investigative
Synonyms
CHEMBL4563060; SCHEMBL21932996
    Click to Show/Hide
External link
Activity
IC50 <= 300 nM
[231]
Compound Name 2,6-dichloro-4-(3,5-dimethyl-1,2-oxazol-4-yl)-N-[2-(2H-tetrazol-5-yl)phenyl]aniline Investigative
Synonyms
CHEMBL4532629
    Click to Show/Hide
External link
Activity
IC50 = 400 nM
[230]
Compound Name (Z)-3-(3,4-dihydroxy-5-nitrophenyl)-2-pyrimidin-4-ylprop-2-enenitrile Investigative
Synonyms
CHEMBL4527360; SCHEMBL20100853
    Click to Show/Hide
External link
Activity
IC50 <= 500 nM
[231]
Compound Name (Z)-3-amino-2-cyano-3-(3,4-dihydroxy-5-nitrophenyl)-N,N-diethylprop-2-enamide Investigative
Synonyms
CHEMBL4567049; SCHEMBL20100829
    Click to Show/Hide
External link
Activity
IC50 <= 500 nM
[231]
Compound Name (Z)-2-cyano-3-(3,4-dihydroxy-5-nitrophenyl)-3-hydroxy-N-(1,3-thiazol-2-yl)prop-2-enamide Investigative
Synonyms
CHEMBL4435468; SCHEMBL20100862
    Click to Show/Hide
External link
Activity
IC50 <= 500 nM
[231]
Compound Name (Z)-2-cyano-3-(3,4-dihydroxy-5-nitrophenyl)-N,N-diethyl-3-hydroxyprop-2-enamide Investigative
Synonyms
CHEMBL4461072; SCHEMBL20100822
    Click to Show/Hide
External link
Activity
IC50 <= 500 nM
[231]
Compound Name (E)-3-(3,4-dihydroxy-5-nitrophenyl)-3-hydroxy-2-pyrimidin-4-ylprop-2-enenitrile Investigative
Synonyms
CHEMBL4467308; SCHEMBL20100828
    Click to Show/Hide
External link
Activity
IC50 <= 500 nM
[231]
Compound Name (E)-3-(3,4-dihydroxy-5-nitrophenyl)-3-hydroxy-2-pyrazin-2-ylprop-2-enenitrile Investigative
Synonyms
CHEMBL4529597; SCHEMBL20100823
    Click to Show/Hide
External link
Activity
IC50 <= 500 nM
[231]
Compound Name 2-[2,6-Dichloro-4-(3,5-dihydroxyphenyl)anilino]benzoic acid Investigative
Synonyms
CHEMBL4563024
    Click to Show/Hide
External link
Activity
IC50 = 700 nM
[230]
Compound Name (Z)-2-(azetidine-1-carbonyl)-3-(3,4-dihydroxy-5-nitrophenyl)-3-hydroxyprop-2-enenitrile Investigative
Synonyms
CHEMBL4458750; SCHEMBL20100880
    Click to Show/Hide
External link
Activity
IC50 <= 750 nM
[231]
Compound Name 5-[(E)-1-cyano-2-(3,4-dihydroxy-5-nitrophenyl)-2-hydroxyethenyl]pyrazine-2-carboxylic acid Investigative
Synonyms
CHEMBL4463923; SCHEMBL21933009
    Click to Show/Hide
External link
Activity
IC50 <= 750 nM
[231]
Compound Name (Z)-3-amino-3-(3,4-dihydroxy-5-nitrophenyl)-2-(piperidine-1-carbonyl)prop-2-enenitrile Investigative
Synonyms
CHEMBL4590326; SCHEMBL20100883
    Click to Show/Hide
External link
Activity
IC50 <= 750 nM
[231]
Compound Name (E)-3-(3,4-dihydroxy-5-nitrophenyl)-3-hydroxy-2-pyridin-2-ylprop-2-enenitrile Investigative
Synonyms
CHEMBL4569935; SCHEMBL20100854
    Click to Show/Hide
External link
Activity
IC50 <= 750 nM
[231]
Compound Name Beta-hydroxybutyrate Investigative
Synonyms
3-hydroxybutanoate; beta-hydroxybutyrate; beta-hydroxybutanoate; 3-OH butyrate; 3-OH-butyrate; beta-hydroxy-n-butyrate; UNII-FG2UN5EP9V; FG2UN5EP9V; DL-3-Hydroxybutyrate; DTXSID9040976; CHEBI:37054; BDBM50270275; Butanoic acid, 3-hydroxy-, ION(1-); Q27117026; 151-03-1
    Click to Show/Hide
External link
Description
FTO fails to bind to its own promoter that promotes FTO expression in the hypothalamus ofhigh-fat diet-induced obese and 48-h fasting mice, suggesting a disruption of the stable expression of this gene.ketogenic diet-derived ketone body beta-hydroxybutyrate (BHB) transiently increases FTO expression in both mouse hypothalamus and cultured cells.
[210]
Compound Name FB23-2 Investigative
Synonyms
FB23-2; 2243736-45-8; 2-((2,6-Dichloro-4-(3,5-dimethylisoxazol-4-yl)phenyl)amino)-N-hydroxybenzamide; 2-[2,6-dichloro-4-(3,5-dimethyl-1,2-oxazol-4-yl)anilino]-N-hydroxybenzamide; CHEMBL4567838; SCHEMBL23261120; BCP31164; EX-A3403; MFCD32174281; s8837; HY-127103; CS-0093102; FB23-2(FTO Demethylase inhibitor FB23-2); D81008; A936868; FB-23-2; FB 23-2; FB232; FB-232; FB 232; 2-{[2,6-Dichloro-4-(3,5-dimethyl-1,2-oxazol-4-yl)phenyl]amino}-N-hydroxybenzamide
    Click to Show/Hide
External link
Description
FTO is a druggable target and that targeting FTO by small-molecule inhibitors(FB23 and FB23-2) holds potential to treatacute myeloid leukemia.
[193]
Compound Name DEHP Investigative
Synonyms
DEHP; 117-81-7; BIS(2-ETHYLHEXYL)PHTHALATE; Di(2-ethylhexyl)phthalate; Di(2-ethylhexyl) phthalate; Diethylhexyl phthalate; 2-Ethylhexyl phthalate; Di-sec-octyl phthalate; Octyl phthalate; Fleximel; Octoil; Ethylhexyl phthalate; Palatinol AH; Celluflex DOP; Vestinol AH; Bisoflex DOP; Kodaflex DOP; Staflex DOP; Truflex DOP; Flexol DOP; Vinicizer 80; Bisoflex 81; Eviplast 80; Eviplast 81; Hercoflex 260; RC plasticizer DOP; Compound 889; Witcizer 312; Platinol dop; Di-2-ethylhexyl phthalate; Nuoplaz dop; Platinol ah; Hatcol dop; Reomol dop; Pittsburgh PX-138; Sansocizer DOP; Ergoplast FDO; Monocizer DOP; Plasthall DOP; Flexol plasticizer DOP; Mollan O; Jayflex DOP; Sicol 150; Ergoplast FDO-S; Di(2-ethylhexyl)orthophthalate; Good-rite gp 264; Reomol D 79P; Bis(2-ethylhexyl) benzene-1,2-dicarboxylate; Di(ethylhexyl) phthalate; Bis(ethylhexyl) phthalate; Rcra waste number U028; Px-138; Phthalic acid dioctyl ester; NCI-C52733; Di(2-ethylhexyl) o-phthalate; Phthalic acid di(2-ethylhexyl) ester; 1,2-Benzenedicarboxylic acid, bis(2-ethylhexyl) ester; DOP; Bis(2-ethylhexyl) 1,2-benzenedicarboxylate; UNII-C42K0PH13C; Bis(2-ethylhexyl) o-phthalate; Phthalic acid, bis(2-ethylhexyl) ester; CHEBI:17747; 1,2-Benzenedicarboxylic acid bis(2-ethylhexyl) ester; Benzenedicarboxylic acid, bis(2-ethylhexyl) ester; Phthalic Acid Bis(2-ethylhexyl) Ester; Bis-(2-ethylhexyl)ester kyseliny ftalove; C42K0PH13C; 1,2-Benzenedicarboxylic acid, 1,2-bis(2-ethylhexyl) ester; DTXSID5020607; Etalon; Bis-(2-ethylhexyl)ester kyseliny ftalove [Czech]; Di-(2-ethylhexyl) phthalate; BIS-(2-ETHYLHEXYL) PHTHALATE; NCGC00091499-05; Sconamoll DOP; Diacizer DOP; Kodaflex DEHP; 15495-94-0; Etalon (plasticizer); Sansocizer R 8000; Caswell No. 392K; Dioctylphthalate; Behp; Di-2-ethylhexylphthalate; Diplast O; ESBO-D 82; Ergoplast FDO; Ergoplast FDO-S; Etalon; Phthalic acid, bis-2-ethylhexyl ester; DOF [Russian plasticizer]; SMR000777878; CCRIS 237; Ethyl hexyl phthalate; HSDB 339; Di(2-ethylhexyl) orthophthalate; Bis-(2-ethylhexyl)ester kyseliny ftalove (czech); EINECS 204-211-0; NSC 17069; Diethylhexylphthalate (Bis-(2-ethylhexyl) Phthalate); RCRA waste no. U028; Union carbide flexol 380; EPA Pesticide Chemical Code 295200; BRN 1890696; AI3-04273; DAF 68; Palatinol DOP; Polycizer DOP; Merrol DOP; Palatinol AH-L; Hatco DOP; Vinycizer 80; Di(2-ethylhexyl)phthalate (DEHP); N-Dioctyl phthalate; MFCD00009493; Corflex 400; Dioctyl phthalate, 99%; DSSTox_CID_607; 1, bis(ethylhexyl) ester; Epitope ID:140107; EC 204-211-0; WLN: 8OVR BVO8; Di(2-Ethylhexyl phthalate); DSSTox_RID_75688; DSSTox_GSID_20607; SCHEMBL20271; 14C -DEHP; 8033-53-2; MLS001333173; MLS001333174; MLS002454397; Dioctyl phthalate, >=99.5%; 1,2-Benzenedicarboxylic acid, bis-(1-ethylhexyl) ester; CHEMBL1242017; SCHEMBL21733281; HMS2233C15; HMS3374J09; AMY40790; HY-B1945; NSC17069; Tox21_400084; Bis(2-ethylhexyl)ester phthalic acid; NSC-17069; s3360; AKOS024318875; Bis(2-ethylhexyl) phthalate-[13C6]; Phthalic acid bis(2-ethylhexyl ester); MCULE-4692716107; NCGC00091499-01; NCGC00091499-02; NCGC00091499-04; NCGC00091499-06; NCGC00091499-07; CAS-117-81-7; I887; Bis(2-ethylhexyl) 1, 2-benzenedicarboxylate; CS-0014050; FT-0624576; FT-0663286; P0297; WLN: 4Y2 & 1OVR BVO1Y4 & 2; Bis(2-ethylhexyl) phthalate, Selectophore(TM); C03690; A937603; Q418492; 1,2-Benzenedicarboxylic acid bis-(1-ethylhexyl) ester; benzene-1,2-dicarboxylic acid bis(2-ethylhexyl) ester; BRD-A89471977-001-05-2; Bis(2-ethylhexyl) phthalate 100 microg/mL in Methanol; Bis(2-ethylhexyl) phthalate 5000 microg/mL in Methanol; F0001-0292; Bis(2-ethylhexyl) phthalate, SAJ first grade, >=98.0%; Bis(2-ethylhexyl) phthalate, PESTANAL(R), analytical standard; Phthalic acid, bis-2-ethylhexyl ester 10 microg/mL in Cyclohexane; Plastic additive 01, European Pharmacopoeia (EP) Reference Standard; Bis(2-ethylhexyl) phthalate, certified reference material, TraceCERT(R); Plastic additive 14, United States Pharmacopeia (USP) Reference Standard; 1,2-Benzenedicarboxylic acid, bis(2-ethylhexyl) ester, labeled with carbon-14; 50885-87-5; 82208-43-3
    Click to Show/Hide
External link
Description
DEHP worsened testicular histology, decreased testosterone concentrations, downregulated expression of spermatogenesis inducers, enhanced oxidative stress, inhibited theNrf2-mediated antioxidant pathway, and increased apoptosis in testes. DEHP is a common environmental endocrine disrupting chemical that inducesmale reproductive disorders. Additionally, DEHP increased global levels of m6A RNA modification and altered the expression of two important RNA methylation modulator genes, FTO and YTHDC2.
