m6A Regulator Information

General Information of the m6A Regulator (ID: REG00012)

Regulator Name	Insulin-like growth factor 2 mRNA-binding protein 1 (IGF2BP1)
Synonyms	IGF2 mRNA-binding protein 1; IMP-1; IMP1; Coding region determinant-binding protein; CRD-BP; IGF-II mRNA-binding protein 1; VICKZ family member 1; Zipcode-binding protein 1; ZBP-1; CRDBP; VICKZ1; ZBP1 Click to Show/Hide
Gene Name	IGF2BP1
Sequence	MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGK VELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETA VVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQG SPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAA EKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLK KVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMSL QSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAI IGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEAQFKAQGRIYGKLKEENFF GPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKII GHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK Click to Show/Hide
Family	RRM IMP/VICKZ family
Function	RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). This transcript 'caging' into mRNPs allows mRNA transport and transient storage. It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation. Plays a direct role in the transport and translation of transcripts required for axonal regeneration in adult sensory neurons (By similarity). Regulates localized beta-actin/ACTB mRNA translation, a crucial process for cell polarity, cell migration and neurite outgrowth. Co-transcriptionally associates with the ACTB mRNA in the nucleus. This binding involves a conserved 54-nucleotide element in the ACTB mRNA 3'-UTR, known as the 'zipcode'. The RNP thus formed is exported to the cytoplasm, binds to a motor protein and is transported along the cytoskeleton to the cell periphery. During transport, prevents ACTB mRNA from being translated into protein. When the RNP complex reaches its destination near the plasma membrane, IGF2BP1 is phosphorylated. This releases the mRNA, allowing ribosomal 40S and 60S subunits to assemble and initiate ACTB protein synthesis. Monomeric ACTB then assembles into the subcortical actin cytoskeleton (By similarity). During neuronal development, key regulator of neurite outgrowth, growth cone guidance and neuronal cell migration, presumably through the spatiotemporal fine tuning of protein synthesis, such as that of ACTB (By similarity). May regulate mRNA transport to activated synapses (By similarity). Binds to and stabilizes ABCB1/MDR-1 mRNA (By similarity). During interstinal wound repair, interacts with and stabilizes PTGS2 transcript. PTGS2 mRNA stabilization may be crucial for colonic mucosal wound healing (By similarity). Binds to the 3'-UTR of IGF2 mRNA by a mechanism of cooperative and sequential dimerization and regulates IGF2 mRNA subcellular localization and translation. Binds to MYC mRNA, in the coding region instability determinant (CRD) of the open reading frame (ORF), hence prevents MYC cleavage by endonucleases and possibly microRNA targeting to MYC-CRD. Binds to the 3'-UTR of CD44 mRNA and stabilizes it, hence promotes cell adhesion and invadopodia formation in cancer cells. Binds to the oncofetal H19 transcript and to the neuron-specific TAU mRNA and regulates their localizations. Binds to and stabilizes BTRC/FBW1A mRNA. Binds to the adenine-rich autoregulatory sequence (ARS) located in PABPC1 mRNA and represses its translation. PABPC1 mRNA-binding is stimulated by PABPC1 protein. Prevents BTRC/FBW1A mRNA degradation by disrupting microRNA-dependent interaction with AGO2. Promotes the directed movement of tumor-derived cells by fine-tuning intracellular signaling networks. Binds to MAPK4 3'-UTR and inhibits its translation. Interacts with PTEN transcript open reading frame (ORF) and prevents mRNA decay. This combined action on MAPK4 (down-regulation) and PTEN (up-regulation) antagonizes HSPB1 phosphorylation, consequently it prevents G-actin sequestration by phosphorylated HSPB1, allowing F-actin polymerization. Hence enhances the velocity of cell migration and stimulates directed cell migration by PTEN-modulated polarization. Interacts with Hepatitis C virus (HCV) 5'-UTR and 3'-UTR and specifically enhances translation at the HCV IRES, but not 5'-cap-dependent translation, possibly by recruiting eIF3. Interacts with HIV-1 GAG protein and blocks the formation of infectious HIV-1 particles. Reduces HIV-1 assembly by inhibiting viral RNA packaging, as well as assembly and processing of GAG protein on cellular membranes. During cellular stress, such as oxidative stress or heat shock, stabilizes target mRNAs that are recruited to stress granules, including CD44, IGF2, MAPK4, MYC, PTEN, RAPGEF2 and RPS6KA5 transcripts. Click to Show/Hide
Gene ID	10642
Uniprot ID	IF2B1_HUMAN
Regulator Type	WRITER ERASER READER
Mechanism Diagram	Click to View the Original Diagram

Target Genes	Click to View Potential Target Genes of This Regulator

Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)

IGF2BP1 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.

Browse Target Gene related Disease

Browse Target Gene related Drug

Aldehyde dehydrogenase 1A1 (ALDH1A1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	A549 cell line	Homo sapiens
Treatment: IGF2BP1 knockout A549 cells Control: Wild type A549 cells		GSE146546
Regulation		logFC: -7.78E-01 p-value: 8.37E-08
More Results	Click to View More RNA-seq Results

Acute myeloid leukaemia [ICD-11: 2A60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[1]
Responsed Disease	Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation	Up regulation
In-vitro Model	MOLT-16	T acute lymphoblastic leukemia	Homo sapiens	CVCL_1424
	Reh	B acute lymphoblastic leukemia	Homo sapiens	CVCL_1650
	SKNO-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_2196
	Tanoue	B acute lymphoblastic leukemia	Homo sapiens	CVCL_1852
In-vivo Model	For the engraftment experiments, 1×10³ 1×10⁶ cells were injected into tail veins of non-irradiated 6-10 week-old female mice in 100 uL of DPBS per mouse. No blinding or randomization was applied to mice experiments. Routinely, each in vivo experiment was performed with three technical replicates (three mice per group) and independently repeated two to three times for each cell line.
Response Summary	IGF2BP1 decreases leukemia cells' tumorigenicity, promotes myeloid differentiation, increases leukemia cell death, and sensitizes acute myeloid leukemia cells to chemotherapeutic drugs. IGF2BP1 affects proliferation and tumorigenic potential of leukemia cells through critical regulators of self-renewal HOXB4 and MYB and through regulation of expression of the aldehyde dehydrogenase, Aldehyde dehydrogenase 1A1 (ALDH1A1).

Apoptosis regulator Bcl-2 (BCL2)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	ES-2 cell line	Homo sapiens
Treatment: siIGF2BP1 ES-2 cells Control: siControl ES-2 cells		GSE109604
Regulation		logFC: -7.97E-01 p-value: 9.99E-03
More Results	Click to View More RNA-seq Results

Malignant haematopoietic neoplasm [ICD-11: 2B33]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[2]
Responsed Disease	Myeloid leukaemia [ICD-11: 2B33.1]
Target Regulation	Up regulation
Cell Process	Cell apoptosis
In-vitro Model	Leukemia stem cell line (Leukemia stem cell line)
	Kasumi-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_0589
	MOLM-13	Adult acute myeloid leukemia	Homo sapiens	CVCL_2119
	THP-1	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0006
	MV4-11	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0064
	BV-173	Chronic myelogenous leukemia	Homo sapiens	CVCL_0181
	NOMO-1	Adult acute monocytic leukemia	Homo sapiens	CVCL_1609
	K-562	Chronic myelogenous leukemia	Homo sapiens	CVCL_0004
	KG-1a	Adult acute myeloid leukemia	Homo sapiens	CVCL_1824
Response Summary	YBX1 selectively functions in regulating survival of myeloid leukemia cells. YBX1 interacts with insulin-like growth factor 2 messenger RNA (mRNA)-binding proteins (IGF2BPs) and stabilizes m6A-tagged RNA. YBX1 deficiency dysregulates the expression of apoptosis-related genes and promotes mRNA decay of MYC and Apoptosis regulator Bcl-2 (BCL2) in an m6A-dependent manner, which contributes to the defective survival that results from deletion of YBX1.

Cyclin-dependent kinase 4 (CDK4)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	PANC-1 cell line	Homo sapiens
Treatment: siIGF2BP1 PANC-1 cells Control: siControl PANC-1 cells		GSE161087
Regulation		logFC: -1.19E+00 p-value: 3.49E-04
More Results	Click to View More RNA-seq Results

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Cell Process	Cell apoptosis
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	NCI-H520	Lung squamous cell carcinoma	Homo sapiens	CVCL_1566
	HBE (Human bronchial epithelial cell line)
	LTEP-a2	Endocervical adenocarcinoma	Homo sapiens	CVCL_6929
	SK-MES-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_0630
Response Summary	GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, CCND1, Cyclin-dependent kinase 4 (CDK4), EGR2, YBX1, and TLX, which were associated with lung cancers.

Cystine/glutamate transporter (SLC7A11)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	MV3 cell line	Homo sapiens
Treatment: siIGF2BP1 MV3 cells Control: siControl MV3 cells		GSE146803
Regulation		logFC: -1.30E+00 p-value: 3.62E-06
More Results	Click to View More RNA-seq Results

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[4]
Responsed Disease	Hepatoblastoma [ICD-11: 2C12.01]
Target Regulation	Up regulation
Pathway Response	Ferroptosis			hsa04216
Cell Process	Ferroptosis
In-vitro Model	HuH-6	Hepatoblastoma	Homo sapiens	CVCL_4381
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
Response Summary	METTL3-mediated Cystine/glutamate transporter (SLC7A11) m6A modification enhances hepatoblastoma ferroptosis resistance. The METTL3/IGF2BP1/m6A modification promotes SLC7A11 mRNA stability and upregulates its expression by inhibiting the deadenylation process.

Unspecific body region injury [ICD-11: ND56]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[22]
Responsed Disease	Peripheral nerve injury [ICD-11: ND56.4]
Target Regulation	Up regulation

Fascin (FSCN1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	HepG2 cell line	Homo sapiens
Treatment: siIGF2BP1 HepG2 cells Control: siControl HepG2 cells		GSE161086
Regulation		logFC: 9.48E-01 p-value: 8.70E-06
More Results	Click to View More RNA-seq Results

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Cell Process	RNA decay
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
Response Summary	In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, Fascin (FSCN1), TK1, and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.

Cervical cancer [ICD-11: 2C77]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Cervical cancer [ICD-11: 2C77]
Cell Process	RNA decay
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
Response Summary	In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, Fascin (FSCN1), TK1, and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.

Histone-lysine N-methyltransferase EZH2 (EZH2)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	PANC-1 cell line	Homo sapiens
Treatment: siIGF2BP1 PANC-1 cells Control: siControl PANC-1 cells		GSE161087
Regulation		logFC: -1.26E+00 p-value: 4.20E-03
More Results	Click to View More RNA-seq Results

Neuroendocrine neoplasms [ICD-11: 2D4Y]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[6]
Responsed Disease	Neuroendocrine neoplasms [ICD-11: 2D4Y]
Target Regulation	Up regulation
Pathway Response	Cell cycle			hsa04110
Cell Process	Increase in G1 and sub-G1 phases
In-vitro Model	NCI-H727	Lung carcinoid tumor	Homo sapiens	CVCL_1584
In-vitro Model	COLO 320DM	Colon adenocarcinoma	Homo sapiens	CVCL_0219
In-vivo Model	RIP1-Tag2 mice were purchased from NCI Mouse Repository (Bethesda, Rockville, MD, USA) and maintained in a C57BL/6N background.
Response Summary	This data identify IGF2BP1 as an important driver of tumor progression in NEN, and indicate that disruption of the IGF2BP1-Myc-Histone-lysine N-methyltransferase EZH2 (EZH2) axis represents a promising approach for targeted therapy of neuroendocrine neoplasms.

Homeobox protein Hox-B4 (HOXB4)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	PANC-1 cell line	Homo sapiens
Treatment: siIGF2BP1 PANC-1 cells Control: siControl PANC-1 cells		GSE161087
Regulation		logFC: -9.62E-01 p-value: 3.85E-02
More Results	Click to View More RNA-seq Results

Acute myeloid leukaemia [ICD-11: 2A60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[1]
Responsed Disease	Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation	Up regulation
In-vitro Model	MOLT-16	T acute lymphoblastic leukemia	Homo sapiens	CVCL_1424
	Reh	B acute lymphoblastic leukemia	Homo sapiens	CVCL_1650
	SKNO-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_2196
	Tanoue	B acute lymphoblastic leukemia	Homo sapiens	CVCL_1852
In-vivo Model	For the engraftment experiments, 1×10³ 1×10⁶ cells were injected into tail veins of non-irradiated 6-10 week-old female mice in 100 uL of DPBS per mouse. No blinding or randomization was applied to mice experiments. Routinely, each in vivo experiment was performed with three technical replicates (three mice per group) and independently repeated two to three times for each cell line.
Response Summary	IGF2BP1 decreases leukemia cells' tumorigenicity, promotes myeloid differentiation, increases leukemia cell death, and sensitizes acute myeloid leukemia cells to chemotherapeutic drugs. IGF2BP1 affects proliferation and tumorigenic potential of leukemia cells through critical regulators of self-renewal Homeobox protein Hox-B4 (HOXB4) and MYB and through regulation of expression of the aldehyde dehydrogenase, ALDH1A1.

Interleukin enhancer-binding factor 3 (ILF3)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	PANC-1 cell line	Homo sapiens
Treatment: siIGF2BP1 PANC-1 cells Control: siControl PANC-1 cells		GSE161087
Regulation		logFC: -9.14E-01 p-value: 4.02E-03
More Results	Click to View More RNA-seq Results

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[7]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Up regulation
In-vitro Model	Huh-7	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0336
	Hep 3B2.1-7	Childhood hepatocellular carcinoma	Homo sapiens	CVCL_0326
	HEK293T	Normal	Homo sapiens	CVCL_0063
In-vivo Model	Approximately 5 × 10⁶ control and ILF3-AS1 silencing Huh7 cells were subcutaneously implanted into the right flank of nude mice.Xenograft size was measured every 7 days and calculated using the equation V(mm³)=(length×width2)/2. 35 days later, the mice were sacrificed, and the tumor tissues were isolated and weighed.
Response Summary	ILF3-AS1 expression was significantly elevated in HCC tissues,mechanistically, ILF3-AS1 associated with Interleukin enhancer-binding factor 3 (ILF3) mRNA and inhibited its degradation. ILF3-AS1 increased ILF3 m6A level via recruiting N6-methyladenosine (m6A) RNA methyltransferase METTL3. Moreover, IFL3-AS1 enhanced the interaction between ILF3 mRNA and m6A reader IGF2BP1.

Leukocyte surface antigen CD47 (CD47)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	PANC-1 cell line	Homo sapiens
Treatment: siIGF2BP1 PANC-1 cells Control: siControl PANC-1 cells		GSE161087
Regulation		logFC: -8.42E-01 p-value: 5.16E-03
More Results	Click to View More RNA-seq Results

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[8]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Up regulation
Cell Process	Epithelial-mesenchymal transition
In-vitro Model	Huh-7	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0336
In-vitro Model	HCCLM3	Adult hepatocellular carcinoma	Homo sapiens	CVCL_6832
Response Summary	METTL3/IGF2BP1/Leukocyte surface antigen CD47 (CD47) mediated EMT transition contributes to the incomplete ablation induced metastasis in HCC cells.

MARCKS-related protein (MARCKSL1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	A549 cell line	Homo sapiens
Treatment: IGF2BP1 knockout A549 cells Control: Wild type A549 cells		GSE146546
Regulation		logFC: -9.80E-01 p-value: 8.88E-07
More Results	Click to View More RNA-seq Results

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Cell Process	RNA decay
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
Response Summary	In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, FSCN1, TK1, and MARCKS-related protein (MARCKSL1), exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.

Cervical cancer [ICD-11: 2C77]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Cervical cancer [ICD-11: 2C77]
Cell Process	RNA decay
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
Response Summary	In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, FSCN1, TK1, and MARCKS-related protein (MARCKSL1), exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.

