m6A Regulator Information

General Information of the m6A Regulator (ID: REG00009)

Regulator Name	Wilms tumor 1-associating protein (WTAP)
Synonyms	Female-lethal(2)D homolog; hFL(2)D; WT1-associated protein; Pre-mRNA-splicing regulator WTAP; KIAA0105 Click to Show/Hide
Gene Name	WTAP
Sequence	MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEE KLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLF FLKMKGELEQTKDKLEQAQNELSAWKFTPDSQTGKKLMAKCRMLIQENQELGRQLSQGRI AQLEAELALQKKYSEELKSSQDELNDFIIQLDEEVEGMQSTILVLQQQLKETRQQLAQYQ QQQSQASAPSTSRTTASEPVEQSEATSKDCSRLTNGPSNGSSSRQRTSGSGFHREGNTTE DDFPSSPGNGNKSSNSSEERTGRGGSGYVNQLSAGYESVDSPTGSENSLTHQSNDTDSSH DPQEEKAVSGKGNRTVGSRHVQNGLDSSVNVQGSVL Click to Show/Hide
Family	fl(2)d family
Function	Associated component of the WMM complex, a complex that mediates N6-methyladenosine (m6A) methylation of RNAs, a modification that plays a role in the efficiency of mRNA splicing and RNA processing . Required for accumulation of METTL3 and METTL14 to nuclear speckle. Acts as a mRNA splicing regulator. Regulates G2/M cell-cycle transition by binding to the 3' UTR of CCNA2, which enhances its stability. Impairs WT1 DNA-binding ability and inhibits expression of WT1 target genes. Click to Show/Hide
Gene ID	9589
Uniprot ID	FL2D_HUMAN
Regulator Type	WRITER ERASER READER
Mechanism Diagram	Click to View the Original Diagram

Target Genes	Click to View Potential Target Genes of This Regulator

Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)

WTAP can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.

Browse Target Gene related Disease

Browse Target Gene related Drug

Alpha-enolase (ENO1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	Human umbilical vein endothelial cells	Homo sapiens
Treatment: siWTAP HUVECs Control: siControl HUVECs		GSE167067
Regulation		logFC: -6.99E-01 p-value: 1.98E-02
More Results	Click to View More RNA-seq Results

Breast cancer [ICD-11: 2C60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[1]
Responsed Disease	Breast cancer [ICD-11: 2C60]
Target Regulation	Up regulation
Pathway Response	Glycolysis / Gluconeogenesis			hsa00010
Cell Process	Glycolysis
In-vitro Model	MDA-MB-231	Breast adenocarcinoma	Homo sapiens	CVCL_0062
	MCF-7	Invasive breast carcinoma	Homo sapiens	CVCL_0031
	HEK293T	Normal	Homo sapiens	CVCL_0063
In-vivo Model	A total of 1 × 10⁶ luciferase-labeled BC cells transfected with shWTAP or shNC were injected subcutaneously with or without C5aR1 neutrophils (tumor cells:neutrophils, 10:1).
Response Summary	The stabilization of WTAP further promotes RNA m6A methylation of Alpha-enolase (ENO1), impacting the glycolytic activity of BC cells.

AMPK subunit alpha-1 (AMPK/PRKAA1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mice hepatocyte	Mus musculus
Treatment: Wtap Hknockout mice hepatocyte Control: Wtap flox/flox mice hepatocyte		GSE168850
Regulation		logFC: 6.89E-01 p-value: 3.35E-03
More Results	Click to View More RNA-seq Results

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[2]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Up regulation
Pathway Response	AMPK signaling pathway			hsa04152
Pathway Response	Autophagy			hsa04140
Cell Process	Cell autophagy
In-vitro Model	BEL-7402	Endocervical adenocarcinoma	Homo sapiens	CVCL_5492
	BEL-7404	Endocervical adenocarcinoma	Homo sapiens	CVCL_6568
	HEK293T	Normal	Homo sapiens	CVCL_0063
	L-02	Endocervical adenocarcinoma	Homo sapiens	CVCL_6926
	SMMC-7721	Endocervical adenocarcinoma	Homo sapiens	CVCL_0534
Response Summary	WTAP/LKB1/AMPK subunit alpha-1 (AMPK/PRKAA1) axis in hepatocellular carcinoma cells acted as a key regulator, linking m6A with autophagy. WTAP-mediated m6A modification plays an important role in the regulation of autophagy in hepatocellular carcinoma cells, which provides a promising target for the treatment of hepatocellular carcinoma.