[110]
Compound Name Rhein Investigative
Synonyms
Monorhein; Rheic acid; Rhubarb Yellow; Cassic acid; 4,5-Dihydroxyanthraquinone-2-carboxylic acid; Chrysazin-3-carboxylic acid; 4,5-dihydroxy-9,10-dioxo-9,10-dihydroanthracene-2-carboxylic acid; NSC 38629; Rheinic acid; 1,8-Dihydroxyanthraquinone-3-carboxylic acid; dipropionyl rhein; 1,8-Dihydroxy-3-carboxyanthraquinone; UNII-YM64C2P6UX; Rhein(Monorhein); 2-Anthracenecarboxylic acid, 9,10-dihydro-4,5-dihydroxy-9,10-dioxo-; CCRIS 5129; 9,10-Dihydro-4,5-dihydroxy-9,10-dioxo-2-anthracenecarboxylic acid; C15H8O6
    Click to Show/Hide
External link
Description
Genetic depletion and pharmacological inhibition of FTO dramatically attenuate leukemia stem/initiating cell self-renewal and reprogram immune response by suppressing expression of immune checkpoint genes, especiallyLILRB4. FTO inhibitors, such as rhein, meclofenamic acid (MA), MO-I-500, fluorescein, and R-2HG, can inhibitacute myeloid leukemia cell viability. CS1 and CS2 displayed a much higher efficacy in inhibiting AML cell viability.
[30]
Compound Name MO-I-500 Investigative
Description
Genetic depletion and pharmacological inhibition of FTO dramatically attenuate leukemia stem/initiating cell self-renewal and reprogram immune response by suppressing expression of immune checkpoint genes, especiallyLILRB4. FTO inhibitors, such as rhein, meclofenamic acid (MA), MO-I-500, fluorescein, and R-2HG, can inhibitacute myeloid leukemia cell viability. CS1 and CS2 displayed a much higher efficacy in inhibiting AML cell viability.
[30]
Compound Name R-2HG Investigative
Synonyms
(R)-2-Hydroxypentanedioic acid; 13095-47-1; D-2-Hydroxyglutaric acid; (R)-2-hydroxyglutaric acid; (R)-Hydroxyglutarate; (R)-2-hydroxyglutarate; Pentanedioic acid, 2-hydroxy-, (2R)-; CHEMBL1614745; CHEBI:32796; D-2-Hydroxyglutarate; Glutaric acid, 2-hydroxy-; d-alpha-hydroxyglutaric acid; D-Hydroxyglutarate; 2HG; D-a-Hydroxyglutarate; 2-hydroxy-D-Glutarate; (R)-a-Hydroxyglutarate; delta-2-Hydroxyglutarate; D-a-Hydroxyglutaric acid; 2-hydroxy-delta-Glutarate; D-; A-Hydroxyglutaric acid; (2R)-hydroxyglutaric acid; 2-hydroxy-D-Glutaric acid; (R)-alpha-Hydroxyglutarate; delta-alpha-Hydroxyglutarate; SCHEMBL8032; (R)-a-Hydroxyglutaric acid; delta-2-Hydroxyglutaric acid; (R)-2-hydroxy-Pentanedioate; 2-hydroxy-delta-Glutaric acid; (R)-alpha-Hydroxyglutaric acid; delta-alpha-Hydroxyglutaric acid; (R)-2-hydroxy-Pentanedioic acid; DTXSID80897218; ZINC402968; BDBM50361471; AKOS027325193; FD21404; BS-50252; HY-113038; CS-0059411; C01087; 93397C3E-3CE9-4FEA-A2ED-8F6FA59A1FEA; Q27104222; Z2217110365; 636-67-9
    Click to Show/Hide
External link
Description
Genetic depletion and pharmacological inhibition of FTO dramatically attenuate leukemia stem/initiating cell self-renewal and reprogram immune response by suppressing expression of immune checkpoint genes, especiallyLILRB4. FTO inhibitors, such as rhein, meclofenamic acid (MA), MO-I-500, fluorescein, and R-2HG, can inhibitacute myeloid leukemia cell viability. CS1 and CS2 displayed a much higher efficacy in inhibiting AML cell viability.
[30]
Compound Name Mehp Investigative
Synonyms
Mehp; Mono(2-ethylhexyl) phthalate; PHTHALIC ACID MONO-2-ETHYLHEXYL ESTER; Mono(2-ethylhexyl)phthalate; 2-Ethylhexyl hydrogen phthalate; Monoethylhexyl phthalate; MONO-2-ETHYLHEXYL PHTHALATE; Mono-(2-ethylhexyl)phthalate; 2-(2-ethylhexoxycarbonyl)benzoic acid; (2-Ethylhexyl) hydrogen phthalate; 1,2-Benzenedicarboxylic acid, mono(2-ethylhexyl) ester; 2-{[(2-ethylhexyl)oxy]carbonyl}benzoic acid; Monoethylhexyl phthalic acid; Phthalic acid, mono-(2-ethylhexyl) ester; CHEBI:17243; PHTHALIC ACID MONOOCTYL ESTER; Phthalic acid mono-2-ethylhexylester; Phthalic acid, mono-2-ethylhexyl ester; NCGC00090773-04; 1276197-22-8; BAR 1; Phthalate, mono(2-ethylhexyl); CCRIS 1742; 2-([(2-Ethylhexyl)oxy]carbonyl)benzoic acid; rac Mono(ethylhexyl) Phthalate-d4; EINECS 224-477-1; mono(ethylhexyl) phthalate; mono-ethylhexyl; Mono-(2-ethylhexyl) phthalate; rac Mono(ethylhexyl) Phthalate; monoethylhexylphthalate; mono-ethylhexylphthalate; DSSTox_CID_5680; Phthalic acid, 2-ethylhexyl ester (6CI,7CI); DSSTox_RID_77879; DSSTox_GSID_25680; phthalicacidmonoethylhexylester; phthalicacid,2-ethylhexylester; SCHEMBL472689; mono-(2-ethyl)hexyl phthalate; PHTHALICACIDMONOETHYLHEXYL; CHEMBL1867438; DTXSID2025680; Monoethylhexyl phthalate (mEHP); phthalic acid, 2-ethylhexyl ester; Mono-(2-ethylhexyl) phthalate-d4; ACT03365; Tox21_400076; MFCD00041500; AKOS015902975; CS-W019178; HY-W018392; 2-(2-ethylhexyloxycarbonyl)benzoic acid; PHTHALICACIDMONO-2-ETHYLEXYLESTER; NCGC00090773-01; NCGC00090773-02; NCGC00090773-03; NCGC00090773-05; NCGC00090773-06; DS-16446; CAS-4376-20-9; DB-007821; 2-[(2S)-2-ethylhexoxy]carbonylbenzoic acid; FT-0600523; Phthalic acid mono-2-ethylhexyl ester liquid; Phthalic acid mono-2-ethylhexyl ester, 97%; W6291; C03343; Phthalic acid hydrogen 1-(2-ethylhexyl) ester; 2-([(2-Ethylhexyl)oxy]carbonyl)benzoic acid #; A826416; Phthalic acid 1-hydrogen 2-(2-ethylhexyl) ester; phthalic acid mono-2-ethylhexyl ester, AldrichCPR; 1,2-benzenedicarboxylicacid,mono(2-ethylhexyl)ester; BRD-A18246003-001-01-1; Q26841225; 1,2-Benzenedicarboxylic acid, mono(2-ethylhexyl) ester (9CI); Phthalic acid, mono-2-ethylhexyl ester 100 microg/mL in Acetonitrile
    Click to Show/Hide
External link
Description
The inhibition of FTO-mediated up-regulation of m6A could be involved in MEHP-inducedLeydig cell apoptosis.