Myc proto-oncogene protein (MYC)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	HepG2 cell line	Homo sapiens
Treatment: siIGF2BP1 HepG2 cells Control: siControl HepG2 cells		GSE161086
Regulation		logFC: -9.94E-01 p-value: 1.72E-04
More Results	Click to View More RNA-seq Results

Malignant haematopoietic neoplasm [ICD-11: 2B33]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[2]
Responsed Disease	Myeloid leukaemia [ICD-11: 2B33.1]
Target Regulation	Up regulation
Cell Process	Cell apoptosis
In-vitro Model	Leukemia stem cell line (Leukemia stem cell line)
	Kasumi-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_0589
	MOLM-13	Adult acute myeloid leukemia	Homo sapiens	CVCL_2119
	THP-1	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0006
	MV4-11	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0064
	BV-173	Chronic myelogenous leukemia	Homo sapiens	CVCL_0181
	NOMO-1	Adult acute monocytic leukemia	Homo sapiens	CVCL_1609
	K-562	Chronic myelogenous leukemia	Homo sapiens	CVCL_0004
	KG-1a	Adult acute myeloid leukemia	Homo sapiens	CVCL_1824
Response Summary	YBX1 selectively functions in regulating survival of myeloid leukemia cells. YBX1 interacts with insulin-like growth factor 2 messenger RNA (mRNA)-binding proteins (IGF2BPs) and stabilizes m6A-tagged RNA. YBX1 deficiency dysregulates the expression of apoptosis-related genes and promotes mRNA decay of Myc proto-oncogene protein (MYC) and BCL2 in an m6A-dependent manner, which contributes to the defective survival that results from deletion of YBX1.

Gastric cancer [ICD-11: 2B72]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[9]
Responsed Disease	Gastric cancer [ICD-11: 2B72]
Target Regulation	Up regulation
Pathway Response	Central carbon metabolism in cancer			hsa05230
Pathway Response	Glycolysis / Gluconeogenesis			hsa00010
Cell Process	Aerobic glycolysis
In-vitro Model	SNU-216	Gastric tubular adenocarcinoma	Homo sapiens	CVCL_3946
	MKN45	Gastric adenocarcinoma	Homo sapiens	CVCL_0434
	HGC-27	Gastric carcinoma	Homo sapiens	CVCL_1279
	GES-1	Normal	Homo sapiens	CVCL_EQ22
	AGS	Gastric adenocarcinoma	Homo sapiens	CVCL_0139
In-vivo Model	A total of 5 × 10⁶ transfected MKN-45 cells, stably transfected with sh-IGF2BP1 vector or empty vector were subcutaneously injected into the flank of the mice. Tumor growth was measured every three days, and calculated using the following equation = a × b2/2 (a for longitudinal diameter; and b for latitudinal diameter). Three weeks after injection, mice were sacrificed.
Response Summary	IGF2BP1 upregulated in GC tissue and acted as a predictor of poor prognosis for GC patients. IGF2BP1 directly interacted with Myc proto-oncogene protein (MYC) mRNA via m6A-dependent manner to by stabilize its stability.

Liver cancer [ICD-11: 2C12]

In total 2 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Cell Process	RNA decay
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
Response Summary	In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including Myc proto-oncogene protein (MYC), FSCN1, TK1, and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene				[33]
Responsed Disease	Intrahepatic cholangiocarcinoma [ICD-11: 2C12.10]
Responsed Drug	BTYNB		Investigative	Drug Info

Breast cancer [ICD-11: 2C60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[10]
Responsed Disease	Breast cancer [ICD-11: 2C60]
Target Regulation	Up regulation
Pathway Response	Signaling pathways regulating pluripotency of stem cells			hsa04550
In-vitro Model	BT-474	Invasive breast carcinoma	Homo sapiens	CVCL_0179
	BT-549	Invasive breast carcinoma	Homo sapiens	CVCL_1092
	HEK293T	Normal	Homo sapiens	CVCL_0063
	Hs 578T	Invasive breast carcinoma	Homo sapiens	CVCL_0332
	MCF-7	Invasive breast carcinoma	Homo sapiens	CVCL_0031
	MDA-MB-231	Breast adenocarcinoma	Homo sapiens	CVCL_0062
	MDA-MB-453	Breast adenocarcinoma	Homo sapiens	CVCL_0418
	MDA-MB-468	Breast adenocarcinoma	Homo sapiens	CVCL_0419
	T-47D	Invasive breast carcinoma	Homo sapiens	CVCL_0553
In-vivo Model	The enriched mammosphere cells derived from engineered BT549 and Hs578T with silenced lncRNA KB-1980E6.3 (shKB/vector), BT549, and Hs578T with lncRNA KB-1980E6.3 knockdown combined with ectopic c-Myc (shKB/c-Myc), BT549, and Hs578T with silenced IGF2BP1 (shIGF2BP1/vector), BT549, and Hs578T with knocked down IGF2BP1 combined with ectopic c-Myc (shIGF2BP1/c-Myc), and BT549, and Hs578T/shNC/vector control cells were used in Xenograft experiments. Three doses (1 × 10⁵, 1 × 10⁴ and 1 × 10³) of spheres derived from the engineered Hs578T and 1 × 10⁵ of spheres derived from the engineered BT549 were subcutaneously inoculated into 4- to 6-week-old female nude mice (n = 5 per group). Mice were then treated with either bevacizumab (10 mg/kg every 3 days) to form a hypoxic tumor microenvironment or vehicle PBS to form a non-hypoxic condition.
Response Summary	Hypoxia-induced lncRNA KB-1980E6.3 is involved in the self-renewal and stemness maintenance of breast cancer stem cells by recruiting IGF2BP1 to regulate Myc proto-oncogene protein (MYC) mRNA stability.

Cervical cancer [ICD-11: 2C77]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Cervical cancer [ICD-11: 2C77]
Cell Process	RNA decay
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
Response Summary	In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including Myc proto-oncogene protein (MYC), FSCN1, TK1, and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.

Acute myeloid leukaemia [ICD-11: 2A60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[29]
Responsed Disease	Acute myeloid leukaemia [ICD-11: 2A60]
Responsed Drug	Cytarabine		Approved	Drug Info
Target Regulation	Up regulation
In-vitro Model	THP-1	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0006
In-vitro Model	Kasumi-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_0589

Pancreatic cancer [ICD-11: 2C10]

In total 2 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[31]
Responsed Disease	Pancreatic cancer [ICD-11: 2C10]
Responsed Drug	Gemcitabine		Approved	Drug Info
Target Regulation	Up regulation
In-vitro Model	PANC-1	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0480
In-vitro Model	CFPAC-1	Cystic fibrosis	Homo sapiens	CVCL_1119
In-vivo Model	To evaluate the effect of gemcitabine on the tumor formation ability and gemcitabine/WTAP/MYC axis in vivo, we injected 2×10⁶ PANC1 cells at logarithmic growth phase into the axilla of 4-week-old nude mice for subcutaneous tumor formation. The mice were randomly divided into phosphate buffered saline (PBS) group and gemcitabine treatment group. PBS or gemcitabine was injected into the mice via the abdominal cavity at a concentration of 50 mg/kg once every 5 days. The tumor dimension was measured every 5 days. After 30 days, the tumors were excised and weighed to compare the tumor size and volume, WTAP and MYC mRNA and protein expression was detected by real-time quantitative reverse transcription polymerase chain reaction (qRT-PCR) and immunofluorescence.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene				[32]
Responsed Disease	Pancreatic cancer [ICD-11: 2C10]
Target Regulation	Up regulation
In-vitro Model	MCF-10A	Normal	Homo sapiens	CVCL_0598
In-vitro Model	MCF-7	Invasive breast carcinoma	Homo sapiens	CVCL_0031
In-vivo Model	Cell suspensions (2 × 10⁶ cells/mL) made with MCF-7/ADR cells stably expressing METTL3 and/or miR-221-3p inhibitor were subcutaneously implanted into each mouse. One week later, xenografted mice were injected with 0.1 mL ADR (25 mg/kg, intraperitoneal injection) twice a week.

Polycomb complex protein BMI-1 (BMI1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	PANC-1 cell line	Homo sapiens
Treatment: siIGF2BP1 PANC-1 cells Control: siControl PANC-1 cells		GSE161087
Regulation		logFC: -6.85E-01 p-value: 1.16E-03
More Results	Click to View More RNA-seq Results

Head and neck squamous carcinoma [ICD-11: 2B6E]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[11]
Responsed Disease	Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Target Regulation	Up regulation
In-vitro Model	UM1	Tongue squamous cell carcinoma	Homo sapiens	CVCL_VH00
	SCC-9	Tongue squamous cell carcinoma	Homo sapiens	CVCL_1685
	SCC-25	Tongue squamous cell carcinoma	Homo sapiens	CVCL_1682
	SCC-15	Tongue squamous cell carcinoma	Homo sapiens	CVCL_1681
	HSC-3	Tongue squamous cell carcinoma	Homo sapiens	CVCL_1288
	HOK	Normal	Hexagrammos otakii	CVCL_YE19
In-vivo Model	To construct the subcutaneous tumorigenesis model, the cells were suspended in 100 uL of PBS and Matrigel matrix (BD Biosciences, USA) (1:1) and injected into the right flanks of 6-week-old female BALB/c nude mice.To construct the lymph node metastasis model, we injected 1 × 10⁵/50 uL stably infected SCC9 cells into the left hind footpads of BALB/c mice.
Response Summary	METTL3 promotes Polycomb complex protein BMI-1 (BMI1) translation in OSCC under the cooperation with m6A reader IGF2BP1. And the study revealed that METTL3 promotes OSCC proliferation and metastasis through BMI1 m6A methylation.

Pre-mRNA-splicing regulator WTAP (WTAP)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	HepG2 cell line	Homo sapiens
Treatment: siIGF2BP1 HepG2 cells Control: siControl HepG2 cells		GSE161086
Regulation		logFC: -7.39E-01 p-value: 8.18E-05
More Results	Click to View More RNA-seq Results

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Cell Process	Cell apoptosis
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	NCI-H520	Lung squamous cell carcinoma	Homo sapiens	CVCL_1566
	HBE (Human bronchial epithelial cell line)
	LTEP-a2	Endocervical adenocarcinoma	Homo sapiens	CVCL_6929
	SK-MES-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_0630
Response Summary	GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, Pre-mRNA-splicing regulator WTAP (WTAP), CCND1, CDK4, EGR2, YBX1, and TLX, which were associated with lung cancers.

Retrotransposon-derived protein PEG10 (PEG10)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	ES-2 cell line	Homo sapiens
Treatment: siIGF2BP1 ES-2 cells Control: siControl ES-2 cells		GSE161087
Regulation		logFC: 1.77E+00 p-value: 9.40E-06
More Results	Click to View More RNA-seq Results

Endometrial cancer [ICD-11: 2C76]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[12]
Responsed Disease	Endometrial cancer [ICD-11: 2C76]
Target Regulation	Up regulation
In-vitro Model	RL95-2	Endometrial adenosquamous carcinoma	Homo sapiens	CVCL_0505
	KLE	Endometrial adenocarcinoma	Homo sapiens	CVCL_1329
	Ishikawa	Endometrial adenocarcinoma	Homo sapiens	CVCL_2529
	HEC-1-B	Endometrial adenocarcinoma	Homo sapiens	CVCL_0294
	HEC-1-A	Endometrial adenocarcinoma	Homo sapiens	CVCL_0293
	AN3-CA	Endometrial adenocarcinoma	Homo sapiens	CVCL_0028
In-vivo Model	Six-week-old, female SCID-Berge mice were purchased from Vitalriver. EC cells with IGF2BP1 overexpression or silencing or the appropriate controls (1×10⁶) were injected into lower abdominal cavity of each mouse (n = 5 mice/group).
Response Summary	IGF2BP1 expression increased in EC, and high expression of this protein correlated with poor prognosis. IGF2BP1 can recognize m6A sites in the 3'UTR of PEG10 mRNA and recruits PABPC1 to enhance Retrotransposon-derived protein PEG10 (PEG10) mRNA stability, which consequently promotes PEG10 protein expression.

Serum response factor (SRF)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	MV3 cell line	Homo sapiens
Treatment: siIGF2BP1 MV3 cells Control: siControl MV3 cells		GSE146803
Regulation		logFC: -9.12E-01 p-value: 4.27E-10
More Results	Click to View More RNA-seq Results

Solid tumour/cancer [ICD-11: 2A00-2F9Z]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[13]
Responsed Disease	Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Target Regulation	Up regulation
Cell Process	Cell growth
Cell Process	Cell invasion
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	K-562	Chronic myelogenous leukemia	Homo sapiens	CVCL_0004
Response Summary	IGF2BP1 promotes Serum response factor (SRF) and SRF target genes at the post-transcriptional level suggesting it as a post-transcriptional enhancer of SRF itself as well as SRF-dependent gene expression in cancer cells.

Signal transducer and activator of transcription 3 (STAT3)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	ES-2 cell line	Homo sapiens
Treatment: siIGF2BP1 ES-2 cells Control: siControl ES-2 cells		GSE161087
Regulation		logFC: 6.53E-01 p-value: 9.70E-05
More Results	Click to View More RNA-seq Results

Atherosclerosis [ICD-11: BD40]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[14]
Responsed Disease	Atherosclerosis [ICD-11: BD40.Z]
Target Regulation	Up regulation
Pathway Response	JAK-STAT signaling pathway			hsa04630
Cell Process	Cell proliferation and migration
In-vitro Model	HUVEC-C	Normal	Homo sapiens	CVCL_2959
In-vivo Model	The adeno-associated viruses (AAV) that could silence METTL3 (sh-METTL3) and the negative control adeno-associated viruses (sh-NC) were obtained from WZ Biosciences Inc. (Jinan, China). APOE^-/- mice were randomly divided into AS + sh-NC and AS + sh-METTL3 groups. Each group contains five mice. Mice were fed with the standard diet for 1 week to acclimatize. After 1 week of acclimation, mice were challenged with a high-fat and high-cholesterol feed H10⁵40 (Beijing HFK BIOSCIENCE Co., Ltd., Beijing, China). The formula of the H10⁵40 feed was shown in Supplementary File S1. After 8 weeks of HFD feeding, sh-NC or sh-METTL3 adeno-associated virus serotype 9 (AAV9, 1012 viral genome copies per mouse) were respectively delivered into mice in AS + sh-NC or AS + sh-METTL3 group through tail vein injection. At 14 weeks after HDF feeding, mice fasted overnight.
Response Summary	METTL3 knockdown prevented Atherosclerosis progression by inhibiting JAK2/Signal transducer and activator of transcription 3 (STAT3) pathway via IGF2BP1.

Thymidine kinase, cytosolic (TK1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	MV3 cell line	Homo sapiens
Treatment: siIGF2BP1 MV3 cells Control: siControl MV3 cells		GSE146803
Regulation		logFC: -6.03E-01 p-value: 6.27E-08
More Results	Click to View More RNA-seq Results

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Cell Process	RNA decay
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
Response Summary	In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, FSCN1, Thymidine kinase, cytosolic (TK1), and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.

Cervical cancer [ICD-11: 2C77]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Cervical cancer [ICD-11: 2C77]
Cell Process	RNA decay
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
Response Summary	In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, FSCN1, Thymidine kinase, cytosolic (TK1), and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.

Transcription factor AP-2 gamma (TFAP2C)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	A549 cell line	Homo sapiens
Treatment: IGF2BP1 knockout A549 cells Control: Wild type A549 cells		GSE146546
Regulation		logFC: 6.39E-01 p-value: 1.76E-04
More Results	Click to View More RNA-seq Results

Testicular cancer [ICD-11: 2C80]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[15]
Responsed Disease	Testicular cancer [ICD-11: 2C80]
Responsed Drug	Cisplatin		Approved	Drug Info
Target Regulation	Up regulation
Pathway Response	Nucleotide excision repair			hsa03420
Cell Process	DNA repair
In-vitro Model	TCam-2	Testicular seminoma	Homo sapiens	CVCL_T012
In-vivo Model	Male mice were subcutaneously injected with tumour cells near the limbs to establish xenografts (1 × 10⁶/mouse, 0.2 mL for each injection site; METTL3-overexpressing TCam-2/CDDP cells were inoculated once at the initial time and IGF2BP1-inhibited TCam-2/CDDP cells were inoculated every 3 days).
Response Summary	METTL3 potentiates resistance to cisplatin through m6A modification of Transcription factor AP-2 gamma (TFAP2C) in seminoma. Enhanced stability of TFAP2C mRNA promoted seminoma cell survival under cisplatin treatment burden probably through up-regulation of DNA repair-related genes. IGF2BP1 binds to TFAP2C and enhances TFAP2C mRNA stability.