Caveolin-1 (CAV1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mice hepatocyte	Mus musculus
Treatment: Wtap Hknockout mice hepatocyte Control: Wtap flox/flox mice hepatocyte		GSE168850
Regulation		logFC: 6.32E-01 p-value: 2.97E-02
More Results	Click to View More RNA-seq Results

Endometrial cancer [ICD-11: 2C76]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Endometrial cancer [ICD-11: 2C76]
Target Regulation	Down regulation
Pathway Response	NF-kappa B signaling pathway			hsa04064
Cell Process	Cell proliferation
	Cell migration
	Cell invasion
	Cell apoptosis
In-vitro Model	Ishikawa	Endometrial adenocarcinoma	Homo sapiens	CVCL_2529
	HEC-1-A	Endometrial adenocarcinoma	Homo sapiens	CVCL_0293
Response Summary	WTAP could methylate 3'-UTR of Caveolin-1 (CAV1) and downregulate CAV-1 expression to activate NF-Kappa-B signaling pathway in EC, which promoted EC progression.

Cyclic AMP-dependent transcription factor ATF-4 (ATF4)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mice hepatocyte	Mus musculus
Treatment: Wtap Hknockout mice hepatocyte Control: Wtap flox/flox mice hepatocyte		GSE168850
Regulation		logFC: 7.14E-01 p-value: 2.43E-02
More Results	Click to View More RNA-seq Results

Acute myocardial infarction [ICD-11: BA41]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[4]
Responsed Disease	Acute myocardial infarction [ICD-11: BA41]
Target Regulation	Up regulation
Cell Process	Endoplasmic reticulum stress
	Cell apoptosis
In-vitro Model	AC16 [Human hybrid cardiomyocyte]	Normal	Homo sapiens	CVCL_4U18
In-vivo Model	Left anterior descending coronary artery (LAD) was ligated for 20 minutes, followed by 48 h reperfusion. Controls underwent same procedures except LAD ligation. WTAP shRNA vector or its negative control (shNC) was injected into the left ventricular anterior wall 24 h before I/R. A pressure volume catheter was used for cardiac function assay.
Response Summary	Myocardial infarction (MI) is one of the leading causes of death. WTAP promoted myocardial I/R injury through promoting ER stress and cell apoptosis by regulating m6A modification of Cyclic AMP-dependent transcription factor ATF-4 (ATF4) mRNA. H/R effects on ER stress and apoptosis were all blocked by silencing of WTAP, promoted by WTAP overexpression, and ameliorated by administration of ER stress inhibitor, 4-PBA.

Dual specificity protein phosphatase 6 (DUSP6)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mouse embryonic stem cells	Mus musculus
Treatment: WTAP-/- ESCs Control: Wild type ESCs		GSE145309
Regulation		logFC: -6.99E-01 p-value: 7.61E-15
More Results	Click to View More RNA-seq Results

Malignant haematopoietic neoplasm [ICD-11: 2B33]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Malignant haematopoietic neoplasm [ICD-11: 2B33]
Responsed Drug	Cisplatin		Approved	Drug Info
Target Regulation	Up regulation
Cell Process	Cell apoptosis
In-vitro Model	Normal NK cells (CD3-negative lymphocytes)
	SNK-6	Nasal type extranodal NK/T-cell lymphoma	Homo sapiens	CVCL_A673
	YTS	Lymphoblastic leukemia/lymphoma	Homo sapiens	CVCL_D324
Response Summary	m6A methyltransferase Wilms' tumor 1-associated protein facilitates cell proliferation and cisplatin resistance in NK/T cell lymphoma by regulating dual-specificity phosphatases 6 expression via m6A RNA methylation. WTAP enhanced Dual specificity protein phosphatase 6 (DUSP6) expression by increasing m6A levels of DUSP6 mRNA transcript, leading to oncogenic functions in NKTCL.