[229]
Compound Name Cycloleucine Investigative
Synonyms
1-Aminocyclopentanecarboxylic acid; 52-52-8; 1-Aminocyclopentane-1-carboxylic acid; Cycloleucin; 1-Amino-1-cyclopentanecarboxylic acid; 1-Amino-1-carboxycyclopentane; 1-Amino-cyclopentanecarboxylic acid; CYCLO-LEUCINE; Cyclopentanecarboxylic acid, 1-amino-; NSC 1026; CB 1639; X 201; UNII-0TQU7668EI; 1-Aminocyclopentanecarboxylate; HSDB 5195; WR 14,997; NSC1026; 1-amino cyclopentane carboxylic acid; EINECS 200-144-6; BRN 0636626; aminocyclopentanecarboxylic acid; Cyclopentanecarboxylic acid, 1-amino-, L-; AI3-26442
    Click to Show/Hide
External link
Description
Studies of the aberrant expression of m6A mediators inbreast cancer revealed that they were associated with different BC subtypes and functions, such as proliferation, apoptosis, stemness, the cell cycle, migration, and metastasis, through several factors and signaling pathways, such asBcl-2 and the PI3K/Akt pathway, among others. Fat mass and obesity-associated protein (FTO) was identified as the first m6A demethylase, and a series of inhibitors that target FTO were reported to have potential for the treatment of BC by inhibiting cell proliferation and promoting apoptosis.
[4]
Compound Name 4-amino-3-quinolinecarboxylic acid Investigative
Synonyms
4-amino-3-quinolinecarboxylic acid; 4-Amino-quinoline-3-carboxylic acid; 3-Quinolinecarboxylicacid, 4-amino-; 4-aminoquinoline-3-carboxylic; SCHEMBL436714; DTXSID10470018; BBL031107; MFCD08705653; STK660776; ZINC14982158; AKOS002326679; MCULE-8408161492; SB67440; VS-10248; DB-081679; BB 0222277; CS-0248109; FT-0748901; Y9812; EN300-39148; J-514466; F2183-0223; Z398556732
    Click to Show/Hide
External link
Description
Inhibition of m6A RNA demethylation by small-molecule drugs, as presented here, has therapeutic potential and provides tools for the identification of disease-modifying m6A RNAs inneurogenesis and neuroregeneration. Small-molecule inhibitors of the RNA m6A demethylases FTO potently support the survival of dopamine neurons.
[212]
References
Ref 1 The FTO/miR-181b-3p/ARL5B signaling pathway regulates cell migration and invasion in breast cancer. Cancer Commun (Lond). 2020 Oct;40(10):484-500. doi: 10.1002/cac2.12075. Epub 2020 Aug 17.
Ref 2 FTO Plays an Oncogenic Role in Acute Myeloid Leukemia as a N(6)-Methyladenosine RNA Demethylase. Cancer Cell. 2017 Jan 9;31(1):127-141. doi: 10.1016/j.ccell.2016.11.017. Epub 2016 Dec 22.
Ref 3 FTO suppresses glycolysis and growth of papillary thyroid cancer via decreasing stability of APOE mRNA in an N6-methyladenosine-dependent manner. J Exp Clin Cancer Res. 2022 Jan 28;41(1):42. doi: 10.1186/s13046-022-02254-z.
Ref 4 The Complex Roles and Therapeutic Implications of m(6)A Modifications in Breast Cancer. Front Cell Dev Biol. 2021 Jan 11;8:615071. doi: 10.3389/fcell.2020.615071. eCollection 2020.
Ref 5 Exosomal Delivery of FTO Confers Gefitinib Resistance to Recipient Cells through ABCC10 Regulation in an m6A-dependent Manner. Mol Cancer Res. 2021 Apr;19(4):726-738. doi: 10.1158/1541-7786.MCR-20-0541. Epub 2021 Feb 9.
Ref 6 RNA N6-methyladenosine demethylase FTO promotes breast tumor progression through inhibiting BNIP3. Mol Cancer. 2019 Mar 28;18(1):46. doi: 10.1186/s12943-019-1004-4.
Ref 7 m(6)A mRNA demethylase FTO regulates melanoma tumorigenicity and response to anti-PD-1 blockade. Nat Commun. 2019 Jun 25;10(1):2782. doi: 10.1038/s41467-019-10669-0.
Ref 8 N6-methyladenosine demethylase FTO promotes growth and metastasis of gastric cancer via m(6)A modification of caveolin-1 and metabolic regulation of mitochondrial dynamics. Cell Death Dis. 2022 Jan 21;13(1):72. doi: 10.1038/s41419-022-04503-7.
Ref 9 R-2HG Exhibits Anti-tumor Activity by Targeting FTO/m(6)A/MYC/CEBPA Signaling. Cell. 2018 Jan 11;172(1-2):90-105.e23. doi: 10.1016/j.cell.2017.11.031. Epub 2017 Dec 14.
Ref 10 FTO promotes SREBP1c maturation and enhances CIDEC transcription during lipid accumulation in HepG2 cells. Biochim Biophys Acta Mol Cell Biol Lipids. 2018 May;1863(5):538-548. doi: 10.1016/j.bbalip.2018.02.003. Epub 2018 Feb 25.
Ref 11 FTO promotes cell proliferation and migration in esophageal squamous cell carcinoma through up-regulation of MMP13. Exp Cell Res. 2020 Apr 1;389(1):111894. doi: 10.1016/j.yexcr.2020.111894. Epub 2020 Feb 6.
Ref 12 Targeting ATF4-dependent pro-survival autophagy to synergize glutaminolysis inhibition. Theranostics. 2021 Jul 25;11(17):8464-8479. doi: 10.7150/thno.60028. eCollection 2021.
Ref 13 Epigallocatechin gallate targets FTO and inhibits adipogenesis in an mRNA m(6)A-YTHDF2-dependent manner. Int J Obes (Lond). 2018 Jul;42(7):1378-1388. doi: 10.1038/s41366-018-0082-5. Epub 2018 May 24.
Ref 14 FTO regulates adipogenesis by controlling cell cycle progression via m(6)A-YTHDF2 dependent mechanism. Biochim Biophys Acta Mol Cell Biol Lipids. 2018 Oct;1863(10):1323-1330. doi: 10.1016/j.bbalip.2018.08.008. Epub 2018 Aug 13.
Ref 15 Metformin combats obesity by targeting FTO in an m(6)A-YTHDF2-dependent manner. J Drug Target. 2022 May 9:1-9. doi: 10.1080/1061186X.2022.2071906. Online ahead of print.
Ref 16 RNA m6A demethylase FTO-mediated epigenetic up-regulation of LINC00022 promotes tumorigenesis in esophageal squamous cell carcinoma. J Exp Clin Cancer Res. 2021 Sep 20;40(1):294. doi: 10.1186/s13046-021-02096-1.
Ref 17 M(6)A demethylase FTO-mediated downregulation of DACT1 mRNA stability promotes Wnt signaling to facilitate osteosarcoma progression. Oncogene. 2022 Mar;41(12):1727-1741. doi: 10.1038/s41388-022-02214-z. Epub 2022 Feb 4.
Ref 18 Glucose Is Involved in the Dynamic Regulation of m6A in Patients With Type 2 Diabetes. J Clin Endocrinol Metab. 2019 Mar 1;104(3):665-673. doi: 10.1210/jc.2018-00619.
Ref 19 Omeprazole improves chemosensitivity of gastric cancer cells by m6A demethylase FTO-mediated activation of mTORC1 and DDIT3 up-regulation. Biosci Rep. 2021 Jan 29;41(1):BSR20200842. doi: 10.1042/BSR20200842.
Ref 20 Mutant NPM1-Regulated FTO-Mediated m(6)A Demethylation Promotes Leukemic Cell Survival via PDGFRB/ERK Signaling Axis. Front Oncol. 2022 Feb 8;12:817584. doi: 10.3389/fonc.2022.817584. eCollection 2022.
Ref 21 N(6)-Methylation of Adenosine of FZD10 mRNA Contributes to PARP Inhibitor Resistance. Cancer Res. 2019 Jun 1;79(11):2812-2820. doi: 10.1158/0008-5472.CAN-18-3592. Epub 2019 Apr 9.
Ref 22 Down-Regulation of m6A mRNA Methylation Is Involved in Dopaminergic Neuronal Death. ACS Chem Neurosci. 2019 May 15;10(5):2355-2363. doi: 10.1021/acschemneuro.8b00657. Epub 2019 Mar 14.
Ref 23 Vascular Smooth Muscle FTO Promotes Aortic Dissecting Aneurysms via m6A Modification of Klf5. Front Cardiovasc Med. 2020 Nov 20;7:592550. doi: 10.3389/fcvm.2020.592550. eCollection 2020.
Ref 24 The RNA demethylase FTO is required for maintenance of bone mass and functions to protect osteoblasts from genotoxic damage. Proc Natl Acad Sci U S A. 2019 Sep 3;116(36):17980-17989. doi: 10.1073/pnas.1905489116. Epub 2019 Aug 21.
Ref 25 FTO promotes multiple myeloma progression by posttranscriptional activation of HSF1 in an m(6)A-YTHDF2-dependent manner. Mol Ther. 2022 Mar 2;30(3):1104-1118. doi: 10.1016/j.ymthe.2021.12.012. Epub 2021 Dec 13.
Ref 26 m6A RNA Methylation Controls Proliferation of Human Glioma Cells by Influencing Cell Apoptosis. Cytogenet Genome Res. 2019;159(3):119-125. doi: 10.1159/000499062. Epub 2019 Oct 23.