Transcription factor E2F3 (E2F3)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	HepG2 cell line	Homo sapiens
Treatment: siIGF2BP1 HepG2 cells Control: siControl HepG2 cells		GSE161086
Regulation		logFC: -8.52E-01 p-value: 2.50E-03
More Results	Click to View More RNA-seq Results

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Cell Process	Cell apoptosis
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	NCI-H520	Lung squamous cell carcinoma	Homo sapiens	CVCL_1566
	HBE (Human bronchial epithelial cell line)
	LTEP-a2	Endocervical adenocarcinoma	Homo sapiens	CVCL_6929
	SK-MES-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_0630
Response Summary	GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including Transcription factor E2F3 (E2F3), WTAP, CCND1, CDK4, EGR2, YBX1, and TLX, which were associated with lung cancers.

Transcription factor SOX-2 (SOX2)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	A549 cell line	Homo sapiens
Treatment: IGF2BP1 knockout A549 cells Control: Wild type A549 cells		GSE146546
Regulation		logFC: -2.55E+00 p-value: 6.23E-05
More Results	Click to View More RNA-seq Results

Endometrial cancer [ICD-11: 2C76]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[16]
Responsed Disease	Endometrial cancer [ICD-11: 2C76]
Target Regulation	Up regulation
Cell Process	RNA stability
In-vitro Model	Ishikawa	Endometrial adenocarcinoma	Homo sapiens	CVCL_2529
In-vitro Model	ECC-1	Endometrial Cancer	Homo sapiens	CVCL_7260
In-vivo Model	Nude mice were subcutaneously injected with 1 × 10⁷ PADI2 depleted or IGF2BP1 depleted Ishikawa cells on the left flanks, and the corresponding control cells on the right flanks.
Response Summary	Dysregulation of IGF2BP1 by PADI2/MEK1/ERK signaling results in abnormal accumulation of oncogenic Transcription factor SOX-2 (SOX2) expression, therefore supporting the malignant state of EC.

Translocation protein SEC62 (SEC62)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	HepG2 cell line	Homo sapiens
Treatment: siIGF2BP1 HepG2 cells Control: siControl HepG2 cells		GSE161086
Regulation		logFC: -8.16E-01 p-value: 3.16E-03
More Results	Click to View More RNA-seq Results

Gastric cancer [ICD-11: 2B72]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[17]
Responsed Disease	Gastric cancer [ICD-11: 2B72]
Target Regulation	Up regulation
Pathway Response	Protein processing in endoplasmic reticulum			hsa04141
Cell Process	RNA stability
Cell Process	Cell apoptosis
In-vitro Model	GES-1	Normal	Homo sapiens	CVCL_EQ22
	HGC-27	Gastric carcinoma	Homo sapiens	CVCL_1279
	MGC-803	Gastric mucinous adenocarcinoma	Homo sapiens	CVCL_5334
	MKN45	Gastric adenocarcinoma	Homo sapiens	CVCL_0434
	MKN45	Gastric adenocarcinoma	Homo sapiens	CVCL_0434
Response Summary	MiR-4429 prevented gastric cancer progression through targeting METTL3 to inhibit m6A-caused stabilization of Translocation protein SEC62 (SEC62), indicating miR-4429 as a promising target for treatment improvement for Gastric cancer. METTL3 interacted with SEC62 to induce the m6A on SEC62 mRNA, therefore facilitated the stabilizing effect of IGF2BP1 on SEC62 mRNA.

Tyrosine-protein kinase JAK2 (JAK2)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	HepG2 cell line	Homo sapiens
Treatment: siIGF2BP1 HepG2 cells Control: siControl HepG2 cells		GSE161086
Regulation		logFC: -1.30E+00 p-value: 1.73E-03
More Results	Click to View More RNA-seq Results

Atherosclerosis [ICD-11: BD40]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[14]
Responsed Disease	Atherosclerosis [ICD-11: BD40.Z]
Target Regulation	Up regulation
Pathway Response	JAK-STAT signaling pathway			hsa04630
Cell Process	Cell proliferation and migration
In-vitro Model	HUVEC-C	Normal	Homo sapiens	CVCL_2959
In-vivo Model	The adeno-associated viruses (AAV) that could silence METTL3 (sh-METTL3) and the negative control adeno-associated viruses (sh-NC) were obtained from WZ Biosciences Inc. (Jinan, China). APOE^-/- mice were randomly divided into AS + sh-NC and AS + sh-METTL3 groups. Each group contains five mice. Mice were fed with the standard diet for 1 week to acclimatize. After 1 week of acclimation, mice were challenged with a high-fat and high-cholesterol feed H10⁵40 (Beijing HFK BIOSCIENCE Co., Ltd., Beijing, China). The formula of the H10⁵40 feed was shown in Supplementary File S1. After 8 weeks of HFD feeding, sh-NC or sh-METTL3 adeno-associated virus serotype 9 (AAV9, 1012 viral genome copies per mouse) were respectively delivered into mice in AS + sh-NC or AS + sh-METTL3 group through tail vein injection. At 14 weeks after HDF feeding, mice fasted overnight.
Response Summary	METTL3 knockdown prevented Atherosclerosis progression by inhibiting Tyrosine-protein kinase JAK2 (JAK2)/STAT3 pathway via IGF2BP1.

Ubiquitin-like modifier-activating enzyme 6 (UBA6)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	PANC-1 cell line	Homo sapiens
Treatment: siIGF2BP1 PANC-1 cells Control: siControl PANC-1 cells		GSE161087
Regulation		logFC: -1.00E+00 p-value: 7.50E-03
More Results	Click to View More RNA-seq Results

Ovarian cancer [ICD-11: 2C73]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[18]
Responsed Disease	Ovarian cancer [ICD-11: 2C73]
Target Regulation	Up regulation
In-vitro Model	SK-OV-3	Ovarian serous cystadenocarcinoma	Homo sapiens	CVCL_0532
In-vitro Model	OVCAR-3	Ovarian serous adenocarcinoma	Homo sapiens	CVCL_0465
Response Summary	IGF2BP1 was identified as the m6A reader protein of UBA6-AS1-RBM15-mediated m6A modification of Ubiquitin-like modifier-activating enzyme 6 (UBA6) mRNA, which enhanced the stability of UBA6 mRNA. UBA6-AS1 suppressed the proliferation, migration and invasion of OC cells via UBA6.

Y-box-binding protein 1 (YBX1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	PANC-1 cell line	Homo sapiens
Treatment: siIGF2BP1 PANC-1 cells Control: siControl PANC-1 cells		GSE161087
Regulation		logFC: -6.25E-01 p-value: 4.95E-03
More Results	Click to View More RNA-seq Results

Malignant haematopoietic neoplasm [ICD-11: 2B33]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[2]
Responsed Disease	Myeloid leukaemia [ICD-11: 2B33.1]
Target Regulation	Up regulation
Cell Process	Cell apoptosis
In-vitro Model	Leukemia stem cell line (Leukemia stem cell line)
	Kasumi-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_0589
	MOLM-13	Adult acute myeloid leukemia	Homo sapiens	CVCL_2119
	THP-1	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0006
	MV4-11	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0064
	BV-173	Chronic myelogenous leukemia	Homo sapiens	CVCL_0181
	NOMO-1	Adult acute monocytic leukemia	Homo sapiens	CVCL_1609
	K-562	Chronic myelogenous leukemia	Homo sapiens	CVCL_0004
	KG-1a	Adult acute myeloid leukemia	Homo sapiens	CVCL_1824
Response Summary	Y-box-binding protein 1 (YBX1) selectively functions in regulating survival of myeloid leukemia cells. YBX1 interacts with insulin-like growth factor 2 messenger RNA (mRNA)-binding proteins (IGF2BPs) and stabilizes m6A-tagged RNA. YBX1 deficiency dysregulates the expression of apoptosis-related genes and promotes mRNA decay of MYC and BCL2 in an m6A-dependent manner, which contributes to the defective survival that results from deletion of YBX1.

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Cell Process	Cell apoptosis
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	NCI-H520	Lung squamous cell carcinoma	Homo sapiens	CVCL_1566
	HBE (Human bronchial epithelial cell line)
	LTEP-a2	Endocervical adenocarcinoma	Homo sapiens	CVCL_6929
	SK-MES-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_0630
Response Summary	GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, CCND1, CDK4, EGR2, Y-box-binding protein 1 (YBX1), and TLX, which were associated with lung cancers.

Bone morphogenetic protein 2 (BMP2)

Target Gene

Ossification of spinal ligaments [ICD-11: FA83]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[19]
Responsed Disease	Ossification of spinal ligaments [ICD-11: FA83]
Target Regulation	Up regulation

Cadherin-1 (CDH1)

Target Gene

Esophageal cancer [ICD-11: 2B70]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[20]
Responsed Disease	Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
In-vitro Model	Eca-109	Esophageal squamous cell carcinoma	Homo sapiens	CVCL_6898
In-vitro Model	KYSE-30	Esophageal squamous cell carcinoma	Homo sapiens	CVCL_1351

Complex I-AGGG (NDUFB2)

Target Gene

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[21]
Responsed Disease	Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation	Down regulation
Pathway Response	Ubiquitin mediated proteolysis			hsa04120
Cell Process	Tumour immunology
Cell Process	Ubiquitination degradation
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	BEAS-2B	Normal	Homo sapiens	CVCL_0168
	NCI-H1299	Lung large cell carcinoma	Homo sapiens	CVCL_0060
	NCI-H1650	Minimally invasive lung adenocarcinoma	Homo sapiens	CVCL_1483
	NCI-H1703	Lung squamous cell carcinoma	Homo sapiens	CVCL_1490
	NCI-H1975	Lung adenocarcinoma	Homo sapiens	CVCL_1511
	NCI-H460	Lung large cell carcinoma	Homo sapiens	CVCL_0459
	HCC827	Lung adenocarcinoma	Homo sapiens	CVCL_2063
	LL/2 (LLC1)	Malignant tumors	Mus musculus	CVCL_4358
In-vivo Model	A549 cells were transfected with the pZW1-FCS-circNDUFB2 plasmid or pZW1-FCS-Vector plasmid, and selected with G418 (800 ug/ml) for 4 weeks, and then 2 × 10⁶ A549 cells were subcutaneously injected into the right flank of each mouse.
Response Summary	Complex I-AGGG (NDUFB2) interacts with IGF2BP1/2/3 in NSCLC cells. circNDUFB2 participates in the degradation of IGF2BPs and activation of anti-tumor immunity during NSCLC progression via the modulation of both protein ubiquitination and degradation, as well as cellular immune responses.

Cytochrome P450 1B1 (CYP1B1)

Target Gene

Osteoarthritis [ICD-11: FA05]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[23]
Responsed Disease	Osteoarthritis [ICD-11: FA05]
Target Regulation	Up regulation
In-vivo Model	An anterior cruciate ligament transection (ACLT)-induced OA model was constructed in mice. Briefly, 10-week-old male C57BL/6 mice were anesthetized, and the skin was prepared. The knee joint capsule was opened, and the ACL was carefully transected with microsurgical scissors under a microscope. For the sham operation, the right knee joints were exposed, but the ligament was not transected. At 1 week, 3 weeks, 5 weeks and 7 weeks after the operation, 10 μl of DMEM containing 1 * 10^5 control MSCs or ALKBH5-overexpressing MSCs was injected into the knee joint with an insulin syringe (BD Bioscience, 324702), with 10 μl of DMEM as a control.

E3 SUMO-protein ligase EGR2 (EGR2)

Target Gene

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Cell Process	Cell apoptosis
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	NCI-H520	Lung squamous cell carcinoma	Homo sapiens	CVCL_1566
	HBE (Human bronchial epithelial cell line)
	LTEP-a2	Endocervical adenocarcinoma	Homo sapiens	CVCL_6929
	SK-MES-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_0630
Response Summary	GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, CCND1, CDK4, E3 SUMO-protein ligase EGR2 (EGR2), YBX1, and TLX, which were associated with lung cancers.

E3 ubiquitin-protein ligase TRIM11 (TRIM11)

Target Gene

Cervical cancer [ICD-11: 2C77]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[24]
Responsed Disease	Cervical cancer [ICD-11: 2C77]
Target Regulation	Up regulation

G1/S-specific cyclin-D1 (CCND1)

Target Gene

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Cell Process	Cell apoptosis
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	NCI-H520	Lung squamous cell carcinoma	Homo sapiens	CVCL_1566
	HBE (Human bronchial epithelial cell line)
	LTEP-a2	Endocervical adenocarcinoma	Homo sapiens	CVCL_6929
	SK-MES-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_0630
Response Summary	GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, G1/S-specific cyclin-D1 (CCND1), CDK4, EGR2, YBX1, and TLX, which were associated with lung cancers.

High mobility group protein B1 (HMGB1)

Target Gene

Diabetic [ICD-11: 5A14]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[25]
Responsed Disease	Diabetic [ICD-11: 5A14]
Target Regulation	Up regulation
In-vitro Model	HUVEC-C	Normal	Homo sapiens	CVCL_2959

Interleukin-11 (IL11)

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[26]
Responsed Disease	Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Up regulation
In-vitro Model	THLE-2	Normal	Homo sapiens	CVCL_3803
	SNU-398	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0077
	Huh-7	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0336
	Hep 3B2.1-7	Childhood hepatocellular carcinoma	Homo sapiens	CVCL_0326
	HCCLM3	Adult hepatocellular carcinoma	Homo sapiens	CVCL_6832
In-vivo Model	Indicated HCC cells were intrasplenically injected into 5-week-old male BALB/C athymic nude mice (SpePharm Biotechnology, Beijing, China). After being fed in specific pathogen free condition for 35 days, the mice were euthanized and the livers were resected and subjected to HE staining.

Kinesin-like protein KIF3C (KIF3C)

Target Gene

Prostate cancer [ICD-11: 2C82]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[27]
Responsed Disease	Prostate cancer [ICD-11: 2C82]
Target Regulation	Up regulation

Lactate dehydrogenase A (LDHA)

Target Gene

Renal cell carcinoma [ICD-11: 2C90]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[28]
Responsed Disease	Renal cell carcinoma [ICD-11: 2C90]
Target Regulation	Up regulation
In-vitro Model	HK2	Normal	Acipenser baerii	CVCL_YE28
In-vitro Model	786-O	Renal cell carcinoma	Homo sapiens	CVCL_1051

Nuclear receptor subfamily 2 group E member 1 (TLX/NR2E1)

Target Gene

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Cell Process	Cell apoptosis
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	NCI-H520	Lung squamous cell carcinoma	Homo sapiens	CVCL_1566
	HBE (Human bronchial epithelial cell line)
	LTEP-a2	Endocervical adenocarcinoma	Homo sapiens	CVCL_6929
	SK-MES-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_0630
Response Summary	GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, CCND1, CDK4, EGR2, YBX1, and Nuclear receptor subfamily 2 group E member 1 (TLX/NR2E1), which were associated with lung cancers.

Programmed cell death 1 ligand 1 (CD274/PD-L1)

Target Gene

Gastric cancer [ICD-11: 2B72]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[36]
Responsed Disease	Gastric cancer [ICD-11: 2B72]
Target Regulation	Up regulation
In-vitro Model	AGS	Gastric adenocarcinoma	Homo sapiens	CVCL_0139
	HGC-27	Gastric carcinoma	Homo sapiens	CVCL_1279
	MKN45	Gastric adenocarcinoma	Homo sapiens	CVCL_0434
	SNU-216	Gastric tubular adenocarcinoma	Homo sapiens	CVCL_3946
	GES-1	Normal	Homo sapiens	CVCL_EQ22
In-vivo Model	Approximately 1 × 10⁶ cells with IGF2BP1 transfection plasmids were suspended in 100 μL PBS were injected in the flank of 4-weeks old male BALB/c nude mice. After 22 days observation, the tumor size was measured with vernier caliper and calculated using V = (width2 × length × 0.5), then, mice were anesthetized and sacrificed for tumors tissue gaining.