Ref 27 The tumor-suppressive effects of alpha-ketoglutarate-dependent dioxygenase FTO via N6-methyladenosine RNA methylation on bladder cancer patients. Bioengineered. 2021 Dec;12(1):5323-5333. doi: 10.1080/21655979.2021.1964893.
Ref 28 N(6)-Methyladenosine RNA Demethylase FTO Promotes Gastric Cancer Metastasis by Down-Regulating the m6A Methylation of ITGB1. Front Oncol. 2021 Jul 1;11:681280. doi: 10.3389/fonc.2021.681280. eCollection 2021.
Ref 29 N6-Methyladenosine Demethylase FTO (Fat Mass and Obesity-Associated Protein) as a Novel Mediator of Statin Effects in Human Endothelial Cells. Arterioscler Thromb Vasc Biol. 2022 May;42(5):644-658. doi: 10.1161/ATVBAHA.121.317295. Epub 2022 Mar 17.
Ref 30 Targeting FTO Suppresses Cancer Stem Cell Maintenance and Immune Evasion. Cancer Cell. 2020 Jul 13;38(1):79-96.e11. doi: 10.1016/j.ccell.2020.04.017. Epub 2020 Jun 11.
Ref 31 MMP24 Contributes to Neuropathic Pain in an FTO-Dependent Manner in the Spinal Cord Neurons. Front Pharmacol. 2021 Apr 29;12:673831. doi: 10.3389/fphar.2021.673831. eCollection 2021.
Ref 32 Demethyltransferase FTO alpha-ketoglutarate dependent dioxygenase (FTO) regulates the proliferation, migration, invasion and tumor growth of prostate cancer by modulating the expression of melanocortin 4 receptor (MC4R). Bioengineered. 2022 Mar;13(3):5598-5612. doi: 10.1080/21655979.2021.2001936.
Ref 33 WNT/Beta-catenin-suppressed FTO expression increases m(6)A of c-Myc mRNA to promote tumor cell glycolysis and tumorigenesis. Cell Death Dis. 2021 May 8;12(5):462. doi: 10.1038/s41419-021-03739-z.
Ref 34 microRNA-96 promotes occurrence and progression of colorectal cancer via regulation of the AMPKAlpha2-FTO-m6A/MYC axis. J Exp Clin Cancer Res. 2020 Nov 12;39(1):240. doi: 10.1186/s13046-020-01731-7.
Ref 35 Kinase GSK3Beta functions as a suppressor in colorectal carcinoma through the FTO-mediated MZF1/c-Myc axis. J Cell Mol Med. 2021 Mar;25(5):2655-2665. doi: 10.1111/jcmm.16291. Epub 2021 Feb 2.
Ref 36 The role of the fat mass and obesity-associated protein in the proliferation of pancreatic cancer cells. Oncol Lett. 2019 Feb;17(2):2473-2478. doi: 10.3892/ol.2018.9873. Epub 2018 Dec 28.
Ref 37 Correlation of m6A methylation with immune infiltrates and poor prognosis in non-small cell lung cancer via a comprehensive analysis of RNA expression profiles. Ann Transl Med. 2021 Sep;9(18):1465. doi: 10.21037/atm-21-4248.
Ref 38 The m(6)A eraser FTO facilitates proliferation and migration of human cervical cancer cells. Cancer Cell Int. 2019 Dec 2;19:321. doi: 10.1186/s12935-019-1045-1. eCollection 2019.
Ref 39 m(6)A demethylase FTO facilitates tumor progression in lung squamous cell carcinoma by regulating MZF1 expression. Biochem Biophys Res Commun. 2018 Aug 25;502(4):456-464. doi: 10.1016/j.bbrc.2018.05.175. Epub 2018 Jun 2.
Ref 40 FTO-mediated demethylation of GADD45B promotes myogenesis through the activation of p38 MAPK pathway. Mol Ther Nucleic Acids. 2021 Jun 24;26:34-48. doi: 10.1016/j.omtn.2021.06.013. eCollection 2021 Dec 3.
Ref 41 The m(6)A RNA demethylase FTO is a HIF-independent synthetic lethal partner with the VHL tumor suppressor. Proc Natl Acad Sci U S A. 2020 Sep 1;117(35):21441-21449. doi: 10.1073/pnas.2000516117. Epub 2020 Aug 19.
Ref 42 Dysregulation of USP18/FTO/PYCR1 signaling network promotes bladder cancer development and progression. Aging (Albany NY). 2021 Jan 10;13(3):3909-3925. doi: 10.18632/aging.202359. Epub 2021 Jan 10.
Ref 43 Long noncoding RNA just proximal to X-inactive specific transcript facilitates aerobic glycolysis and temozolomide chemoresistance by promoting stability of PDK1 mRNA in an m6A-dependent manner in glioblastoma multiforme cells. Cancer Sci. 2021 Nov;112(11):4543-4552. doi: 10.1111/cas.15072. Epub 2021 Aug 30.
Ref 44 The m(6)A demethylase FTO promotes the osteogenesis of mesenchymal stem cells by downregulating PPARG. Acta Pharmacol Sin. 2022 May;43(5):1311-1323. doi: 10.1038/s41401-021-00756-8. Epub 2021 Aug 30.
Ref 45 RNA N6-methyladenosine demethylase FTO promotes pancreatic cancer progression by inducing the autocrine activity of PDGFC in an m(6)A-YTHDF2-dependent manner. Oncogene. 2022 May;41(20):2860-2872. doi: 10.1038/s41388-022-02306-w. Epub 2022 Apr 14.
Ref 46 N6-methyladenosine demethylase FTO suppresses clear cell renal cell carcinoma through a novel FTO-PGC-1Alpha signalling axis. J Cell Mol Med. 2019 Mar;23(3):2163-2173. doi: 10.1111/jcmm.14128. Epub 2019 Jan 16.
Ref 47 FTO is required for myogenesis by positively regulating mTOR-PGC-1Alpha pathway-mediated mitochondria biogenesis. Cell Death Dis. 2017 Mar 23;8(3):e2702. doi: 10.1038/cddis.2017.122.
Ref 48 Fat mass and obesity-associated protein regulates arecoline-exposed oral cancer immune response through programmed cell death-ligand 1. Cancer Sci. 2022 Mar 15. doi: 10.1111/cas.15332. Online ahead of print.
Ref 49 m6A demethylase FTO promotes hepatocellular carcinoma tumorigenesis via mediating PKM2 demethylation. Am J Transl Res. 2019 Sep 15;11(9):6084-6092. eCollection 2019.
Ref 50 AMD1 upregulates hepatocellular carcinoma cells stemness by FTO mediated mRNA demethylation. Clin Transl Med. 2021 Mar;11(3):e352. doi: 10.1002/ctm2.352.
Ref 51 RNA N6-methyladenosine demethylase FTO promotes osteoporosis through demethylating Runx2 mRNA and inhibiting osteogenic differentiation. Aging (Albany NY). 2021 Sep 8;13(17):21134-21141. doi: 10.18632/aging.203377. Epub 2021 Sep 8.
Ref 52 Protective mechanism of demethylase fat mass and obesity-associated protein in energy metabolism disorder of hypoxia-reoxygenation-induced cardiomyocytes. Exp Physiol. 2021 Dec;106(12):2423-2433. doi: 10.1113/EP089901. Epub 2021 Nov 21.
Ref 53 m(6)A RNA modification controls autophagy through upregulating ULK1 protein abundance. Cell Res. 2018 Sep;28(9):955-957. doi: 10.1038/s41422-018-0069-8. Epub 2018 Jul 25.
Ref 54 Autophagy of the m(6)A mRNA demethylase FTO is impaired by low-level arsenic exposure to promote tumorigenesis. Nat Commun. 2021 Apr 12;12(1):2183. doi: 10.1038/s41467-021-22469-6.
Ref 55 M(6) A demethylase fat mass and obesity-associated protein regulates cisplatin resistance of gastric cancer by modulating autophagy activation through ULK1. Cancer Sci. 2022 Jun 22. doi: 10.1111/cas.15469. Online ahead of print.
Ref 56 FTO promotes Bortezomib resistance via m6A-dependent destabilization of SOD2 expression in multiple myeloma. Cancer Gene Ther. 2022 Feb 10. doi: 10.1038/s41417-022-00429-6. Online ahead of print.
Ref 57 m(6)A RNA demethylase FTO promotes the growth, migration and invasion of pancreatic cancer cells through inhibiting TFPI-2. Epigenetics. 2022 Apr 11:1-15. doi: 10.1080/15592294.2022.2061117. Online ahead of print.
Ref 58 SPI1-induced?downregulation of FTO promotes GBM progression by regulating pri-miR-10a processing in an m6A-dependent manner. Mol Ther Nucleic Acids. 2022 Jan 1;27:699-717. doi: 10.1016/j.omtn.2021.12.035. eCollection 2022 Mar 8.
Ref 59 FTO demethylates YAP mRNA promoting oral squamous cell carcinoma tumorigenesis. Neoplasma. 2022 Jan;69(1):71-79. doi: 10.4149/neo_2021_210716N967. Epub 2021 Nov 16.
Ref 60 m(6)A demethylase FTO regulates the apoptosis and inflammation of cardiomyocytes via YAP1 in ischemia-reperfusion injury. Bioengineered. 2022 Mar;13(3):5443-5452. doi: 10.1080/21655979.2022.2030572.
Ref 61 Downregulation of Fat Mass and Obesity Associated (FTO) Promotes the Progression of Intrahepatic Cholangiocarcinoma. Front Oncol. 2019 May 9;9:369. doi: 10.3389/fonc.2019.00369. eCollection 2019.