Colon cancer [ICD-11: 2B90]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[38]
Responsed Disease	Colon cancer [ICD-11: 2B90]
Target Regulation	Up regulation
In-vitro Model	HCT 116	Colon carcinoma	Homo sapiens	CVCL_0291
	DLD-1	Colon adenocarcinoma	Homo sapiens	CVCL_0248
	SW620	Colon adenocarcinoma	Homo sapiens	CVCL_0547
	HCT 8	Colon adenocarcinoma	Homo sapiens	CVCL_2478
	Caco-2	Colon adenocarcinoma	Homo sapiens	CVCL_0025
In-vivo Model	A total of 10⁶ cells transfected with the IGF2BP1 silencing (sh-IGF2BP1-2) or control (sh-NC) constructs were injected subcutaneously into nude mice.

Runt-related transcription factor 2 (Runx2)

Target Gene

Maxillofacial bone defect is a critical obstacle for maxillofacial tumors and periodontal diseases. [ICD-11: NA02]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[39]
Responsed Disease	Maxillofacial bone defect is a critical obstacle for maxillofacial tumors and periodontal diseases. [ICD-11: NA02]
Target Regulation	Up regulation

Transcription factor E2F1 (E2F1)

Target Gene

Acute kidney failure [ICD-11: GB60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[40]
Responsed Disease	Acute kidney failure [ICD-11: GB60]
Target Regulation	Up regulation
In-vitro Model	HK2	Normal	Acipenser baerii	CVCL_YE28
In-vivo Model	Each mouse was intraperitoneally administered according to body weight (20 μg/g of ISO-1 for the CLP+ISO-1 group and the same quantity of 1% DMSO for the CLP+DMSO group) 4-6 h prior to the CLP surgery. Injection of renal parenchyma (5×10⁷ TU/mouse) facilitated lentivirus-mediated gene transfer in the kidneys. The CLP operation was conducted one week after the injection. In vivo tests were conducted in accordance with Chinese regulations on the use and care of laboratory animals.

Transcriptional activator Myb (MYB)

Target Gene

Acute myeloid leukaemia [ICD-11: 2A60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[1]
Responsed Disease	Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation	Up regulation
In-vitro Model	MOLT-16	T acute lymphoblastic leukemia	Homo sapiens	CVCL_1424
	Reh	B acute lymphoblastic leukemia	Homo sapiens	CVCL_1650
	SKNO-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_2196
	Tanoue	B acute lymphoblastic leukemia	Homo sapiens	CVCL_1852
In-vivo Model	For the engraftment experiments, 1×10³ 1×10⁶ cells were injected into tail veins of non-irradiated 6-10 week-old female mice in 100 uL of DPBS per mouse. No blinding or randomization was applied to mice experiments. Routinely, each in vivo experiment was performed with three technical replicates (three mice per group) and independently repeated two to three times for each cell line.
Response Summary	IGF2BP1 decreases leukemia cells' tumorigenicity, promotes myeloid differentiation, increases leukemia cell death, and sensitizes acute myeloid leukemia cells to chemotherapeutic drugs. IGF2BP1 affects proliferation and tumorigenic potential of leukemia cells through critical regulators of self-renewal HOXB4 and Transcriptional activator Myb (MYB) and through regulation of expression of the aldehyde dehydrogenase, ALDH1A1.

Prostate cancer associated transcript 6 (PCAT6)

Target Gene

Brain cancer [ICD-11: 2A00]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[41]
Responsed Disease	Glioblastoma [ICD-11: 2A00.00]
In-vitro Model	LN-229	Glioblastoma	Homo sapiens	CVCL_0393
In-vitro Model	A-172	Glioblastoma	Homo sapiens	CVCL_0131

UBA6 divergent transcript (UBA6-DT/UBA6-AS1)

Target Gene

Ovarian cancer [ICD-11: 2C73]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[18]
Responsed Disease	Ovarian cancer [ICD-11: 2C73]
Target Regulation	Up regulation
In-vitro Model	SK-OV-3	Ovarian serous cystadenocarcinoma	Homo sapiens	CVCL_0532
In-vitro Model	OVCAR-3	Ovarian serous adenocarcinoma	Homo sapiens	CVCL_0465
Response Summary	IGF2BP1 was identified as the m6A reader protein of UBA6 divergent transcript (UBA6-DT/UBA6-AS1)-RBM15-mediated m6A modification of UBA6 mRNA, which enhanced the stability of UBA6 mRNA. UBA6-AS1 suppressed the proliferation, migration and invasion of OC cells via UBA6.

A disintegrin and metalloproteinase with thrombospondin motifs 15 (ADAMTS15)

Target Gene

Rheumatoid arthritis [ICD-11: FA20]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[42]
Responsed Disease	Rheumatoid arthritis [ICD-11: FA20]
In-vivo Model	Male Wistar rats were injected at approximately 1.5 cm distal to the base of the tail with emulsion consisting of collagen (2 mg/ml, Chondrex, USA) and complete Freund's adjuvant(CFA) (5 mg/ml, Chondrex, USA) (at the ratio of 1:1) in a volume of 200 μl per rat. 7 days later, a booster immunization was performed by injecting the same concentration of emulsion as the first immunization in a volume of 100 μl per rat. Subsequently, twice intra-articular injection of adenovirus (Control vector or shFTO, 2 × 108 PFU, 50 μl) (Genechem, Shanghai, China) were prescribed to rats at 8 and 15 days after the primary immunization. Arthritis progression was monitored every three days according to the previously described scoring system ranging from 0 to 4 (0, normal; 1, swelling or redness of paw or a single digit; 2, 2 joints involved; 3, 3 joints involved; 4, severe arthritis of the entire paw and digits). The arthritic score was independently calculated in a blinded manner and defined as the average score of hind paws.

Baculoviral IAP repeat-containing protein 5 (BIRC5)

Target Gene

Ovarian cancer [ICD-11: 2C73]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[43]
Responsed Disease	Ovarian cancer [ICD-11: 2C73]
Responsed Drug	Cisplatin		Approved	Drug Info
Target Regulation	Up regulation
In-vitro Model	SK-OV-3	Ovarian serous cystadenocarcinoma	Homo sapiens	CVCL_0532
In-vitro Model	A2780	Ovarian endometrioid adenocarcinoma	Homo sapiens	CVCL_0134
In-vivo Model	Four weeks old female BALB/c nude mice were purchased from SJA Laboratory Animal Co, Ltd (Changsha, China), and acclimated in a specific pathogen free environment for 1 week. SKOV3/DDP cells treated with shBIRC5, or shBIRC5 combined with pcDNA-IGF2BP1 plasmid (IGF2BP1) or corresponding negative control were suspended in 100 μL McCoy's 5A medium and implanted subcutaneously into the left frank of mice in 1 × 10⁷ cells/mice. After 7 days incubation, three groups of mice received 10 mg/kg cisplatin respectively, sacrificing and tumor collecting after 30 days.

C-terminal-binding protein 1 (CTBP1)

Target Gene

Clear cell renal cell carcinoma [ICD-11: XH46F1]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[44]
Responsed Disease	Clear cell renal cell carcinoma [ICD-11: XH46F1]
In-vitro Model	Caki-1	Clear cell renal cell carcinoma	Homo sapiens	CVCL_0234
In-vitro Model	786-O	Renal cell carcinoma	Homo sapiens	CVCL_1051

Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A)

Target Gene

Breast cancer [ICD-11: 2C60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[45]
Responsed Disease	Breast cancer [ICD-11: 2C60]
Target Regulation	Up regulation
In-vitro Model	HEK293T	Normal	Homo sapiens	CVCL_0063
	MDA-MB-468	Breast adenocarcinoma	Homo sapiens	CVCL_0419
	HCC1806	Breast squamous cell carcinoma	Homo sapiens	CVCL_1258
	Human Pancreatic Nestin-Expressing cells (Human Pancreatic Nestin-Expressing cells)
In-vivo Model	Female BALB/c nude mice (4-5 weeks, 18-20 g) were purchased from GemPharmatech (Nanjing, China) and raised in a specific pathogen-free (SPF) experimental animal room. Treated cells (1×10⁶/100 μl PBS) were injected through the tail vein of the nude mice. Pulmonary metastasis was evaluated by bioluminescence imaging at 4 or 8 weeks. Then, the mice were sacrificed, and the lung tissues were imaged and fixed in 4% paraformaldehyde for further analyses.

Circ_ASXL1

Target Gene

Ovarian cancer [ICD-11: 2C73]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[46]
Responsed Disease	Ovarian cancer [ICD-11: 2C73]
Target Regulation	Up regulation
In-vitro Model	SK-OV-3	Ovarian serous cystadenocarcinoma	Homo sapiens	CVCL_0532
	OVCAR-3	Ovarian serous adenocarcinoma	Homo sapiens	CVCL_0465
	ES-2	Ovarian clear cell adenocarcinoma	Homo sapiens	CVCL_3509
	HEY	Ovarian serous adenocarcinoma	Homo sapiens	CVCL_0297
	A2780	Ovarian endometrioid adenocarcinoma	Homo sapiens	CVCL_0134
	COV362	Ovarian serous adenocarcinoma	Homo sapiens	CVCL_2420
In-vivo Model	SKOV3 cells were treated with sh-NC or sh-circASXL1. 100 μL of PBS containing 1 × 10⁶ cells were implanted into mice. Tumor volume was measured every 5 days. After 30 days, mice were euthanized. The tumor was excised and weighed.

Circ_MAP3K4

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[47]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug	Cisplatin		Approved	Drug Info
Target Regulation	Up regulation
Pathway Response	Ubiquitin mediated proteolysis			hsa04120
Cell Process	Proteasome pathway degradation
In-vitro Model	Huh-7	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0336
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	PLC/PRF/5	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0485
Response Summary	Driven by m6A modification, Circ_MAP3K4 encoded circMAP3K4-455aa, protected HCC cells from cisplatin exposure, and predicted worse prognosis of HCC patients. IGF2BP1 facilitates circMAP3K4 peptide translation, then the circMAP3K4 peptide inhibits AIF cleavage and nuclear distribution.

Circ_PTPRA

Target Gene

Bladder cancer [ICD-11: 2C94]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[48]
Responsed Disease	Bladder cancer [ICD-11: 2C94]
Target Regulation	Up regulation
Cell Process	Cell proliferation
	Cell migration
	Cell invasion
In-vitro Model	T24T	Bladder carcinoma	Homo sapiens	CVCL_M892
	EJ (Human bladder cancer cells)
In-vivo Model	For melittin treatment study, 4-week-old female BALB/c nude mice were subcutaneously injected with 1 × 10⁷ T24 or BIU87 cells.
Response Summary	IGF2BP1 was predominantly binded with Circ_PTPRA in the cytoplasm in BC cells.

Disintegrin and metalloproteinase domain-containing protein 10 (ADAM10)

Target Gene

BackgroundAllergic rhinitis [ICD-11: CA08]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[49]
Responsed Disease	BackgroundAllergic rhinitis [ICD-11: CA08.0]
Target Regulation	Up regulation
In-vivo Model	Briefly, the mice were intraperitoneally injected with 25 μg OVA mixed with 1 mg aluminum hydroxide gel was intraperitoneally injected into mice once a week for three weeks. Subsequently, nostril challenge with 500 μg OVA was performed once a day for one week. The control mice were exposed to PBS (vehicle). LV-sh-NC or LV-sh-circMIRLET7BHG (1 × 10⁷ TU/mL, GenePharma) were injected into mice via the tail vein two days before the nostril challenge.

E3 ubiquitin-protein ligase CHIP (STUB1)

Target Gene

Alzheimer disease [ICD-11: 8A20]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[50]
Responsed Disease	Alzheimer disease [ICD-11: 8A20]
Target Regulation	Up regulation
In-vitro Model	SH-SY5Y	Neuroblastoma	Homo sapiens	CVCL_0019
In-vitro Model	HT22	Normal	Mus musculus	CVCL_0321

E3 ubiquitin-protein ligase synoviolin (SYVN1)

Target Gene

Cervical cancer [ICD-11: 2C77]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[51]
Responsed Disease	Cervical cancer [ICD-11: 2C77]
Target Regulation	Up regulation
In-vitro Model	C-33 A	Cervical squamous cell carcinoma	Homo sapiens	CVCL_1094
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	SiHa	Cervical squamous cell carcinoma	Homo sapiens	CVCL_0032
	Ca Ski	Cervical squamous cell carcinoma	Homo sapiens	CVCL_1100
	ME-180	Human papillomavirus-related cervical squamous cell carcinoma	Homo sapiens	CVCL_1401
In-vivo Model	Mice were blindly grouped into sh-NC, sh-LRRC75A-AS1, OE-NC, and OE-LRRC75A-AS1 groups (n = 7 per group). sh-NC or sh-LRRC75A-AS1-transfected HeLa cells and OE-NC or OE-LRRC75A-AS1-transfected CaSki cells were subcutaneously injected into the right flank (1 × 10⁶ cells in 200 μL PBS/mouse).

Ephrin type-A receptor 3 (EPHA3)

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[52]
Responsed Disease	Liver hepatocellular carcinoma [ICD-11: 2C12.02]
In-vitro Model	Huh-7	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0336
	SNU-449	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0454
	Hep 3B2.1-7	Childhood hepatocellular carcinoma	Homo sapiens	CVCL_0326

Ferritin heavy chain (FTH1)

Target Gene

Ovarian cancer [ICD-11: 2C73]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[53]
Responsed Disease	Ovarian cancer [ICD-11: 2C73]
Target Regulation	Up regulation
In-vitro Model	SK-OV-3	Ovarian serous cystadenocarcinoma	Homo sapiens	CVCL_0532
In-vitro Model	A2780	Ovarian endometrioid adenocarcinoma	Homo sapiens	CVCL_0134
In-vivo Model	Ten BALB/c nude mice (21 days) were randomly divided into two groups (NC group and si-CACNA1G-AS1 group). In the NC group, we performed subcutaneous injection with 0.2 ml SKOV3 cells (2 × 10⁷/ml) on the back of each mouse, while in the si-CACNA1G-AS1 group, we chose 0.2 ml CACNA1G-AS1 knockout SKOV3 cells (2 × 10⁷/ml) for injection. During this process, we set the puncture point 1.0 cm from the injection site. Each mouse was injected once, and the next day was marked as the first day after inoculation. Meanwhile, 1 ml PBS buffer supplemented with ferric ammonium citrate (FAC, with 100 μmol/L Fe2+) was injected alongside the tumor borders at 0, 6, 12, 18 and 24 days after subcutaneous inoculation of ovarian cancer cells. We chose 6, 12, 18, 24, 30, 36, 42 and 48 days post tumor cell injection as assessment points, where we measured the long/short diameter of tumors with calipers and then calculated tumor volume according to the formula: length × width2/2. All tumor-bearing mice were euthanized by intraperitoneal injection with pentobarbital sodium (150-200 mg/kg) on the 50th day, and then these subcutaneous transplant tumors were removed, weighed and analyzed.

Ferroptosis suppressor protein 1 (AIFM2)

Target Gene

Colorectal cancer [ICD-11: 2B91]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[54]
Responsed Disease	Colorectal cancer [ICD-11: 2B91]
Target Regulation	Up regulation

Frizzled-6 (FZD6)

Target Gene

Colorectal cancer [ICD-11: 2B91]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[55]
Responsed Disease	Colorectal cancer [ICD-11: 2B91]
Target Regulation	Up regulation
In-vitro Model	FHC	Normal	Homo sapiens	CVCL_3688
	SW480	Colon adenocarcinoma	Homo sapiens	CVCL_0546
	DLD-1	Colon adenocarcinoma	Homo sapiens	CVCL_0248
	HCT 116	Colon carcinoma	Homo sapiens	CVCL_0291
	HT-29	Colon adenocarcinoma	Homo sapiens	CVCL_0320
	LoVo	Colon adenocarcinoma	Homo sapiens	CVCL_0399
	SW620	Colon adenocarcinoma	Homo sapiens	CVCL_0547
In-vivo Model	Female BALB/c nude mouse (4 weeks) was used to establish a xenograft transplant model. DLD-1 cells stably transfected with sh-linc00659 or scramble were subcutaneously inoculated in the mouse with 2 × 10⁶ cells.