Ref 62 M(6)A methylation-mediated elevation of SM22Alpha?inhibits the proliferation and migration of?vascular smooth muscle cells and ameliorates?intimal hyperplasia in type 2 diabetes mellitus. Biol Chem. 2021 Dec 7;403(3):317-329. doi: 10.1515/hsz-2021-0296. Print 2022 Feb 23.
Ref 63 CircRAB11FIP1 promoted autophagy flux of ovarian cancer through DSC1 and miR-129. Cell Death Dis. 2021 Feb 26;12(2):219. doi: 10.1038/s41419-021-03486-1.
Ref 64 m(6)A mRNA methylation controls autophagy and adipogenesis by targeting Atg5 and Atg7. Autophagy. 2020 Jul;16(7):1221-1235. doi: 10.1080/15548627.2019.1659617. Epub 2019 Aug 26.
Ref 65 FTO modifies the m6A level of MALAT and promotes bladder cancer progression. Clin Transl Med. 2021 Feb;11(2):e310. doi: 10.1002/ctm2.310.
Ref 66 Changes and relationship of N(6)-methyladenosine modification and long non-coding RNAs in oxidative damage induced by cadmium in pancreatic Beta-cells. Toxicol Lett. 2021 Jun 1;343:56-66. doi: 10.1016/j.toxlet.2021.02.014. Epub 2021 Feb 24.
Ref 67 FDA Label of Uptravi. The 2020 official website of the U.S. Food and Drug Administration.
Ref 68 Association of the ABCG2 C421A polymorphism with prostate cancer risk and survival. BJU Int. 2008 Dec;102(11):1694-9. doi: 10.1111/j.1464-410X.2008.07913.x. Epub 2008 Aug 14.
Ref 69 Optimization of the antitumor activity of sequence-specific pyrrolobenzodiazepine derivatives based on their affinity for ABC transporters. AAPS J. 2010 Dec;12(4):617-27.
Ref 70 A new tumor-specific variant of GRP78 as target for antibody-based therapy. Lab Invest. 2008 Apr;88(4):375-86. doi: 10.1038/labinvest.2008.2. Epub 2008 Feb 11.
Ref 71 The RNA N6-Methyladenosine Demethylase FTO Promotes Head and Neck Squamous Cell Carcinoma Proliferation and Migration by Increasing CTNNB1. Int J Gen Med. 2021 Nov 24;14:8785-8795. doi: 10.2147/IJGM.S339095. eCollection 2021.
Ref 72 FTO regulates the chemo-radiotherapy resistance of cervical squamous cell carcinoma (CSCC) by targeting Beta-catenin through mRNA demethylation. Mol Carcinog. 2018 May;57(5):590-597. doi: 10.1002/mc.22782. Epub 2018 Feb 1.
Ref 73 Halofantrine metabolism in microsomes in man: major role of CYP 3A4 and CYP 3A5. J Pharm Pharmacol. 1999 Apr;51(4):419-26. doi: 10.1211/0022357991772628.
Ref 74 Meclofenamic acid promotes cisplatin-induced acute kidney injury by inhibiting fat mass and obesity-associated protein-mediated m(6)A abrogation in RNA. J Biol Chem. 2019 Nov 8;294(45):16908-16917. doi: 10.1074/jbc.RA119.011009. Epub 2019 Oct 2.
Ref 75 N6-methyladenosine demethylase FTO suppressed prostate cancer progression by maintaining CLIC4 mRNA stability. Cell Death Discov. 2022 Apr 9;8(1):184. doi: 10.1038/s41420-022-01003-7.
Ref 76 Potential interaction between ritonavir and carbamazepine. Pharmacotherapy. 2000 Jul;20(7):851-4. doi: 10.1592/phco.20.9.851.35206.
Ref 77 Interferon-beta gene therapy for cancer: basic research to clinical application. Cancer Sci. 2004 Nov;95(11):858-65. doi: 10.1111/j.1349-7006.2004.tb02194.x.
Ref 78 FTO promotes tumour proliferation in bladder cancer via the FTO/miR-576/CDK6 axis in an m6A-dependent manner. Cell Death Discov. 2021 Nov 1;7(1):329. doi: 10.1038/s41420-021-00724-5.
Ref 79 Methylation of adenosine at the N(6) position post-transcriptionally regulates hepatic P450s expression. Biochem Pharmacol. 2020 Jan;171:113697. doi: 10.1016/j.bcp.2019.113697. Epub 2019 Nov 7.
Ref 80 RNA m(6)A methylation regulates the ultraviolet-induced DNA damage response. Nature. 2017 Mar 23;543(7646):573-576. doi: 10.1038/nature21671. Epub 2017 Mar 15.
Ref 81 m6A demethylase FTO promotes tumor progression via regulation of lipid metabolism in esophageal cancer. Cell Biosci. 2022 May 14;12(1):60. doi: 10.1186/s13578-022-00798-3.
Ref 82 N6-methyladenosine demethyltransferase FTO-mediated autophagy in malignant development of oral squamous cell carcinoma. Oncogene. 2021 Jun;40(22):3885-3898. doi: 10.1038/s41388-021-01820-7. Epub 2021 May 10.
Ref 83 Fat mass and obesity-associated protein regulates lipogenesis via m(6) A modification in fatty acid synthase mRNA. Cell Biol Int. 2021 Feb;45(2):334-344. doi: 10.1002/cbin.11490. Epub 2020 Nov 8.
Ref 84 N6-methyladenosine Demethylase FTO Induces the Dysfunctions of Ovarian Granulosa Cells by Upregulating Flotillin 2. Reprod Sci. 2022 Apr;29(4):1305-1315. doi: 10.1007/s43032-021-00664-6. Epub 2021 Jul 12.
Ref 85 Influence of CYP2C8 polymorphisms on the hydroxylation metabolism of paclitaxel, repaglinide and ibuprofen enantiomers in vitro. Biopharm Drug Dispos. 2013 Jul;34(5):278-87. doi: 10.1002/bdd.1842. Epub 2013 Jun 3.
Ref 86 Multicentre phase I/II study of PI-88, a heparanase inhibitor in combination with docetaxel in patients with metastatic castrate-resistant prostate cancer. Ann Oncol. 2010 Jun;21(6):1302-1307. doi: 10.1093/annonc/mdp524. Epub 2009 Nov 16.
Ref 87 Structure-based design of potent small-molecule inhibitors of anti-apoptotic Bcl-2 proteins. J Med Chem. 2006 Oct 19;49(21):6139-42. doi: 10.1021/jm060460o.
Ref 88 Clinical pipeline report, company report or official report of Astex Pharmaceuticals.
Ref 89 FTO promotes colorectal cancer progression and chemotherapy resistance via demethylating G6PD/PARP1. Clin Transl Med. 2022 Mar;12(3):e772. doi: 10.1002/ctm2.772.
Ref 90 Potent and selective inhibitors of the Met [hepatocyte growth factor/scatter factor (HGF/SF) receptor] tyrosine kinase block HGF/SF-induced tumor cell growth and invasion. Mol Cancer Ther. 2003 Nov;2(11):1085-92.
Ref 91 N(6)-Methyladenosine Demethylase FTO Contributes to Neuropathic Pain by Stabilizing G9a Expression in Primary Sensory Neurons. Adv Sci (Weinh). 2020 May 27;7(13):1902402. doi: 10.1002/advs.201902402. eCollection 2020 Jul.
Ref 92 HOXB13 promotes gastric cancer cell migration and invasion via IGF-1R upregulation and subsequent activation of PI3K/AKT/mTOR signaling pathway. Life Sci. 2021 Aug 1;278:119522. doi: 10.1016/j.lfs.2021.119522. Epub 2021 Apr 21.
Ref 93 FTO demethylates m6A modifications in HOXB13 mRNA and promotes endometrial cancer metastasis by activating the WNT signalling pathway. RNA Biol. 2021 Sep;18(9):1265-1278. doi: 10.1080/15476286.2020.1841458. Epub 2020 Nov 5.
Ref 94 miRNA-mediated loss of m6A increases nascent translation in glioblastoma. PLoS Genet. 2021 Mar 8;17(3):e1009086. doi: 10.1371/journal.pgen.1009086. eCollection 2021 Mar.
Ref 95 IDH Mutation, Competitive Inhibition of FTO, and RNA Methylation. Cancer Cell. 2017 May 8;31(5):619-620. doi: 10.1016/j.ccell.2017.04.001.
Ref 96 A functional role of the C-terminal 42 amino acids of SUR2A and SUR2B in the physiology and pharmacology of cardiovascular ATP-sensitive K(+) channels. J Mol Cell Cardiol. 2005 Jul;39(1):1-6. doi: 10.1016/j.yjmcc.2004.11.022. Epub 2005 Feb 5.
Ref 97 FTO downregulation mediated by hypoxia facilitates colorectal cancer metastasis. Oncogene. 2021 Aug;40(33):5168-5181. doi: 10.1038/s41388-021-01916-0. Epub 2021 Jul 3.
Ref 98 Chronic glucose-lowering effects of rosiglitazone and bis(ethylmaltolato) oxovanadium(IV) in ZDF rats. Canadian Journal of Physiology and Pharmacology. 12/2003; 81(11):1049-55.
Ref 99 Tacrine sinusoidal uptake and biliary excretion in sandwich-cultured primary rat hepatocytes. J Pharm Pharm Sci. 2014;17(3):427-38. doi: 10.18433/j3801t.
Ref 100 Clinical pipeline report, company report or official report of Agenus.
Ref 101 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2030).
Ref 102 Clinical pipeline report, company report or official report of Prelude Therapeutics.
Ref 103 Inhibition of CXCR4 by LY2624587, a Fully Humanized Anti-CXCR4 Antibody Induces Apoptosis of Hematologic Malignancies. PLoS One. 2016 Mar 8;11(3):e0150585. doi: 10.1371/journal.pone.0150585. eCollection 2016.
Ref 104 Buprenorphine in cancer pain. Support Care Cancer. 2005 Nov;13(11):878-87. doi: 10.1007/s00520-005-0849-9. Epub 2005 Jul 12.