G-protein coupled estrogen receptor 1 (GPER1)

Target Gene

Acute ischemic stroke [ICD-11: 8B11]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[56]
Responsed Disease	Acute ischemic stroke [ICD-11: 8B11]
Target Regulation	Up regulation

Homeobox protein Hox-C10 (HOXC10)

Target Gene

Head and neck squamous carcinoma [ICD-11: 2B6E]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[57]
Responsed Disease	Head and neck squamous carcinoma [ICD-11: 2B6E]
Target Regulation	Up regulation
Pathway Response	Wnt signaling pathway			hsa04310
In-vitro Model	FaDu	Hypopharyngeal squamous cell carcinoma	Homo sapiens	CVCL_1218
In-vitro Model	HuLa-PC	N.A.	Homo sapiens	CVCL_UC74
In-vivo Model	Animals had free access to standard rodent chow and water. For the subcutaneous xenograft tumor model, transfected cells (5×10⁶) were injected on the sides of the flanks of mice (n=5 per group). Subsequently, 30 days later, the mice were euthanized by cervical dislocation following anesthesia induced by intraperitoneal injection of 0.3% sodium pentobarbital (30 mg/kg). Euthanasia was confirmed by verifying respiratory and cardiac arrest, along with pupil dilation, for a minimum of 10 min. Tumor size and tumor weight were measured (max tumor diameter, 9.6 mm; max area, 82.56 mm2; max volume, 355.01 mm3). For the pulmonary metastasis model, transfected cells (2×10⁶) were injected into the mouse tail veins (n=5 per group). Subsequently, 60 days later, the mice were sacrificed, and lungs were obtained. Finally, lung and tumor tissues were available for H&E staining at room temperature for 5 min or immunohistochemistry staining.

hsa-miR-383-5p

Target Gene

Pancreatic cancer [ICD-11: 2C10]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[58]
Responsed Disease	Pancreatic cancer [ICD-11: 2C10]
Target Regulation	Up regulation
In-vitro Model	HPDE6c7	Normal	Homo sapiens	CVCL_0P38
	Capan-1	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0237
	SW1990	Pancreatic adenocarcinoma	Homo sapiens	CVCL_1723
	CFPAC-1	Cystic fibrosis	Homo sapiens	CVCL_1119

Hydroxymethylglutaryl-CoA synthase, mitochondrial (HMGCS2)

Target Gene

Colorectal cancer [ICD-11: 2B91]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[59]
Responsed Disease	Colorectal cancer [ICD-11: 2B91]
Target Regulation	Up regulation
In-vitro Model	SW480	Colon adenocarcinoma	Homo sapiens	CVCL_0546
	SW620	Colon adenocarcinoma	Homo sapiens	CVCL_0547
	HT29	Colon cancer	Mus musculus	CVCL_A8EZ
	HCT 116	Colon carcinoma	Homo sapiens	CVCL_0291
	LoVo	Colon adenocarcinoma	Homo sapiens	CVCL_0399
	DLD-1	Colon adenocarcinoma	Homo sapiens	CVCL_0248
	FHC	Normal	Homo sapiens	CVCL_3688
	HUVEC-C	Normal	Homo sapiens	CVCL_2959
In-vivo Model	For the xenograft model, 100μL cell suspensions containing 1× 10⁶ CRC cells sin 100 μLPBS were injected into the armpits of the mouse limbs which divided into six groups (shNC, shHMGCS2, shLOC+OE-HMGCS2, shLOC, shHMGCS2+OE-IGF2BP1, shLOC+OE-GF2BP1).

JmjC domain-containing protein 8 (JMJD8)

Target Gene

Colorectal cancer [ICD-11: 2B91]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[60]
Responsed Disease	Colorectal cancer [ICD-11: 2B91]
In-vitro Model	SW480	Colon adenocarcinoma	Homo sapiens	CVCL_0546
In-vitro Model	SW620	Colon adenocarcinoma	Homo sapiens	CVCL_0547

KB-1980E6.3

Target Gene

Breast cancer [ICD-11: 2C60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[10]
Responsed Disease	Breast cancer [ICD-11: 2C60]
Target Regulation	Up regulation
Pathway Response	Signaling pathways regulating pluripotency of stem cells			hsa04550
In-vitro Model	BT-474	Invasive breast carcinoma	Homo sapiens	CVCL_0179
	BT-549	Invasive breast carcinoma	Homo sapiens	CVCL_1092
	HEK293T	Normal	Homo sapiens	CVCL_0063
	Hs 578T	Invasive breast carcinoma	Homo sapiens	CVCL_0332
	MCF-7	Invasive breast carcinoma	Homo sapiens	CVCL_0031
	MDA-MB-231	Breast adenocarcinoma	Homo sapiens	CVCL_0062
	MDA-MB-453	Breast adenocarcinoma	Homo sapiens	CVCL_0418
	MDA-MB-468	Breast adenocarcinoma	Homo sapiens	CVCL_0419
	T-47D	Invasive breast carcinoma	Homo sapiens	CVCL_0553
In-vivo Model	The enriched mammosphere cells derived from engineered BT549 and Hs578T with silenced lncRNA KB-1980E6.3 (shKB/vector), BT549, and Hs578T with lncRNA KB-1980E6.3 knockdown combined with ectopic c-Myc (shKB/c-Myc), BT549, and Hs578T with silenced IGF2BP1 (shIGF2BP1/vector), BT549, and Hs578T with knocked down IGF2BP1 combined with ectopic c-Myc (shIGF2BP1/c-Myc), and BT549, and Hs578T/shNC/vector control cells were used in Xenograft experiments. Three doses (1 × 10⁵, 1 × 10⁴ and 1 × 10³) of spheres derived from the engineered Hs578T and 1 × 10⁵ of spheres derived from the engineered BT549 were subcutaneously inoculated into 4- to 6-week-old female nude mice (n = 5 per group). Mice were then treated with either bevacizumab (10 mg/kg every 3 days) to form a hypoxic tumor microenvironment or vehicle PBS to form a non-hypoxic condition.
Response Summary	Hypoxia-induced lncRNA KB-1980E6.3 is involved in the self-renewal and stemness maintenance of breast cancer stem cells by recruiting IGF2BP1 to regulate c-Myc mRNA stability.

Kremen protein 2 (KREMEN2)

Target Gene

Ovarian cancer [ICD-11: 2C73]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[61]
Responsed Disease	Ovarian cancer [ICD-11: 2C73]
Target Regulation	Down regulation
In-vitro Model	OVCAR-3	Ovarian serous adenocarcinoma	Homo sapiens	CVCL_0465
In-vitro Model	Caov-3	Ovarian serous adenocarcinoma	Homo sapiens	CVCL_0201
In-vivo Model	1 × 10⁵ treated cells were subcutaneously injected into mice with normal drinking water. When the volume of subcutaneous tumors was about 150 mm3, the mice were kept with drinking water containing 1 mg/mL of Dox. After 3 weeks, the xenograft tumors were collected and used for follow-up experiments.

long intergenic non-protein coding RNA 839 (LINC00839)

Target Gene

Nasopharyngeal carcinoma [ICD-11: 2B6B]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[62]
Responsed Disease	Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation	Up regulation
In-vitro Model	NP69SV40T	N.A.	Homo sapiens	CVCL_F755
	N2Tert (The human immortalized nasopharyngeal epithelial cell lines)
	HONE-1	Nasopharyngeal carcinoma	Homo sapiens	CVCL_8706
	SUNE1	Nasopharyngeal carcinoma	Homo sapiens	CVCL_6946
	C666	Nasopharyngeal carcinoma	Homo sapiens	CVCL_M597
	HNE-1	Nasopharyngeal carcinoma	Homo sapiens	CVCL_0308
	5-8F	Nasopharyngeal carcinoma	Homo sapiens	CVCL_C528
	6-10B	Nasopharyngeal carcinoma	Homo sapiens	CVCL_C529
	S18	Nasopharyngeal carcinoma	Homo sapiens	CVCL_B0U9
	S26	Nasopharyngeal carcinoma	Homo sapiens	CVCL_B0UB
	CNE-1	Normal	Homo sapiens	CVCL_6888
	CNE-2	Nasopharyngeal carcinoma	Homo sapiens	CVCL_6889
	HK-1	Lung large cell carcinoma	Homo sapiens	CVCL_7047
In-vivo Model	For xenograft growth model, 1 × 10⁶ SUNE-1 cells stably expressing scrambled or sh-LINC00839 were inoculated subcutaneously into the axillas of nude mice. The tumor volumes were measured every 3 days. After 21 days, the mice were sacrificed. Simultaneously, the subcutaneous tumors were excised and weighed. For the lung metastatic colonization model, 1 × 10⁶ SUNE-1 cells stably expressing scrambled or sh-LINC00839 were injected into the tail veins of nude mice. After 5 weeks, the mice were sacrificed, with their lung tissues dissected. All subcutaneous tumors and lung tissues were paraffin embedded and sectioned for subsequent analyses.

Microtubule cross-linking factor 2 (SOGA1)

Target Gene

Colorectal cancer [ICD-11: 2B91]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[63]
Responsed Disease	Colorectal cancer [ICD-11: 2B91]
Target Regulation	Up regulation
In-vitro Model	NCM460	Normal	Homo sapiens	CVCL_0460
	SW620	Colon adenocarcinoma	Homo sapiens	CVCL_0547
	LoVo	Colon adenocarcinoma	Homo sapiens	CVCL_0399
	HCT 8	Colon adenocarcinoma	Homo sapiens	CVCL_2478
	HCT 15	Colon adenocarcinoma	Homo sapiens	CVCL_0292
	HCT 116	Colon carcinoma	Homo sapiens	CVCL_0291
	HT29	Colon cancer	Mus musculus	CVCL_A8EZ
	SW480	Colon adenocarcinoma	Homo sapiens	CVCL_0546
In-vivo Model	2 × 10⁶ SW620 cells stably overexpressed or silencing METTL16 were injected into the right flank of mice to observe tumor growth. Tumor volumes were monitored once a week after injection and calculated using the formula 0.5 × a2 × b.

MIR4435-2 host gene (MIR4435-2HG)

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[64]
Responsed Disease	Liver cancer [ICD-11: 2C12]
Target Regulation	Up regulation

Mitotic checkpoint serine/threonine-protein kinase BUB1 beta (BUB1B)

Target Gene

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[65]
Responsed Disease	Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation	Up regulation
In-vitro Model	HBEC3-KT	N.A.	Homo sapiens	CVCL_X491
	NCI-H2228	Lung adenocarcinoma	Homo sapiens	CVCL_1543
	NCI-H520	Lung squamous cell carcinoma	Homo sapiens	CVCL_1566
In-vivo Model	Wenty mice were allocated into four groups, n = 5 in each group. CSC cells transfected with sh-IGF2BP1, sh-NC, sh-IGF2BP1 + oe-BUB1B, or sh-IGF2BP1 + oe-NC were injected into mice subcutaneously (2 × 10⁶ cells per mouse). The tumor size was detected every 4 d and evaluated by the formula below: volume = (tumor length × tumor width2)/2. On day 24, the animals were euthanized by injection of overdosed barbiturate (150 mg/kg) to have the tumors collected and weighed. All operators had no idea of the grouping details when analyzing the results.

NAD-dependent protein deacetylase sirtuin-3, mitochondrial (SIRT3)

Target Gene

Cervical cancer [ICD-11: 2C77]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[66]
Responsed Disease	Cervical cancer [ICD-11: 2C77]
Target Regulation	Up regulation
In-vitro Model	Ca Ski	Cervical squamous cell carcinoma	Homo sapiens	CVCL_1100
	SiHa	Cervical squamous cell carcinoma	Homo sapiens	CVCL_0032
	C-33 A	Cervical squamous cell carcinoma	Homo sapiens	CVCL_1094
	Ect1/E6E7	Normal	Homo sapiens	CVCL_3679
In-vivo Model	The animals were maintained in pathogen-free conditions at 21°C ± 2°C and 55% ± 5% humidity with free access to food and water. Mice were randomly divided into three groups (n = 8 per group) and received a subcutaneous injection of 2 × 10⁶ stably transfected SiHa cells containing the indicated lentivirus (empty, Lv-ALKBH5, Lv-ALKBH5 + Lv-ACC1) diluted in PBS in the left flank. The mice were sacrificed when tumours were apparent on day 30. Tumour volume was recorded 7, 14, 21 and 28 days after injection with a Vernier calliper. After euthanasia, xenografts were excised from mice and weighed.

Neurotrophic factor BDNF precursor form (BDNF)

Target Gene

Endometrial cancer [ICD-11: 2C76]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[67]
Responsed Disease	Endometrial cancer [ICD-11: 2C76]
Target Regulation	Up regulation
In-vitro Model	KLE	Endometrial adenocarcinoma	Homo sapiens	CVCL_1329
In-vitro Model	AN3-CA	Endometrial adenocarcinoma	Homo sapiens	CVCL_0028
In-vivo Model	The mice were randomly divided into four groups (n=5 per group), labeled as OE-vector (caudal vein injection of 2×10⁶ AN3CA cells), OE-SLERT (caudal vein injection of 2×10⁶ SLERT-overexpressing AN3CA cells), OE-SLERT+ASO-BDNF (caudal vein injection of 2×10⁶ SLERT-overexpressing AN3CA cells transfected with ASO-BDNF), and OE-SLERT+k252a (caudal vein injection of 2×10⁶ SLERT-overexpressing AN3CA cells and intraperitoneal injection of 25μg/kg k252a). After 4 weeks, the lung tissues were dissected and weighted, followed by H&E staining.

Phosphoenolpyruvate carboxykinase [GTP], mitochondrial (PCK2)

Target Gene

Hepatic inflammation [ICD-11: DB97]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[68]
Responsed Disease	Hepatic inflammation [ICD-11: DB97]
Target Regulation	Up regulation

Phospholipid hydroperoxide glutathione peroxidase GPX4 (GPX4)

Target Gene

Breast cancer [ICD-11: 2C60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[69]
Responsed Disease	Breast cancer [ICD-11: 2C60]
Target Regulation	Up regulation
In-vitro Model	T-47D	Invasive breast carcinoma	Homo sapiens	CVCL_0553
In-vitro Model	MDA-MB-231	Breast adenocarcinoma	Homo sapiens	CVCL_0062

Probable ATP-dependent RNA helicase DDX27 (DDX27)

Target Gene

Colorectal cancer [ICD-11: 2B91]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[70]
Responsed Disease	Colorectal cancer [ICD-11: 2B91]
Target Regulation	Up regulation
In-vitro Model	LoVo	Colon adenocarcinoma	Homo sapiens	CVCL_0399
	SW480	Colon adenocarcinoma	Homo sapiens	CVCL_0546
	SW620	Colon adenocarcinoma	Homo sapiens	CVCL_0547
	HCT 116	Colon carcinoma	Homo sapiens	CVCL_0291
	HCT 8	Colon adenocarcinoma	Homo sapiens	CVCL_2478
In-vivo Model	To create a xenograft model, 1 × 10⁷ SW620 cells stably transfected shMETTL3 and shcircUHRF2 were subcutaneously injected into the nude mice. Tumor sizes were calculated by measuring the length and width (V = length × width2/2). Mice were euthanized four weeks later, and tumors were weighed. For in vivo liver metastasis assay, 1 × 10⁶ SW620 cells stably transfected shMETTL3 and shcircUHRF2 were injected into the distal tip of the spleen of mice according to previous studies.

Progestin and adipoQ receptor family member 4 (PAQR4)

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[71]
Responsed Disease	Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Down regulation
Pathway Response	PI3K-Akt signaling pathway			hsa04151
In-vitro Model	LM3	Malignant neoplasms	Mus musculus	CVCL_D269
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HLF	Adult hepatocellular carcinoma	Homo sapiens	CVCL_2947
	Hep 3B2.1-7	Childhood hepatocellular carcinoma	Homo sapiens	CVCL_0326
	MHCC97-H	Adult hepatocellular carcinoma	Homo sapiens	CVCL_4972
In-vivo Model	For the subcutaneous xenograft model, 1 × 10⁶ tumor cells were resuspended in 100 μL of DMEM and then injected into the axilla of each mouse (n = 5 mice per group). The mice were sacrificed after 2 weeks, the tumor weight was recorded, and the tumor volume was calculated according to the following equation: volume = 1/2*(length × width2). After the experiment, the specimens were fixed with 4% formaldehyde. For the intrahepatic tumor implantation model, 1 × 10⁶ tumor cells were resuspended in 100 μL of DMEM and then inoculated under the capsule of the right lobe of the liver (n = 5 mice per group). The mice were sacrificed after 4 weeks, and the tumors were removed and subjected to HE staining.

Protein c-Fos (FOS)

Target Gene

Gastric cancer [ICD-11: 2B72]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[72]
Responsed Disease	Gastric cancer [ICD-11: 2B72]
Target Regulation	Up regulation
In-vitro Model	Akata	EBV-related Burkitt lymphoma	Homo sapiens	CVCL_0148
In-vivo Model	To evaluate the tumorigenic effect of FTO, FTO knockdown or control AGS B95.8 cells (1 × 10⁷ suspended in 150 μL of PBS) were subcutaneously injected into the flanks of B-NDG mice. The diameter and width of the tumours were measured every 4 days and used to estimate the tumour volumes by the standard formula: 0.5 × length × width2. At the end stage, the tumours were removed, imaged and weighed. To investigate the peritoneal dissemination ability of EBVaGC cells, intraperitoneal injection was performed. Briefly, 1 × 10⁷ FTO silencing or control EBVaGC cells suspended in 0.4 mL of PBS were injected into the peritoneal cavity of each mouse. Eight weeks later, all the mice were sacrificed, and the abdominal and intestinal metastatic nodules were excised, counted, photographed and paraffin embedded. For the lung metastasis model, 200 μL of 1 × 10⁶ luciferase-labelled EBVaGC cells from different groups were directly injected into the tail vein of B-NDG mice, and distant and lung metastasis were evaluated using bioluminescent imaging. After 6 or 8 weeks, the mice were euthanized, and the lungs were embedded in paraffin and subjected to haematoxylin and eosin (H&E) staining to record the micrometastatic nodules using a microscope. All animal experiments were approved by our Institutional Animal Care.

RNA cytidine acetyltransferase (NAT10)

Target Gene

Ovarian cancer [ICD-11: 2C73]

In total 1 item(s) under this disease			Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene			[73]
Responsed Disease	Ovarian cancer [ICD-11: 2C73]
Responsed Drug	Fludarabine	Approved	Drug Info

Serine/threonine-protein kinase SIK2 (SIK2)

Target Gene

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[74]
Responsed Disease	Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation	Up regulation
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	NCI-H1299	Lung large cell carcinoma	Homo sapiens	CVCL_0060
	HCC827	Lung adenocarcinoma	Homo sapiens	CVCL_2063
	NCI-H1975	Lung adenocarcinoma	Homo sapiens	CVCL_1511
In-vivo Model	Male BALB/C nude mice that were four weeks old were acquired from Hunan SJA Experimental Animal Co., Ltd. and then arbitrarily categorized into four groups. These groups included NC (inoculation with A549 cells transfected with si-NC and oe-NC plasmids), si-IGF2BP2 (inoculation with A549 cells transfected with si-IGF2BP2 and oe-NC plasmid), oe-SIK (inoculation with A549 cells transfected with oe-SIK and si-NC plasmid), and si-IGF2BP2+oe-SIK2 (inoculation with A549 cells transfected with si-IGF2BP2 and oe-SIK2 plasmids). Subcutaneous injection of roughly 1 × 10⁶ cells per nude mouse was utilized to establish the xenograft tumor in each group. Every 7 days, tumor volume was assessed using the following formula: 1/2 × length × width2. Tumor weight, on the other hand, was recorded 24 days after inoculation .

Toll-like receptor 2 (TLR2)

Target Gene

Intervertebral disc degeneration [ICD-11: FA80]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[75]
Responsed Disease	Intervertebral disc degeneration [ICD-11: FA80]
In-vivo Model	Rats were anesthetized with 40 mg/kg sodium pentobarbital. A 21G needle was used to puncture discs 7-8 (Co7-8) from the back through the skin of the tail. The length of the needle was predetermined to ensure a puncture depth of approximately 5 mm. After penetrating the annulus, the needle was rotated 360° and held for 31 seconds to injure the annulus. The sham group underwent the same procedure but without puncture injury to the caudal disc.

Unspecific Target Gene

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[76]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Pathway Response	Chemical carcinogenesis - DNA adducts			hsa05204
Cell Process	Malignant transformation
In-vitro Model	BEAS-2B	Normal	Homo sapiens	CVCL_0168
In-vivo Model	Twenty 5-week-old male nude mice were randomly divided into two groups and injected with either 2B-NNK or 2B-C cells. Tumor growth was measured every 3 days.
Response Summary	NNK is a Group 1 human carcinogen, as classified by the International Agency for Research of Cancer (IARC), and plays a significant role in lung carcinogenesis. However IGF2BP1 is involved in the NNK-induced malignant transformation of Beas-2B cells, via m6A modification.

Single episode depressive disorder, severe, without psychotic symptoms [ICD-11: 6A70]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[77]
Responsed Disease	Major depressive disorder [ICD-11: 6A70.3]

Transcription factor AP-2 gamma (TFAP2C)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	A549 cell line	Homo sapiens
Treatment: IGF2BP1 knockout A549 cells Control: Wild type A549 cells		GSE146546
Regulation		logFC: 6.39E-01 p-value: 1.76E-04
More Results	Click to View More RNA-seq Results

Cisplatin [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[15]
Responsed Disease	Testicular cancer		ICD-11: 2C80	Disease Info
Target Regulation	Up regulation
Pathway Response	Nucleotide excision repair			hsa03420
Cell Process	DNA repair
In-vitro Model	TCam-2	Testicular seminoma	Homo sapiens	CVCL_T012
In-vivo Model	Male mice were subcutaneously injected with tumour cells near the limbs to establish xenografts (1 × 10⁶/mouse, 0.2 mL for each injection site; METTL3-overexpressing TCam-2/CDDP cells were inoculated once at the initial time and IGF2BP1-inhibited TCam-2/CDDP cells were inoculated every 3 days).
Response Summary	METTL3 potentiates resistance to cisplatin through m6A modification of Transcription factor AP-2 gamma (TFAP2C) in seminoma. Enhanced stability of TFAP2C mRNA promoted seminoma cell survival under cisplatin treatment burden probably through up-regulation of DNA repair-related genes. IGF2BP1 binds to TFAP2C and enhances TFAP2C mRNA stability.

Myc proto-oncogene protein (MYC)

Target Gene

Cytarabine [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[29]
Responsed Disease	Acute myeloid leukaemia		ICD-11: 2A60	Disease Info
Target Regulation	Up regulation
In-vitro Model	THP-1	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0006
In-vitro Model	Kasumi-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_0589

Gemcitabine [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[31]
Responsed Disease	Pancreatic cancer		ICD-11: 2C10	Disease Info
Target Regulation	Up regulation
In-vitro Model	PANC-1	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0480
In-vitro Model	CFPAC-1	Cystic fibrosis	Homo sapiens	CVCL_1119
In-vivo Model	To evaluate the effect of gemcitabine on the tumor formation ability and gemcitabine/WTAP/MYC axis in vivo, we injected 2×10⁶ PANC1 cells at logarithmic growth phase into the axilla of 4-week-old nude mice for subcutaneous tumor formation. The mice were randomly divided into phosphate buffered saline (PBS) group and gemcitabine treatment group. PBS or gemcitabine was injected into the mice via the abdominal cavity at a concentration of 50 mg/kg once every 5 days. The tumor dimension was measured every 5 days. After 30 days, the tumors were excised and weighed to compare the tumor size and volume, WTAP and MYC mRNA and protein expression was detected by real-time quantitative reverse transcription polymerase chain reaction (qRT-PCR) and immunofluorescence.

BTYNB [Investigative]

In total 1 item(s) under this drug			Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene			[33]
Responsed Disease	Intrahepatic cholangiocarcinoma	ICD-11: 2C12.10	Disease Info

Baculoviral IAP repeat-containing protein 5 (BIRC5)

Target Gene

Cisplatin [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[43]
Responsed Disease	Ovarian cancer		ICD-11: 2C73	Disease Info
Target Regulation	Up regulation
In-vitro Model	SK-OV-3	Ovarian serous cystadenocarcinoma	Homo sapiens	CVCL_0532
In-vitro Model	A2780	Ovarian endometrioid adenocarcinoma	Homo sapiens	CVCL_0134
In-vivo Model	Four weeks old female BALB/c nude mice were purchased from SJA Laboratory Animal Co, Ltd (Changsha, China), and acclimated in a specific pathogen free environment for 1 week. SKOV3/DDP cells treated with shBIRC5, or shBIRC5 combined with pcDNA-IGF2BP1 plasmid (IGF2BP1) or corresponding negative control were suspended in 100 μL McCoy's 5A medium and implanted subcutaneously into the left frank of mice in 1 × 10⁷ cells/mice. After 7 days incubation, three groups of mice received 10 mg/kg cisplatin respectively, sacrificing and tumor collecting after 30 days.

Circ_MAP3K4

Target Gene

Cisplatin [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[47]
Responsed Disease	Hepatocellular carcinoma		ICD-11: 2C12.02	Disease Info
Target Regulation	Up regulation
Pathway Response	Ubiquitin mediated proteolysis			hsa04120
Cell Process	Proteasome pathway degradation
In-vitro Model	Huh-7	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0336
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	PLC/PRF/5	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0485
Response Summary	Driven by m6A modification, Circ_MAP3K4 encoded circMAP3K4-455aa, protected HCC cells from cisplatin exposure, and predicted worse prognosis of HCC patients. IGF2BP1 facilitates circMAP3K4 peptide translation, then the circMAP3K4 peptide inhibits AIF cleavage and nuclear distribution.

RNA cytidine acetyltransferase (NAT10)

Target Gene

Fludarabine [Approved]

In total 1 item(s) under this drug			Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene			[73]
Responsed Disease	Ovarian cancer	ICD-11: 2C73	Disease Info

Click to View Potential Drug Response of This Regulator

Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator

RNA modification

m6A Target: MIR4435-2 host gene (MIR4435-2HG)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00059		Crosstalk Info
Epigenetic Regulator	Nucleolar protein 58 (NOP58)
Regulated Target	rRNA
Crosstalk relationship	m6A → 2'-O-methylation
Disease	Liver cancer	Disease Info

m6A Target: RNA cytidine acetyltransferase (NAT10)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00075		Crosstalk Info
Epigenetic Regulator	RNA cytidine acetyltransferase (NAT10)
Regulated Target	Acyl-CoA thioesterase 7 (ACOT7)
Crosstalk relationship	m6A → ac4C
Disease	Ovarian cancer	Disease Info
Drug	Fludarabine	Drug Info

m6A Target: Myc proto-oncogene protein (MYC)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00228		Crosstalk Info
Epigenetic Regulator	Y-box-binding protein 1 (YBX1)
Regulated Target	Myc proto-oncogene protein (MYC)
Crosstalk relationship	m6A → m5C
Drug	AVI-5126	Drug Info

m6A Target: Mutated in multiple advanced cancers 1 (PTEN)

Target Gene

In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT00409		Crosstalk Info
Epigenetic Regulator	Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target	MicroRNA 21 (MIR21)
Crosstalk relationship	A-to-I → m6A
Crosstalk ID: M6ACROT00410		Crosstalk Info
Epigenetic Regulator	Interferon-inducible protein 4 (ADAR1)
Regulated Target	MicroRNA 21 (MIR21)
Crosstalk relationship	A-to-I → m6A
Crosstalk ID: M6ACROT00446		Crosstalk Info
Epigenetic Regulator	Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target	MicroRNA 214 (MIR214)
Crosstalk relationship	A-to-I → m6A
Crosstalk ID: M6ACROT00510		Crosstalk Info
Epigenetic Regulator	Interferon-inducible protein 4 (ADAR1)
Regulated Target	hsa-mir-18a
Crosstalk relationship	A-to-I → m6A

m6A Target: Insulin-like growth factor 2 (IGF2)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00537		Crosstalk Info
Epigenetic Regulator	Interferon-inducible protein 4 (ADAR1)
Regulated Target	MicroRNA 432 (MIR432)
Crosstalk relationship	A-to-I → m6A

m6A Target: Fascin (FSCN1)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00544		Crosstalk Info
Epigenetic Regulator	Interferon-inducible protein 4 (ADAR1)
Regulated Target	MicroRNA 200b (MIR200B)
Crosstalk relationship	A-to-I → m6A
Crosstalk ID: M6ACROT00545		Crosstalk Info
Epigenetic Regulator	Y-box-binding protein 1 (YBX1)
Regulated Target	MicroRNA 200b (MIR200B)
Crosstalk relationship	m5C → m6A

DNA modification

m6A Target: Myc proto-oncogene protein (MYC)

Target Gene

In total 5 item(s) under this m6A target
Crosstalk ID: M6ACROT02075		Crosstalk Info
Epigenetic Regulator	Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target	Protein tyrosine phosphatase non-receptor type 13 (PTPN13)
Crosstalk relationship	DNA modification → m6A
Disease	Liver cancer	Disease Info
Crosstalk ID: M6ACROT02194		Crosstalk Info
Epigenetic Regulator	Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target	Protein tyrosine phosphatase non-receptor type 13 (PTPN13)
Crosstalk relationship	DNA modification → m6A
Disease	Liver cancer	Disease Info
Crosstalk ID: M6ACROT05864		Crosstalk Info
Epigenetic Regulator	Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target	Long intergenic non-protein coding RNA 261 (LINC00261)
Crosstalk relationship	DNA modification → m6A
Disease	Pancreatic cancer	Disease Info
Crosstalk ID: M6ACROT05865		Crosstalk Info
Epigenetic Regulator	DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target	Long intergenic non-protein coding RNA 261 (LINC00261)
Crosstalk relationship	DNA modification → m6A
Disease	Pancreatic cancer	Disease Info
Crosstalk ID: M6ACROT05866		Crosstalk Info
Epigenetic Regulator	DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target	Long intergenic non-protein coding RNA 261 (LINC00261)
Crosstalk relationship	DNA modification → m6A
Disease	Pancreatic cancer	Disease Info

m6A Target: Phosphoenolpyruvate carboxykinase [GTP], mitochondrial (PCK2)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02115		Crosstalk Info
Epigenetic Regulator	Methylcytosine dioxygenase TET2 (TET2)
Regulated Target	Phosphoenolpyruvate carboxykinase [GTP], mitochondrial (PCK2)
Crosstalk relationship	DNA modification → m6A
Disease	Hepatic inflammation	Disease Info

m6A Target: Thymidine kinase, cytosolic (TK1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02193		Crosstalk Info
Epigenetic Regulator	Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target	Protein tyrosine phosphatase non-receptor type 13 (PTPN13)
Crosstalk relationship	DNA modification → m6A
Disease	Liver cancer	Disease Info

m6A Target: Fascin (FSCN1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02195		Crosstalk Info
Epigenetic Regulator	Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target	Protein tyrosine phosphatase non-receptor type 13 (PTPN13)
Crosstalk relationship	DNA modification → m6A
Disease	Liver cancer	Disease Info

m6A Target: MARCKS-related protein (MARCKSL1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02196		Crosstalk Info
Epigenetic Regulator	Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target	Protein tyrosine phosphatase non-receptor type 13 (PTPN13)
Crosstalk relationship	DNA modification → m6A
Disease	Liver cancer	Disease Info

m6A Target: Leukocyte surface antigen CD47 (CD47)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02197		Crosstalk Info
Epigenetic Regulator	Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target	Protein tyrosine phosphatase non-receptor type 13 (PTPN13)
Crosstalk relationship	DNA modification → m6A
Disease	Liver cancer	Disease Info

m6A Target: Circ_MAP3K4

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02198		Crosstalk Info
Epigenetic Regulator	Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target	Protein tyrosine phosphatase non-receptor type 13 (PTPN13)
Crosstalk relationship	DNA modification → m6A
Disease	Liver cancer	Disease Info
Drug	Cisplatin	Drug Info

m6A Target: Interleukin enhancer-binding factor 3 (ILF3)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02199		Crosstalk Info
Epigenetic Regulator	Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target	Protein tyrosine phosphatase non-receptor type 13 (PTPN13)
Crosstalk relationship	DNA modification → m6A
Disease	Liver cancer	Disease Info

m6A Target: Interleukin-11 (IL11)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02200		Crosstalk Info
Epigenetic Regulator	Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target	Protein tyrosine phosphatase non-receptor type 13 (PTPN13)
Crosstalk relationship	DNA modification → m6A
Disease	Liver cancer	Disease Info

m6A Target: Progestin and adipoQ receptor family member 4 (PAQR4)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02201		Crosstalk Info
Epigenetic Regulator	Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target	Protein tyrosine phosphatase non-receptor type 13 (PTPN13)
Crosstalk relationship	DNA modification → m6A
Disease	Liver cancer	Disease Info

m6A Target: Ephrin type-A receptor 3 (EPHA3)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02202		Crosstalk Info
Epigenetic Regulator	Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target	Protein tyrosine phosphatase non-receptor type 13 (PTPN13)
Crosstalk relationship	DNA modification → m6A
Disease	Liver cancer	Disease Info