Ref 105 Novel triazolopyridylbenzamides as potent and selective p38Alpha inhibitors. Bioorg Med Chem Lett. 2012 May 15;22(10):3431-6. doi: 10.1016/j.bmcl.2012.03.099. Epub 2012 Apr 4.
Ref 106 Apoptosis as a mechanism for the treatment of adult T cell leukemia: promising drugs from benchside to bedside. Drug Discov Today. 2020 Jul;25(7):1189-1197. doi: 10.1016/j.drudis.2020.04.023. Epub 2020 May 7.
Ref 107 Role of methionine adenosyltransferase 2A and S-adenosylmethionine in mitogen-induced growth of human colon cancer cells. Gastroenterology. 2007 Jul;133(1):207-18. doi: 10.1053/j.gastro.2007.03.114. Epub 2007 Apr 11.
Ref 108 Future pharmacological treatment options for nonexudative and exudative age-related macular degeneration. Expert Opin Emerg Drugs. 2005 Feb;10(1):119-35. doi: 10.1517/14728214.10.1.119.
Ref 109 The selective hypoxia inducible factor-1 inhibitor PX-478 provides in vivo radiosensitization through tumor stromal effects. Mol Cancer Ther. 2009 Apr;8(4):947-58. doi: 10.1158/1535-7163.MCT-08-0981.
Ref 110 Increased m6A RNA modification is related to the inhibition of the Nrf2-mediated antioxidant response in di-(2-ethylhexyl) phthalate-induced prepubertal testicular injury. Environ Pollut. 2020 Apr;259:113911. doi: 10.1016/j.envpol.2020.113911. Epub 2020 Jan 6.
Ref 111 Quantitative prediction of fold resistance for inhibitors of EGFR. Biochemistry. 2009 Sep 8;48(35):8435-48. doi: 10.1021/bi900729a.
Ref 112 FTO-dependent demethylation of N6-methyladenosine regulates mRNA splicing and is required for adipogenesis. Cell Res. 2014 Dec;24(12):1403-19. doi: 10.1038/cr.2014.151. Epub 2014 Nov 21.
Ref 113 m6A demethylase FTO induces NELL2 expression by inhibiting E2F1 m6A modification leading to metastasis of non-small cell lung cancer. Mol Ther Oncolytics. 2021 Apr 29;21:367-376. doi: 10.1016/j.omto.2021.04.011. eCollection 2021 Jun 25.
Ref 114 FTO mediated ERBB2 demethylation promotes tumor progression in esophageal squamous cell carcinoma cells. Clin Exp Metastasis. 2022 Aug;39(4):623-639. doi: 10.1007/s10585-022-10169-4. Epub 2022 May 7.
Ref 115 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7422).
Ref 116 Clinical pipeline report, company report or official report of Innovent.
Ref 117 Heparanase affects secretory granule homeostasis of murine mast cells through degrading heparin. J Allergy Clin Immunol. 2011 Dec;128(6):1310-1317.e8. doi: 10.1016/j.jaci.2011.04.011. Epub 2011 May 14.
Ref 118 Inhibition of cyclooxygenase-2 improves cardiac function in myocardial infarction. Biochem Biophys Res Commun. 2000 Jul 5;273(2):772-5. doi: 10.1006/bbrc.2000.3010.
Ref 119 Fat mass and obesity-associated protein (FTO) mediates signal transducer and activator of transcription 3 (STAT3)-drived resistance of breast cancer to doxorubicin. Bioengineered. 2021 Dec;12(1):1874-1889. doi: 10.1080/21655979.2021.1924544.
Ref 120 Effect of genetic polymorphisms in cytochrome p450 (CYP) 2C9 and CYP2C8 on the pharmacokinetics of oral antidiabetic drugs: clinical relevance. Clin Pharmacokinet. 2005;44(12):1209-25. doi: 10.2165/00003088-200544120-00002.
Ref 121 NADPH- and hydroperoxide-supported 17beta-estradiol hydroxylation catalyzed by a variant form (432L, 453S) of human cytochrome P450 1B1. J Steroid Biochem Mol Biol. 2000 Sep;74(1-2):11-8. doi: 10.1016/s0960-0760(00)00083-2.
Ref 122 FTO-mediated m(6) A modification of SOCS1 mRNA promotes the progression of diabetic kidney disease. Clin Transl Med. 2022 Jun;12(6):e942. doi: 10.1002/ctm2.942.
Ref 123 PD-1 as a potential target in cancer therapy. Cancer Med. 2013 October; 2(5): 662-673.
Ref 124 US patent application no. 8,669,257, Phenazine derivatives and uses thereof as potassium channel modulators.
Ref 125 The m6A demethylase FTO promotes the growth of lung cancer cells by regulating the m6A level of USP7 mRNA. Biochem Biophys Res Commun. 2019 May 7;512(3):479-485. doi: 10.1016/j.bbrc.2019.03.093. Epub 2019 Mar 21.
Ref 126 Clinical pipeline report, company report or official report of Alpine Immune Sciences.
Ref 127 National Cancer Institute Drug Dictionary (drug name CC 90002).
Ref 128 ClinicalTrials.gov (NCT03152435) EGFR CART Cells for Patients With Metastatic Colorectal Cancer
Ref 129 FTO-stabilized lncRNA HOXC13-AS epigenetically upregulated FZD6 and activated Wnt/Beta-catenin signaling to drive cervical cancer proliferation, invasion, and EMT. J BUON. 2021 Jul-Aug;26(4):1279-1291.
Ref 130 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800029267)
Ref 131 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2019).
Ref 132 FTO overexpression inhibits apoptosis of hypoxia/reoxygenation-treated myocardial cells by regulating m6A modification of Mhrt. Mol Cell Biochem. 2021 May;476(5):2171-2179. doi: 10.1007/s11010-021-04069-6. Epub 2021 Feb 6.
Ref 133 FTO Inhibition Enhances the Antitumor Effect of Temozolomide by Targeting MYC-miR-155/23a Cluster-MXI1 Feedback Circuit in Glioma. Cancer Res. 2020 Sep 15;80(18):3945-3958. doi: 10.1158/0008-5472.CAN-20-0132. Epub 2020 Jul 17.
Ref 134 Emerging oral drugs for multiple sclerosis. Expert Opin Emerg Drugs. 2008 Sep;13(3):465-77. doi: 10.1517/14728214.13.3.465.
Ref 135 SMAD3 and FTO are involved in miR-5581-3p-mediated inhibition of cell migration and proliferation in bladder cancer. Cell Death Discov. 2022 Apr 13;8(1):199. doi: 10.1038/s41420-022-01010-8.
Ref 136 Grapefruit juice-drug interactions: Grapefruit juice and its components inhibit P-glycoprotein (ABCB1) mediated transport of talinolol in Caco-2 cells. J Pharm Sci. 2007 Oct;96(10):2808-17. doi: 10.1002/jps.20975.
Ref 137 First-in-Human Pharmacokinetic and Pharmacodynamic Study of the Dual m-TORC 1/2 Inhibitor AZD2014. Clin Cancer Res. 2015 Aug 1;21(15):3412-9. doi: 10.1158/1078-0432.CCR-14-2422. Epub 2015 Mar 24.
Ref 138 m(6)A-mediated upregulation of AC008 promotes osteoarthritis progression through the miR-328-3p?AQP1/ANKH axis. Exp Mol Med. 2021 Nov;53(11):1723-1734. doi: 10.1038/s12276-021-00696-7. Epub 2021 Nov 4.
Ref 139 US patent application no. 6,274,627, Conjugates of dithiocarbamate disulfides with pharmacologically active agents and uses therefor.
Ref 140 CN patent application no. 1882326, Ppar agonists for the treatment of hcv infection.
Ref 141 Therapeutic targeting of the NRF2 and KEAP1 partnership in chronic diseases. Nat Rev Drug Discov. 2019 Apr;18(4):295-317. doi: 10.1038/s41573-018-0008-x.
Ref 142 Discovery of a novel ERK inhibitor with activity in models of acquired resistance to BRAF and MEK inhibitors. Cancer Discov. 2013 Jul;3(7):742-50. doi: 10.1158/2159-8290.CD-13-0070. Epub 2013 Apr 24.
Ref 143 Lysosomes as a therapeutic target. Nat Rev Drug Discov. 2019 Dec;18(12):923-948. doi: 10.1038/s41573-019-0036-1. Epub 2019 Sep 2.
Ref 144 A first-in-human Phase I study of DS-3078a, an oral TORC1/2 inhibitor, in patients with advanced solid tumors: Preliminary results, Mol Cancer Ther November,2013, 12, C173.
Ref 145 US patent application no. 7,098,192, Antisense oligonucleotide modulation of STAT3 expression.
Ref 146 ClinicalTrials.gov (NCT03267173) Evaluate the Safety and Efficacy of CAR-T in the Treatment of Pancreatic Cancer.
Ref 147 Teaming up to tackle RNAi delivery challenge. Nat Rev Drug Discov. 2009 Jul;8(7):525-6. doi: 10.1038/nrd2940.
Ref 148 Safety and Immunogenicity of LY3415244, a Bispecific Antibody Against TIM-3 and PD-L1, in Patients With Advanced Solid Tumors. Clin Cancer Res. 2021 May 15;27(10):2773-2781. doi: 10.1158/1078-0432.CCR-20-3716. Epub 2021 Jan 13.
Ref 149 Company report (Biooncology)
Ref 150 Association of genetic variation in cystathionine-beta-synthase and arsenic metabolism. Environ Res. 2010 Aug;110(6):580-7. doi: 10.1016/j.envres.2010.05.001. Epub 2010 Jun 1.
Ref 151 National Cancer Institute Drug Dictionary (drug id 756624).
Ref 152 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017210)
Ref 153 ABCC8 and ABCC9: ABC transporters that regulate K+ channels. Pflugers Arch. 2007 Feb;453(5):703-18. doi: 10.1007/s00424-006-0116-z. Epub 2006 Aug 8.
Ref 154 Active immunotherapy in HER2 overexpressing breast cancer: current status and future perspectives. Ann Oncol. 2013 Jul;24(7):1740-1748. doi: 10.1093/annonc/mdt133. Epub 2013 Apr 12.
Ref 155 Synthesis and structure-activity relationship studies of N-benzyl-2-phenylpyrimidin-4-amine derivatives as potent USP1/UAF1 deubiquitinase inhibitors with anticancer activity against nonsmall cell lung cancer. J Med Chem. 2014 Oct 9;57(19):8099-110. doi: 10.1021/jm5010495. Epub 2014 Sep 17.
Ref 156 Polyamines and the NMDA receptor: modifying intrinsic activities with aromatic substituents. Bioorg Med Chem Lett. 2006 Jun 1;16(11):2837-41. doi: 10.1016/j.bmcl.2006.03.015. Epub 2006 Mar 24.
Ref 157 A Global Map of Lipid-Binding Proteins and Their Ligandability in Cells. Cell. 2015 Jun 18;161(7):1668-80. doi: 10.1016/j.cell.2015.05.045.
Ref 158 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033173)
Ref 159 In vitro metabolism of rivoglitazone, a novel peroxisome proliferator-activated receptor Gamma agonist, in rat, monkey, and human liver microsomes and freshly isolated hepatocytes. Drug Metab Dispos. 2011 Jul;39(7):1311-9. doi: 10.1124/dmd.111.038729. Epub 2011 Apr 21.
Ref 160 Phase I dose escalation study of ASP8273, a mutant-selective irreversible EGFR inhibitor, in subjects with EGFR mutation positive NSCLC, Journal of Clinical Oncology, Vol 33, No 15_suppl (May 20 Supplement), 2015: 8083.
Ref 161 Pyrrolo[2,3-d]pyrimidines active as Btk inhibitors. Expert Opin Ther Pat. 2017 Dec;27(12):1305-1318. doi: 10.1080/13543776.2017.1355908. Epub 2017 Jul 20.
Ref 162 Evidence for a role of testosterone-androgen receptor interactions in mediating masculine sexual behavior in male rats. Endocrinology. 1989 Feb;124(2):618-26. doi: 10.1210/endo-124-2-618.
Ref 163 US patent application no. 6,277,636, Antisense inhibition of MADH6 expression.
Ref 164 Beneficial effect of a CXCR4 agonist in murine models of systemic inflammation. Inflammation. 2012 Feb;35(1):130-7. doi: 10.1007/s10753-011-9297-5.
Ref 165 Substrate affinity of photosensitizers derived from chlorophyll-a: the ABCG2 transporter affects the phototoxic response of side population stem cell-like cancer cells to photodynamic therapy. Mol Pharm. 2010 Oct 4;7(5):1789-804.
Ref 166 Pharmacogenomics of statins: understanding susceptibility to adverse effects. Pharmgenomics Pers Med. 2016 Oct 3;9:97-106. doi: 10.2147/PGPM.S86013. eCollection 2016.
Ref 167 Company report (FirstString Research)
Ref 168 Mechanisms of tetrandrine and 5-bromotetrandrine in reversing multidrug resistance may relate to down-regulation of multidrug resistance associated protein 7 expression. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2012 Jun;20(3):558-63.
Ref 169 Synthesis of (aryloxyacetylamino)-isonicotinic/nicotinic acid analogues as potent hypoxia-inducible factor (HIF)-1alpha inhibitors. Bioorg Med Chem Lett. 2007 Nov 15;17(22):6305-10. doi: 10.1016/j.bmcl.2007.09.005. Epub 2007 Sep 7.
Ref 170 Pharmacokinetics, Safety, and CCR2/CCR5 Antagonist Activity of Cenicriviroc in Participants With Mild or Moderate Hepatic Impairment. Clin Transl Sci. 2016 Jun;9(3):139-48. doi: 10.1111/cts.12397. Epub 2016 May 12.
Ref 171 Emerging drugs for obesity: linking novel biological mechanisms to pharmaceutical pipelines. Expert Opin Emerg Drugs. 2005 Aug;10(3):643-60. doi: 10.1517/14728214.10.3.643.
Ref 172 Identifying susceptibility genes for prostate cancer--a family-based association study of polymorphisms in CYP17, CYP19, CYP11A1, and LH-beta. Cancer Epidemiol Biomarkers Prev. 2005 Aug;14(8):2035-9. doi: 10.1158/1055-9965.EPI-05-0170.
Ref 173 GEMSTONE-301: a phase III clinical trial of CS1001 as consolidation therapy in patients with locally advanced/unresectable (stage III) non-small cell lung cancer (NSCLC) who did not have disease progression after prior concurrent/sequential chemoradiotherapy. Transl Lung Cancer Res. 2020 Oct;9(5):2008-2015. doi: 10.21037/tlcr-20-608.
Ref 174 P-glycoprotein (ABCB1) transports the primary active tamoxifen metabolites endoxifen and 4-hydroxytamoxifen and restricts their brain penetration. J Pharmacol Exp Ther. 2011 Jun;337(3):710-7.
Ref 175 WO patent application no. 2005,0443,02, Selective erbb2 inhibitor/anti-erbb antibody combinations in the treatment of cancer.
Ref 176 Antitumor activity of HM781-36B, a highly effective pan-HER inhibitor in erlotinib-resistant NSCLC and other EGFR-dependent cancer models. Int J Cancer. 2012 May 15;130(10):2445-54. doi: 10.1002/ijc.26276. Epub 2011 Aug 24.
Ref 177 US patent application no. 6,300,491, Oligonucleotide inhibition of cell adhesion.
Ref 178 Decrease of cyclin D1 in the human lung adenocarcinoma cell line A-427 by 7-hydroxycoumarin. Lung Cancer. 2001 Nov;34(2):185-94. doi: 10.1016/s0169-5002(01)00263-x.
Ref 179 Mammalian glucose permease GLUT1 facilitates transport of arsenic trioxide and methylarsonous acid. Biochem Biophys Res Commun. 2006 Dec 15;351(2):424-30. doi: 10.1016/j.bbrc.2006.10.054. Epub 2006 Oct 17.
Ref 180 NPS-1034, a novel MET inhibitor, inhibits the activated MET receptor and its constitutively active mutants. Invest New Drugs. 2014 Jun;32(3):389-99. doi: 10.1007/s10637-013-0039-4. Epub 2013 Oct 31.
Ref 181 Identification of enzymes responsible for primary and sequential oxygenation reactions of capravirine in human liver microsomes. Drug Metab Dispos. 2006 Nov;34(11):1798-802. doi: 10.1124/dmd.106.011189. Epub 2006 Aug 16.
Ref 182 US patent application no. 7,217,572, Modulation of HIF1.alpha. and HIF2.alpha. expression.
Ref 183 Examination of 209 drugs for inhibition of cytochrome P450 2C8. J Clin Pharmacol. 2005 Jan;45(1):68-78. doi: 10.1177/0091270004270642.
Ref 184 Design and synthesis of novel 3-(benzo[d]oxazol-2-yl)-5-(1-(piperidin-4-yl)-1H-pyrazol-4-yl)pyridin-2-amine derivatives as selective G-protein-coupled receptor kinase-2 and -5 inhibitors. Bioorg Med Chem Lett. 2013 Dec 15;23(24):6711-6. doi: 10.1016/j.bmcl.2013.10.036. Epub 2013 Oct 30.
Ref 185 US patent application no. 5,843,738, Oligonucleotide modulation of cell adhesion.
Ref 186 N(6)-methyladenosine mediates the cellular proliferation and apoptosis via microRNAs in arsenite-transformed cells. Toxicol Lett. 2018 Aug;292:1-11. doi: 10.1016/j.toxlet.2018.04.018. Epub 2018 Apr 20.
Ref 187 N(6) -Methyladenosine Negatively Regulates Human Respiratory Syncytial Virus Replication. Front Cell Dev Biol. 2021 Oct 4;9:739445. doi: 10.3389/fcell.2021.739445. eCollection 2021.
Ref 188 The Potential Role of N6-Methyladenosine (m6A) Demethylase Fat Mass and Obesity-Associated Gene (FTO) in Human Cancers. Onco Targets Ther. 2020 Dec 15;13:12845-12856. doi: 10.2147/OTT.S283417. eCollection 2020.
Ref 189 Roles of N6-Methyladenosine Demethylase FTO in Malignant Tumors Progression. Onco Targets Ther. 2021 Sep 16;14:4837-4846. doi: 10.2147/OTT.S329232. eCollection 2021.
Ref 190 Downregulation of the FTO m(6)A RNA demethylase promotes EMT-mediated progression of epithelial tumors and sensitivity to Wnt inhibitors. Nat Cancer. 2021 Jun;2(6):611-628. doi: 10.1038/s43018-021-00223-7. Epub 2021 Jun 23.
Ref 191 Saikosaponin D exhibits anti-leukemic activity by targeting FTO/m(6)A signaling. Theranostics. 2021 Mar 31;11(12):5831-5846. doi: 10.7150/thno.55574. eCollection 2021.
Ref 192 The Yin and Yang of RNA Methylation: An Imbalance of Erasers Enhances Sensitivity to FTO Demethylase Small-Molecule Targeting in Leukemia Stem Cells. Cancer Cell. 2019 Apr 15;35(4):540-541. doi: 10.1016/j.ccell.2019.03.011.
Ref 193 Small-Molecule Targeting of Oncogenic FTO Demethylase in Acute Myeloid Leukemia. Cancer Cell. 2019 Apr 15;35(4):677-691.e10. doi: 10.1016/j.ccell.2019.03.006.
Ref 194 A dynamic N(6)-methyladenosine methylome regulates intrinsic and acquired resistance to tyrosine kinase inhibitors. Cell Res. 2018 Nov;28(11):1062-1076. doi: 10.1038/s41422-018-0097-4. Epub 2018 Oct 8.