Histone modification

m6A Target: Bone morphogenetic protein 2 (BMP2)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03045		Crosstalk Info
Epigenetic Regulator	Lactate dehydrogenase A (LDHA)
Regulated Target	Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship	Histone modification → m6A
Disease	Ossification of spinal ligaments	Disease Info

m6A Target: JmjC domain-containing protein 8 (JMJD8)

Target Gene

In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT03101		Crosstalk Info
Epigenetic Regulator	Histone deacetylase 2 (HDAC2)
Regulated Target	Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship	Histone modification → m6A
Disease	Colorectal cancer	Disease Info
Crosstalk ID: M6ACROT03464		Crosstalk Info
Epigenetic Regulator	Histone deacetylase 1 (HDAC1)
Regulated Target	Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship	Histone modification → m6A
Disease	Colorectal cancer	Disease Info
Crosstalk ID: M6ACROT05853		Crosstalk Info
Epigenetic Regulator	Histone deacetylase 1 (HDAC1)
Regulated Target	Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship	Histone modification → m6A
Disease	Colorectal cancer	Disease Info

m6A Target: Ferroptosis suppressor protein 1 (AIFM2)

Target Gene

In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT03126		Crosstalk Info
Epigenetic Regulator	Histone deacetylase 1 (HDAC1)
Regulated Target	Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship	Histone modification → m6A
Disease	Colorectal cancer	Disease Info
Drug	Vorinostat	Drug Info
Crosstalk ID: M6ACROT05850		Crosstalk Info
Epigenetic Regulator	Histone deacetylase 1 (HDAC1)
Regulated Target	Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship	Histone modification → m6A
Disease	Colorectal cancer	Disease Info
Drug	Vorinostat	Drug Info
Crosstalk ID: M6ACROT06044		Crosstalk Info
Epigenetic Regulator	Histone deacetylase 1 (HDAC1)
Regulated Target	Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship	Histone modification → m6A
Disease	Colorectal cancer	Disease Info
Drug	Trichostatin A	Drug Info
Crosstalk ID: M6ACROT06045		Crosstalk Info
Epigenetic Regulator	Histone deacetylase 1 (HDAC1)
Regulated Target	Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship	Histone modification → m6A
Disease	Colorectal cancer	Disease Info
Drug	Trichostatin A	Drug Info

m6A Target: Myc proto-oncogene protein (MYC)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03155		Crosstalk Info
Epigenetic Regulator	Histone acetyltransferase p300 (P300)
Regulated Target	Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship	Histone modification → m6A
Disease	Intrahepatic cholangiocarcinoma	Disease Info
Crosstalk ID: M6ACROT05863		Crosstalk Info
Epigenetic Regulator	Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target	Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship	Histone modification → m6A
Disease	Pancreatic cancer	Disease Info

m6A Target: Histone-lysine N-methyltransferase EZH2 (EZH2)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03200		Crosstalk Info
Epigenetic Regulator	Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target	Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship	m6A → Histone modification
Disease	Neuroendocrine neoplasms	Disease Info

Non-coding RNA

m6A Target: Myc proto-oncogene protein (MYC)

Target Gene

In total 7 item(s) under this m6A target
Crosstalk ID: M6ACROT05004		Crosstalk Info
Epigenetic Regulator	Long intergenic non-protein coding RNA 261 (LINC00261)
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Pancreatic cancer	Disease Info
Crosstalk ID: M6ACROT05008		Crosstalk Info
Epigenetic Regulator	Neuroblastoma associated transcript 1 (NBAT1)
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Liver cancer	Disease Info
Crosstalk ID: M6ACROT05058		Crosstalk Info
Epigenetic Regulator	Septin 14 pseudogene 20 (SEPTIN14P20/LINC00266-1)
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Crosstalk ID: M6ACROT05172		Crosstalk Info
Epigenetic Regulator	FERM, ARH/RhoGEF and pleckstrin domain protein 1 (FARP1)
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Acute myeloid leukaemia	Disease Info
Drug	Cytarabine	Drug Info
Crosstalk ID: M6ACROT05366		Crosstalk Info
Epigenetic Regulator	KB-1980E6.3
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Breast cancer	Disease Info
Crosstalk ID: M6ACROT05867		Crosstalk Info
Epigenetic Regulator	Long intergenic non-protein coding RNA 261 (LINC00261)
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	m6A → ncRNA
Disease	Pancreatic cancer	Disease Info
Crosstalk ID: M6ACROT05891		Crosstalk Info
Epigenetic Regulator	Testis associated oncogenic lncRNA (THORLNC)
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Nasopharyngeal carcinoma	Disease Info
Drug	Triptonide	Drug Info

m6A Target: C-terminal-binding protein 1 (CTBP1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05005		Crosstalk Info
Epigenetic Regulator	Long intergenic non-protein coding RNA 1426 (LINC01426)
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Clear cell renal cell carcinoma	Disease Info

m6A Target: Hydroxymethylglutaryl-CoA synthase, mitochondrial (HMGCS2)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05192		Crosstalk Info
Epigenetic Regulator	LOC101928222
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Colorectal cancer	Disease Info

m6A Target: E3 ubiquitin-protein ligase synoviolin (SYVN1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05210		Crosstalk Info
Epigenetic Regulator	Small nucleolar RNA host gene 29 (SNHG29)
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Cervical cancer	Disease Info

m6A Target: Frizzled-6 (FZD6)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05302		Crosstalk Info
Epigenetic Regulator	Long intergenic non-protein coding RNA 659 (LINC00659)
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Colorectal cancer	Disease Info

m6A Target: Interleukin enhancer-binding factor 3 (ILF3)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05306		Crosstalk Info
Epigenetic Regulator	ILF3 divergent transcript (ILF3-DT)
Regulated Target	Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship	ncRNA → m6A
Disease	Liver cancer	Disease Info

m6A Target: Translocation protein SEC62 (SEC62)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05313		Crosstalk Info
Epigenetic Regulator	hsa-miR-4429
Regulated Target	Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship	ncRNA → m6A
Disease	Gastric cancer	Disease Info

m6A Target: Ferritin heavy chain (FTH1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05326		Crosstalk Info
Epigenetic Regulator	CACNA1G antisense RNA 1 (CACNA1G-AS1)
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Ovarian cancer	Disease Info

m6A Target: Neurotrophic factor BDNF precursor form (BDNF)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05337		Crosstalk Info
Epigenetic Regulator	SnoRNA-ended lncRNA Enhances pre-Ribosomal RNA Transcription (SLERT)
Regulated Target	Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship	ncRNA → m6A
Disease	Endometrial cancer	Disease Info

m6A Target: Ubiquitin-like modifier-activating enzyme 6 (UBA6)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05340		Crosstalk Info
Epigenetic Regulator	UBA6 divergent transcript (UBA6-DT/UBA6-AS1)
Regulated Target	RNA binding motif protein 15 (RBM15)
Crosstalk relationship	ncRNA → m6A
Disease	Ovarian cancer	Disease Info

m6A Target: Kinesin-like protein KIF3C (KIF3C)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05344		Crosstalk Info
Epigenetic Regulator	hsa-miR-320d
Regulated Target	Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship	ncRNA → m6A
Disease	Prostate cancer	Disease Info

m6A Target: Ephrin type-A receptor 3 (EPHA3)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05361		Crosstalk Info
Epigenetic Regulator	VIM antisense RNA 1 (VIM-AS1)
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Liver cancer	Disease Info

m6A Target: Septin 14 pseudogene 20 (SEPTIN14P20/LINC00266-1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05429		Crosstalk Info
Epigenetic Regulator	Septin 14 pseudogene 20 (SEPTIN14P20/LINC00266-1)
Regulated Target	Septin 14 pseudogene 20 (SEPTIN14P20/LINC00266-1)
Crosstalk relationship	m6A → ncRNA

m6A Target: KB-1980E6.3

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05468		Crosstalk Info
Epigenetic Regulator	KB-1980E6.3
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	m6A → ncRNA
Disease	Breast cancer	Disease Info

m6A Target: Circ_PTPRA

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05581		Crosstalk Info
Epigenetic Regulator	Circ_PTPRA
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	m6A → ncRNA
Disease	Bladder cancer	Disease Info

m6A Target: Circ_MAP3K4

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05588		Crosstalk Info
Epigenetic Regulator	Circ_MAP3K4
Regulated Target	Apoptosis inducing factor mitochondria associated 1 (AIFM1)
Crosstalk relationship	m6A → ncRNA
Disease	Liver cancer	Disease Info
Drug	Cisplatin	Drug Info

m6A Target: UBA6 divergent transcript (UBA6-DT/UBA6-AS1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05592		Crosstalk Info
Epigenetic Regulator	UBA6 divergent transcript (UBA6-DT/UBA6-AS1)
Regulated Target	Ubiquitin-like modifier-activating enzyme 6 (UBA6)
Crosstalk relationship	m6A → ncRNA
Disease	Ovarian cancer	Disease Info

m6A Target: Long intergenic non-protein coding RNA 839 (LINC00839)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05741		Crosstalk Info
Epigenetic Regulator	Long intergenic non-protein coding RNA 839 (LINC00839)
Regulated Target	TATA-box binding protein associated factor 15 (TAF15)
Crosstalk relationship	m6A → ncRNA
Disease	Nasopharyngeal carcinoma	Disease Info

m6A Target: Circ_ASXL1

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05765		Crosstalk Info
Epigenetic Regulator	Circ_ASXL1
Regulated Target	hsa-miR-320d
Crosstalk relationship	m6A → ncRNA
Disease	Ovarian cancer	Disease Info
Crosstalk ID: M6ACROT05897		Crosstalk Info
Epigenetic Regulator	hsa-miR-320d
Regulated Target	Rac GTPase-activating protein 1 (RACGAP1)
Crosstalk relationship	m6A → ncRNA
Disease	Ovarian cancer	Disease Info

m6A Target: hsa-miR-383-5p

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05776		Crosstalk Info
Epigenetic Regulator	hsa-miR-383-5p
Regulated Target	Integrin subunit alpha 3 (ITGA3)
Crosstalk relationship	m6A → ncRNA
Disease	Pancreatic cancer	Disease Info

m6A Target: hepatocellular carcinoma up-regulated long non-coding RNA (HULC)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05778		Crosstalk Info
Epigenetic Regulator	Hepatocellular carcinoma up-regulated long non-coding RNA (HULC)
Regulated Target	Programmed cell death 4 (PDCD4)
Crosstalk relationship	m6A → ncRNA

m6A Target: Prostate cancer associated transcript 6 (PCAT6)

Target Gene

In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT05803		Crosstalk Info
Epigenetic Regulator	Prostate cancer associated transcript 6 (PCAT6)
Regulated Target	MiR-513 family
Crosstalk relationship	m6A → ncRNA
Disease	Glioblastoma	Disease Info
Crosstalk ID: M6ACROT05882		Crosstalk Info
Epigenetic Regulator	MicroRNA 513a-1 (MIR513A1)
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	m6A → ncRNA
Disease	Glioblastoma	Disease Info
Crosstalk ID: M6ACROT05883		Crosstalk Info
Epigenetic Regulator	Prostate cancer associated transcript 6 (PCAT6)
Regulated Target	MiR-513 family
Crosstalk relationship	ncRNA → m6A
Disease	Glioblastoma	Disease Info
Crosstalk ID: M6ACROT05884		Crosstalk Info
Epigenetic Regulator	MicroRNA 513a-1 (MIR513A1)
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Glioblastoma	Disease Info

m6A Target: Zinc finger protein GLI1 (GLI1)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05889		Crosstalk Info
Epigenetic Regulator	Long intergenic non-protein coding RNA 1093 (LINC01093)
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Hepatocellular carcinoma	Disease Info
Crosstalk ID: M6ACROT05893		Crosstalk Info
Epigenetic Regulator	Testis associated oncogenic lncRNA (THORLNC)
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Nasopharyngeal carcinoma	Disease Info
Drug	Triptonide	Drug Info

m6A Target: Insulin-like growth factor 2 (IGF2)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05892		Crosstalk Info
Epigenetic Regulator	Testis associated oncogenic lncRNA (THORLNC)
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Nasopharyngeal carcinoma	Disease Info
Drug	Triptonide	Drug Info

m6A Target: Parkinson disease protein 7 (PARK7)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05899		Crosstalk Info
Epigenetic Regulator	Circ_CMTM3
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Hepatocellular carcinoma	Disease Info

m6A Target: Disintegrin and metalloproteinase domain-containing protein 10 (ADAM10)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05919		Crosstalk Info
Epigenetic Regulator	Circ_MIRLET7BHG
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Allergic rhinitis	Disease Info

m6A Target: Probable ATP-dependent RNA helicase DDX27 (DDX27)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05920		Crosstalk Info
Epigenetic Regulator	Circ_UHRF2
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	ncRNA → m6A
Disease	Colorectal cancer	Disease Info

m6A Target: MIR4435-2 host gene (MIR4435-2HG)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05969		Crosstalk Info
Epigenetic Regulator	MIR4435-2 host gene (MIR4435-2HG)
Regulated Target	Nucleolar protein 58 (NOP58)
Crosstalk relationship	m6A → ncRNA
Disease	Liver cancer	Disease Info

Xenobiotics Compound(s) Regulating the m6A Methylation Regulator

Compound Name	Betaine	Approved
Synonyms	Cystadane Click to Show/Hide
External link	CID: 247 TTD: D0XB8P DrugBank: DB06756
Description	MiR-670-3p functions as the regulator of Igf2bp1 expression and plays a crucial role inparthenogenetic activation development through m6A modification. The treatment with betaine could significantly restore the m6A level.	[78]
Compound Name	PMID34895045-Compound-7773	Investigative
Activity	IC50 = 30.45 uM	[79]