Ref 195 Integrated analysis of transcriptome-wide m(6)A methylome of osteosarcoma stem cells enriched by chemotherapy. Epigenomics. 2019 Nov 1;11(15):1693-1715. doi: 10.2217/epi-2019-0262. Epub 2019 Oct 25.
Ref 196 Expression of Demethylase Genes, FTO and ALKBH1, Is Associated with Prognosis of Gastric Cancer. Dig Dis Sci. 2019 Jun;64(6):1503-1513. doi: 10.1007/s10620-018-5452-2. Epub 2019 Jan 14.
Ref 197 Gene Polymorphisms of m6A Erasers FTO and ALKBH1 Associated with Susceptibility to Gastric Cancer. Pharmgenomics Pers Med. 2022 May 31;15:547-559. doi: 10.2147/PGPM.S360912. eCollection 2022.
Ref 198 To Develop and Validate the Combination of RNA Methylation Regulators for the Prognosis of Patients with Gastric Cancer. Onco Targets Ther. 2020 Oct 23;13:10785-10795. doi: 10.2147/OTT.S276239. eCollection 2020.
Ref 199 Berberine Suppresses Stemness and Tumorigenicity of Colorectal Cancer Stem-Like Cells by Inhibiting m(6)A Methylation. Front Oncol. 2021 Nov 15;11:775418. doi: 10.3389/fonc.2021.775418. eCollection 2021.
Ref 200 SIRT1 Regulates N(6) -Methyladenosine RNA Modification in Hepatocarcinogenesis by Inducing RANBP2-Dependent FTO SUMOylation. Hepatology. 2020 Dec;72(6):2029-2050. doi: 10.1002/hep.31222. Epub 2020 Oct 22.
Ref 201 Fat mass and obesity-associated protein promotes the tumorigenesis and development of liver cancer. Oncol Lett. 2020 Aug;20(2):1409-1417. doi: 10.3892/ol.2020.11673. Epub 2020 May 25.
Ref 202 FTO Facilitates Lung Adenocarcinoma Cell Progression by Activating Cell Migration Through mRNA Demethylation. Onco Targets Ther. 2020 Feb 18;13:1461-1470. doi: 10.2147/OTT.S231914. eCollection 2020.
Ref 203 FTO-Dependent N (6)-Methyladenosine Modifications Inhibit Ovarian Cancer Stem Cell Self-Renewal by Blocking cAMP Signaling. Cancer Res. 2020 Aug 15;80(16):3200-3214. doi: 10.1158/0008-5472.CAN-19-4044. Epub 2020 Jun 30.
Ref 204 RNA m6A Methylation Regulators Multi-Omics Analysis in Prostate Cancer. Front Genet. 2021 Nov 26;12:768041. doi: 10.3389/fgene.2021.768041. eCollection 2021.
Ref 205 The FTO m(6)A demethylase inhibits the invasion and migration of prostate cancer cells by regulating total m(6)A levels. Life Sci. 2021 Apr 15;271:119180. doi: 10.1016/j.lfs.2021.119180. Epub 2021 Feb 8.
Ref 206 The N(6) -methyladenosine (m(6) A) erasers alkylation repair homologue 5 (ALKBH5) and fat mass and obesity-associated protein (FTO) are prognostic biomarkers in patients with clear cell renal carcinoma. BJU Int. 2020 Apr;125(4):617-624. doi: 10.1111/bju.15019. Epub 2020 Feb 17.
Ref 207 MiR-155 regulates m(6)A level and cell progression by targeting FTO in clear cell renal cell carcinoma. Cell Signal. 2022 Mar;91:110217. doi: 10.1016/j.cellsig.2021.110217. Epub 2021 Dec 16.
Ref 208 Interplay between RNA Methylation Eraser FTO and Writer METTL3 in Renal Clear Cell Carcinoma Patient Survival. Recent Pat Anticancer Drug Discov. 2021;16(3):363-376. doi: 10.2174/1574892816666210204125155.
Ref 209 Decreased N(6)-methyladenosine in peripheral blood RNA from diabetic patients is associated with FTO expression rather than ALKBH5. J Clin Endocrinol Metab. 2015 Jan;100(1):E148-54. doi: 10.1210/jc.2014-1893.
Ref 210 FTO is a transcriptional repressor to auto-regulate its own gene and potentially associated with homeostasis of body weight. J Mol Cell Biol. 2019 Feb 1;11(2):118-132. doi: 10.1093/jmcb/mjy028.
Ref 211 AMPK regulates lipid accumulation in skeletal muscle cells through FTO-dependent demethylation of N(6)-methyladenosine. Sci Rep. 2017 Feb 8;7:41606. doi: 10.1038/srep41606.
Ref 212 Small-Molecule Inhibitors of the RNA M6A Demethylases FTO Potently Support the Survival of Dopamine Neurons. Int J Mol Sci. 2021 Apr 26;22(9):4537. doi: 10.3390/ijms22094537.
Ref 213 Abnormality of m6A mRNA Methylation Is Involved in Alzheimer's Disease. Front Neurosci. 2020 Feb 28;14:98. doi: 10.3389/fnins.2020.00098. eCollection 2020.
Ref 214 Streptozotocin-Induced Astrocyte Mitochondrial Dysfunction Is Ameliorated by FTO Inhibitor MO-I-500. ACS Chem Neurosci. 2021 Oct 20;12(20):3818-3828. doi: 10.1021/acschemneuro.1c00063. Epub 2021 Sep 7.
Ref 215 Estradiol induces export of sphingosine 1-phosphate from breast cancer cells via ABCC1 and ABCG2. J Biol Chem. 2010 Apr 2;285(14):10477-86. doi: 10.1074/jbc.M109.064162. Epub 2010 Jan 28.
Ref 216 m6A Demethylase FTO Regulates Dopaminergic Neurotransmission Deficits Caused by Arsenite. Toxicol Sci. 2018 Oct 1;165(2):431-446. doi: 10.1093/toxsci/kfy172.
Ref 217 FTO regulates ocular angiogenesis via m(6)A-YTHDF2-dependent mechanism. Exp Eye Res. 2020 Aug;197:108107. doi: 10.1016/j.exer.2020.108107. Epub 2020 Jun 9.
Ref 218 Meclofenamic Acid Reduces Reactive Oxygen Species Accumulation and Apoptosis, Inhibits Excessive Autophagy, and Protects Hair Cell-Like HEI-OC1 Cells From Cisplatin-Induced Damage. Front Cell Neurosci. 2018 May 23;12:139. doi: 10.3389/fncel.2018.00139. eCollection 2018.
Ref 219 The effect of intravenous interferon-beta-1a (FP-1201) on lung CD73 expression and on acute respiratory distress syndrome mortality: an open-label study. Lancet Respir Med. 2014 Feb;2(2):98-107. doi: 10.1016/S2213-2600(13)70259-5. Epub 2013 Dec 23.
Ref 220 Changes in N6-Methyladenosine Modification Modulate Diabetic Cardiomyopathy by Reducing Myocardial Fibrosis and Myocyte Hypertrophy. Front Cell Dev Biol. 2021 Jul 21;9:702579. doi: 10.3389/fcell.2021.702579. eCollection 2021.
Ref 221 FTO-Dependent N(6)-Methyladenosine Regulates Cardiac Function During Remodeling and Repair. Circulation. 2019 Jan 22;139(4):518-532. doi: 10.1161/CIRCULATIONAHA.118.033794.
Ref 222 Increased m6A methylation level is associated with the progression of human abdominal aortic aneurysm. Ann Transl Med. 2019 Dec;7(24):797. doi: 10.21037/atm.2019.12.65.
Ref 223 Alteration of N(6)-Methyladenosine mRNA Methylation in a Human Stem Cell-Derived Cardiomyocyte Model of Tyrosine Kinase Inhibitor-Induced Cardiotoxicity. Front Cardiovasc Med. 2022 Mar 23;9:849175. doi: 10.3389/fcvm.2022.849175. eCollection 2022.
Ref 224 FTO-dependent function of N6-methyladenosine is involved in the hepatoprotective effects of betaine on adolescent mice. J Physiol Biochem. 2015 Sep;71(3):405-13. doi: 10.1007/s13105-015-0420-1. Epub 2015 Jun 16.
Ref 225 Resveratrol Attenuates High-Fat Diet Induced Hepatic Lipid Homeostasis Disorder and Decreases m(6)A RNA Methylation. Front Pharmacol. 2020 Dec 18;11:568006. doi: 10.3389/fphar.2020.568006. eCollection 2020.
Ref 226 Increased N6-methyladenosine causes infertility is associated with FTO expression. J Cell Physiol. 2018 Sep;233(9):7055-7066. doi: 10.1002/jcp.26507. Epub 2018 Mar 25.
Ref 227 Cyclophosphamide Regulates N6-Methyladenosine and m6A RNA Enzyme Levels in Human Granulosa Cells and in Ovaries of a Premature Ovarian Aging Mouse Model. Front Endocrinol (Lausanne). 2019 Jun 27;10:415. doi: 10.3389/fendo.2019.00415. eCollection 2019.
Ref 228 Regulation of autophagy in leukocytes through RNA N(6)-adenosine methylation in chronic kidney disease patients. Biochem Biophys Res Commun. 2020 Jul 5;527(4):953-959. doi: 10.1016/j.bbrc.2020.04.138. Epub 2020 May 18.
Ref 229 Increased m6A modification of RNA methylation related to the inhibition of demethylase FTO contributes to MEHP-induced Leydig cell injury. Environ Pollut. 2021 Jan 1;268(Pt A):115627. doi: 10.1016/j.envpol.2020.115627. Epub 2020 Sep 24.
Ref 230 Use of 2-(substituted phenylamino)benzoic acid fto inhibitor in treating leukemia. WO-2018157842-A1
Ref 231 FTO Inhibitors. US-20180118665-A1.