References

Ref 1	RNA-binding protein IGF2BP1 maintains leukemia stem cell properties by regulating HOXB4, MYB, and ALDH1A1. Leukemia. 2020 May;34(5):1354-1363. doi: 10.1038/s41375-019-0656-9. Epub 2019 Nov 25.
Ref 2	YBX1 is required for maintaining myeloid leukemia cell survival by regulating BCL2 stability in an m6A-dependent manner. Blood. 2021 Jul 8;138(1):71-85. doi: 10.1182/blood.2020009676.
Ref 3	Identification of pathology-specific regulators of m(6)A RNA modification to optimize lung cancer management in the context of predictive, preventive, and personalized medicine. EPMA J. 2020 Jul 29;11(3):485-504. doi: 10.1007/s13167-020-00220-3. eCollection 2020 Sep.
Ref 4	The N6-methyladenosine modification enhances ferroptosis resistance through inhibiting SLC7A11 mRNA deadenylation in hepatoblastoma. Clin Transl Med. 2022 May;12(5):e778. doi: 10.1002/ctm2.778.
Ref 5	Recognition of RNA N(6)-methyladenosine by IGF2BP proteins enhances mRNA stability and translation. Nat Cell Biol. 2018 Mar;20(3):285-295. doi: 10.1038/s41556-018-0045-z. Epub 2018 Feb 23.
Ref 6	IGF2BP1 Promotes Proliferation of Neuroendocrine Neoplasms by Post-Transcriptional Enhancement of EZH2. Cancers (Basel). 2022 Apr 24;14(9):2121. doi: 10.3390/cancers14092121.
Ref 7	Long non-coding RNA ILF3-AS1 facilitates hepatocellular carcinoma progression by stabilizing ILF3 mRNA in an m(6)A-dependent manner. Hum Cell. 2021 Nov;34(6):1843-1854. doi: 10.1007/s13577-021-00608-x. Epub 2021 Sep 7.
Ref 8	METTL3/IGF2BP1/CD47 contributes to the sublethal heat treatment induced mesenchymal transition in HCC. Biochem Biophys Res Commun. 2021 Mar 26;546:169-177. doi: 10.1016/j.bbrc.2021.01.085. Epub 2021 Feb 12.
Ref 9	N(6)-methyladenosine (m(6)A) reader IGF2BP1 accelerates gastric cancer aerobic glycolysis in c-Myc-dependent manner. Exp Cell Res. 2022 Aug 1;417(1):113176. doi: 10.1016/j.yexcr.2022.113176. Epub 2022 Apr 27.
Ref 10	A novel hypoxic long noncoding RNA KB-1980E6.3 maintains breast cancer stem cell stemness via interacting with IGF2BP1 to facilitate c-Myc mRNA stability. Oncogene. 2021 Mar;40(9):1609-1627. doi: 10.1038/s41388-020-01638-9. Epub 2021 Jan 19.
Ref 11	METTL3 Promotes Tumorigenesis and Metastasis through BMI1 m(6)A Methylation in Oral Squamous Cell Carcinoma. Mol Ther. 2020 Oct 7;28(10):2177-2190. doi: 10.1016/j.ymthe.2020.06.024. Epub 2020 Jun 24.
Ref 12	IGF2BP1 overexpression stabilizes PEG10 mRNA in an m6A-dependent manner and promotes endometrial cancer progression. Theranostics. 2021 Jan 1;11(3):1100-1114. doi: 10.7150/thno.49345. eCollection 2021.
Ref 13	IGF2BP1 promotes SRF-dependent transcription in cancer in a m6A- and miRNA-dependent manner. Nucleic Acids Res. 2019 Jan 10;47(1):375-390. doi: 10.1093/nar/gky1012.
Ref 14	N6-Methyladenosine Methyltransferase METTL3 Promotes Angiogenesis and Atherosclerosis by Upregulating the JAK2/STAT3 Pathway via m6A Reader IGF2BP1. Front Cell Dev Biol. 2021 Dec 7;9:731810. doi: 10.3389/fcell.2021.731810. eCollection 2021.
Ref 15	METTL3 potentiates resistance to cisplatin through m(6) A modification of TFAP2C in seminoma. J Cell Mol Med. 2020 Oct;24(19):11366-11380. doi: 10.1111/jcmm.15738. Epub 2020 Aug 28.
Ref 16	PADI2-Catalyzed MEK1 Citrullination Activates ERK1/2 and Promotes IGF2BP1-Mediated SOX2 mRNA Stability in Endometrial Cancer. Adv Sci (Weinh). 2021 Jan 29;8(6):2002831. doi: 10.1002/advs.202002831. eCollection 2021 Mar.
Ref 17	MiR-4429 prevented gastric cancer progression through targeting METTL3 to inhibit m(6)A-caused stabilization of SEC62. Biochem Biophys Res Commun. 2019 Oct 1;517(4):581-587. doi: 10.1016/j.bbrc.2019.07.058. Epub 2019 Aug 5.
Ref 18	Long noncoding RNA UBA6-AS1 inhibits the malignancy of ovarian cancer cells via suppressing the decay of UBA6 mRNA. Bioengineered. 2022 Jan;13(1):178-189. doi: 10.1080/21655979.2021.2011640.
Ref 19	Biochemical characterization of TAK-593, a novel VEGFR/PDGFR inhibitor with a two-step slow binding mechanism. Biochemistry. 2011 Feb 8;50(5):738-51. doi: 10.1021/bi101777f. Epub 2011 Jan 10.
Ref 20	The SLC45 gene family of putative sugar transporters. Mol Aspects Med. 2013 Apr-Jun;34(2-3):655-60. doi: 10.1016/j.mam.2012.05.014.
Ref 21	circNDUFB2 inhibits non-small cell lung cancer progression via destabilizing IGF2BPs and activating anti-tumor immunity. Nat Commun. 2021 Jan 12;12(1):295. doi: 10.1038/s41467-020-20527-z.
Ref 22	A Non-ATP-Competitive Dual Inhibitor of JAK2 and BCR-ABL Kinases: Elucidation of a Novel Therapeutic Spectrum Based on Substrate Competitive Inhibition. Genes Cancer. 2010 Apr;1(4):331-45. doi: 10.1177/1947601910371337.
Ref 23	Symbiopolyol, a VCAM-1 inhibitor from a symbiotic dinoflagellate of the jellyfish Mastigias papua. J Nat Prod. 2010 Jul 23;73(7):1318-22. doi: 10.1021/np100221k.
Ref 24	The pharmacogenetics of methotrexate. Rheumatology (Oxford). 2007 Oct;46(10):1520-4. doi: 10.1093/rheumatology/kem147. Epub 2007 Jun 24.
Ref 25	The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42. doi: 10.1093/nar/28.1.235.
Ref 26	Clinical pipeline report, company report or official report of Gan & Lee Pharmaceuticals.
Ref 27	METTL3-mediated m6A modification of KIF3C-mRNA promotes prostate cancer progression and is negatively regulated by miR-320d. Aging (Albany NY). 2021 Sep 19;13(18):22332-22344. doi: 10.18632/aging.203541. Epub 2021 Sep 19.
Ref 28	Pharmacological inhibitors of cyclin-dependent kinases. Trends Pharmacol Sci. 2002 Sep;23(9):417-25. doi: 10.1016/s0165-6147(02)02071-0.
Ref 29	Selective inhibition of methoxyflavonoids on human CYP1B1 activity. Bioorg Med Chem. 2010 Sep 1;18(17):6310-5. doi: 10.1016/j.bmc.2010.07.020. Epub 2010 Jul 13.
Ref 30	Human CYP1B1 and anticancer agent metabolism: mechanism for tumor-specific drug inactivation?. J Pharmacol Exp Ther. 2001 Feb;296(2):537-41.
Ref 31	A patent review on PD-1/PD-L1 antagonists: small molecules, peptides, and macrocycles (2015-2018). Expert Opin Ther Pat. 2018 Sep;28(9):665-678. doi: 10.1080/13543776.2018.1512706. Epub 2018 Sep 10.
Ref 32	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1815).
Ref 33	ClinicalTrials.gov (NCT03500991) HER2-specific CAR T Cell Locoregional Immunotherapy for HER2-positive Recurrent/Refractory Pediatric CNS Tumors
Ref 34	Current status of COX-2 inhibitors. Mini Rev Med Chem. 2008 Jan;8(1):73-90. doi: 10.2174/138955708783331577.
Ref 35	Clinical pipeline report, company report or official report of Exelixis.
Ref 36	Conversion of highly malignant colon cancer from an aggressive to a controlled disease by oral administration of a metalloproteinase inhibitor. Clin Exp Metastasis. 1997 Mar;15(2):184-95. doi: 10.1023/a:1018461112732.
Ref 37	Metformin/Repaglinide (PrandiMet) for type 2 diabetes. Med Lett Drugs Ther. 2009 Jun 1;51(1313):41-3.
Ref 38	Purification and properties of 5,10-methylenetetrahydrofolate reductase, an iron-sulfur flavoprotein from Clostridium formicoaceticum. J Biol Chem. 1984 Sep 10;259(17):10845-9.
Ref 39	Synthesis and biological evaluation of substrate-based inhibitors of 6-phosphogluconate dehydrogenase as potential drugs against African trypanosomiasis. Bioorg Med Chem. 2003 Jul 17;11(14):3205-14. doi: 10.1016/s0968-0896(03)00191-3.
Ref 40	National Cancer Institute Drug Dictionary (drug name INCB086550).
Ref 41	Inhibition of IKappaB phosphorylation prevents load-induced cardiac dysfunction in mice. Am J Physiol Heart Circ Physiol. 2012 Dec 15;303(12):H1435-45. doi: 10.1152/ajpheart.00290.2012. Epub 2012 Oct 5.
Ref 42	Grapefruit juice-drug interactions: Grapefruit juice and its components inhibit P-glycoprotein (ABCB1) mediated transport of talinolol in Caco-2 cells. J Pharm Sci. 2007 Oct;96(10):2808-17. doi: 10.1002/jps.20975.
Ref 43	Clinical pipeline report, company report or official report of Daiichi Sankyo.
Ref 44	J Clin Oncol 32:5s, 2014 (suppl; abstr 2507).
Ref 45	Bintrafusp Alfa, a Bifunctional Fusion Protein Targeting TGF-Beta and PD-L1, in Second-Line Treatment of Patients With NSCLC: Results From an Expansion Cohort of a Phase 1 Trial. J Thorac Oncol. 2020 Jul;15(7):1210-1222. doi: 10.1016/j.jtho.2020.03.003. Epub 2020 Mar 13.
Ref 46	Identification of small molecule inhibitors of Jumonji AT-rich interactive domain 1B (JARID1B) histone demethylase by a sensitive high throughput screen. J Biol Chem. 2013 Mar 29;288(13):9408-17. doi: 10.1074/jbc.M112.419861. Epub 2013 Feb 13.
Ref 47	A novel peptide encoded by N6-methyladenosine modified circMAP3K4 prevents apoptosis in hepatocellular carcinoma. Mol Cancer. 2022 Apr 2;21(1):93. doi: 10.1186/s12943-022-01537-5.
Ref 48	CircPTPRA blocks the recognition of RNA N(6)-methyladenosine through interacting with IGF2BP1 to suppress bladder cancer progression. Mol Cancer. 2021 Apr 14;20(1):68. doi: 10.1186/s12943-021-01359-x.
Ref 49	The selective intravenous inhibitor of the MET tyrosine kinase SAR125844 inhibits tumor growth in MET-amplified cancer. Mol Cancer Ther. 2015 Feb;14(2):384-94. doi: 10.1158/1535-7163.MCT-14-0428. Epub 2014 Dec 10.
Ref 50	Phase I and Pharmacokinetic Studies of CYT-6091, a Novel PEGylated Colloidal Gold-rhTNF Nanomedicine. Clin Cancer Res. 2010 December 15; 16(24): 6139-6149.
Ref 51	Clinical pipeline report, company report or official report of Silicon Therapeutics.
Ref 52	Clinical pipeline report, company report or official report of ProNAi.
Ref 53	Development of new agents for peripheral T-cell lymphoma. Expert Opin Biol Ther. 2019 Mar;19(3):197-209. doi: 10.1080/14712598.2019.1572746. Epub 2019 Jan 29.
Ref 54	Active immunotherapy in HER2 overexpressing breast cancer: current status and future perspectives. Ann Oncol. 2013 Jul;24(7):1740-1748. doi: 10.1093/annonc/mdt133. Epub 2013 Apr 12.
Ref 55	ClinicalTrials.gov (NCT02547961) Chimeric Antigen Receptor-Modified T Cells for Breast Cancer
Ref 56	Characterization of enzymes participating in carbonyl reduction of 4-methylnitrosamino-1-(3-pyridyl)-1-butanone (NNK) in human placenta. Chem Biol Interact. 2001 Jan 30;130-132(1-3):737-48. doi: 10.1016/s0009-2797(00)00304-5.
Ref 57	ClinicalTrials.gov (NCT03403777) Avelumab in Refractory Testicular Germ Cell Cancer.. U.S. National Institutes of Health.
Ref 58	Phase I dose escalation study of ASP8273, a mutant-selective irreversible EGFR inhibitor, in subjects with EGFR mutation positive NSCLC, Journal of Clinical Oncology, Vol 33, No 15_suppl (May 20 Supplement), 2015: 8083.
Ref 59	Clinical pipeline report, company report or official report of I-MAB Biopharma.
Ref 60	AMXI-5001, a novel dual parp1/2 and microtubule polymerization inhibitor for the treatment of human cancers. Am J Cancer Res. 2020 Aug 1;10(8):2649-2676. eCollection 2020.
Ref 61	Substrate affinity of photosensitizers derived from chlorophyll-a: the ABCG2 transporter affects the phototoxic response of side population stem cell-like cancer cells to photodynamic therapy. Mol Pharm. 2010 Oct 4;7(5):1789-804.
Ref 62	Clinical pipeline report, company report or official report of AbbVie.
Ref 63	Contribution of human hepatic cytochrome P450s and steroidogenic CYP17 to the N-demethylation of aminopyrine. Xenobiotica. 1999 Feb;29(2):187-93. doi: 10.1080/004982599238731.
Ref 64	Thalidomide and thalidomide analogues for maintenance of remission in Crohn's disease. Cochrane Database Syst Rev. 2009 Apr 15;2009(2):CD007351. doi: 10.1002/14651858.CD007351.pub2.
Ref 65	Urinary and serum octopamine in patients with portal-systemic encephalopathy. Lancet. 1975 Nov 15;2(7942):943-6. doi: 10.1016/s0140-6736(75)90359-1.
Ref 66	The xenobiotic inhibitor profile of cytochrome P4502C8. Br J Clin Pharmacol. 2000 Dec;50(6):573-80. doi: 10.1046/j.1365-2125.2000.00316.x.
Ref 67	ClinicalTrials.gov (NCT01686334) Efficacy Study of Dendritic Cell Vaccination in Patients With Acute Myeloid Leukemia in Remission. U.S. National Institutes of Health.
Ref 68	AZD3514: a small molecule that modulates androgen receptor signaling and function in vitro and in vivo. Mol Cancer Ther. 2013 Sep;12(9):1715-27. doi: 10.1158/1535-7163.MCT-12-1174. Epub 2013 Jul 16.
Ref 69	The prokinetic cinitapride has no clinically relevant pharmacokinetic interaction and effect on QT during coadministration with ketoconazole. Drug Metab Dispos. 2007 Jul;35(7):1149-56. doi: 10.1124/dmd.106.010835. Epub 2007 Apr 16.
Ref 70	Trichomonas vaginalis thymidine kinase: purification, characterization and search for inhibitors. Biochem J. 1998 Aug 15;334 ( Pt 1)(Pt 1):15-22. doi: 10.1042/bj3340015.
Ref 71	Design, synthesis, and structure-activity relationships of macrocyclic hydroxamic acids that inhibit tumor necrosis factor alpha release in vitro and in vivo. J Med Chem. 2001 Aug 2;44(16):2636-60. doi: 10.1021/jm010127e.
Ref 72	Decrease of cyclin D1 in the human lung adenocarcinoma cell line A-427 by 7-hydroxycoumarin. Lung Cancer. 2001 Nov;34(2):185-94. doi: 10.1016/s0169-5002(01)00263-x.
Ref 73	2008 FDA drug approvals. Nat Rev Drug Discov. 2009 Feb;8(2):93-6. doi: 10.1038/nrd2813.
Ref 74	CYP2C8/9 mediate dapsone N-hydroxylation at clinical concentrations of dapsone. Drug Metab Dispos. 2000 Aug;28(8):865-8.
Ref 75	Interaction of nilotinib, dasatinib and bosutinib with ABCB1 and ABCG2: implications for altered anti-cancer effects and pharmacological properties. Br J Pharmacol. 2009 Oct;158(4):1153-64. doi: 10.1111/j.1476-5381.2009.00383.x. Epub 2009 Sep 28.
Ref 76	Involvement of m6A regulatory factor IGF2BP1 in malignant transformation of human bronchial epithelial Beas-2B cells induced by tobacco carcinogen NNK. Toxicol Appl Pharmacol. 2022 Feb 1;436:115849. doi: 10.1016/j.taap.2021.115849. Epub 2021 Dec 30.
Ref 77	Functional characterization of sodium-dependent multivitamin transporter in MDCK-MDR1 cells and its utilization as a target for drug delivery. Mol Pharm. 2006 May-Jun;3(3):329-39. doi: 10.1021/mp0500768.
Ref 78	microRNA-670 modulates Igf2bp1 expression to regulate RNA methylation in parthenogenetic mouse embryonic development. Sci Rep. 2020 Mar 16;10(1):4782. doi: 10.1038/s41598-020-61816-3.
Ref 79	Small molecule inhibitor of Igf2bp1 represses Kras and a pro-oncogenic phenotype in cancer cells. RNA Biol. 2022;19(1):26-43. doi: 10.1080/15476286.2021.2010983. Epub 2021 Dec 31.

m6A Regulator Information

Cite M6AREG

Correspondence

Prof. Feng ZHU

Prof. Shuiping Liu

Visitor Map