Focal adhesion kinase 1 (Fak)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mouse embryonic stem cells	Mus musculus
Treatment: WTAP-/- ESCs Control: Wild type ESCs		GSE145309
Regulation		logFC: 5.98E-01 p-value: 1.29E-24
More Results	Click to View More RNA-seq Results

Pancreatic cancer [ICD-11: 2C10]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[6]
Responsed Disease	Pancreatic cancer [ICD-11: 2C10]
Responsed Drug	Gemcitabine		Approved	Drug Info
Target Regulation	Up regulation
Pathway Response	PI3K-Akt signaling pathway			hsa04151
Cell Process	RNA stability
In-vitro Model	T3M-4	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_4056
	PANC-1	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0480
	MIA PaCa-2	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0428
	hTERT-HPNE	Normal	Homo sapiens	CVCL_C466
	HPDE6c7	Normal	Homo sapiens	CVCL_0P38
	BxPC-3	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0186
	AsPC-1	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0152
In-vivo Model	Twenty-four female BALB/c athymic nude mice, which were 4-6 weeks old and weighed 20.0-25.0 g, were obtained from the Animal Research Center of PUMCH. WTAP-OE, WTAP-NC, shWTAP and shNC-lentivirus infected MIA PaCa-2 cells (5 × 10⁶) were suspended in 50 uL PBS and then injected subcapsularly into the pancreatic tissue by 1-mL syringes.
Response Summary	WTAP could promote migration/invasion and suppress chemo-sensitivity to gemcitabine in PC. Further mechanical investigation revealed that WTAP could bind to and stabilize Focal adhesion kinase 1 (Fak) mRNA which in turn activated the Fak-PI3K-AKT and Fak-Src-GRB2-Erk1/2 signaling pathways.

Forkhead box protein M1 (FOXM1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mouse embryonic stem cells	Mus musculus
Treatment: WTAP-/- ESCs Control: Wild type ESCs		GSE145309
Regulation		logFC: -9.85E-01 p-value: 1.39E-67
More Results	Click to View More RNA-seq Results

Osteosarcoma [ICD-11: 2B51]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[7]
Responsed Disease	Osteosarcoma [ICD-11: 2B51]
Target Regulation	Up regulation
In-vitro Model	SaOS-2	Osteosarcoma	Homo sapiens	CVCL_0548
	MG-63	Osteosarcoma	Homo sapiens	CVCL_0426
	hFOB 1.19	Normal	Homo sapiens	CVCL_3708
In-vivo Model	In vivo animal assay, FOXD2-AS1 overexpression promoted the tumor growth in mice subcutaneous injection.
Response Summary	A remarkable m6A-modified site was found on the 3'-UTR of FOXD2-AS1, and m6A methyltransferase WTAP promoted the methylation modification, thus enhancing the stability of FOXD2-AS1 transcripts. m6A-modified FOXD2-AS1 accelerates the osteosarcoma progression through m6A manner, which provides new concepts for osteosarcoma tumorigenesis. FOXD2-AS1 interacted with downstream target FOXM1 mRNA through m6A sites, forming a FOXD2-AS1/m6A/Forkhead box protein M1 (FOXM1) complex to heighten FOXM1 mRNA stability.

Hepatocyte growth factor receptor (c-Met/MET)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mouse embryonic stem cells	Mus musculus
Treatment: WTAP-/- ESCs Control: Wild type ESCs		GSE145309
Regulation		logFC: -2.39E+00 p-value: 1.81E-38
More Results	Click to View More RNA-seq Results

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[8]
Responsed Disease	Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug	Crizotinib		Approved	Drug Info
Target Regulation	Up regulation
Pathway Response	EGFR tyrosine kinase inhibitor resistance			hsa01521
In-vitro Model	HCC827	Lung adenocarcinoma	Homo sapiens	CVCL_2063
	NCI-H661	Lung large cell carcinoma	Homo sapiens	CVCL_1577
	NCI-H596	Lung adenosquamous carcinoma	Homo sapiens	CVCL_1571
	NCI-H460	Lung large cell carcinoma	Homo sapiens	CVCL_0459
	NCI-H358	Minimally invasive lung adenocarcinoma	Homo sapiens	CVCL_1559
	NCI-H292	Lung mucoepidermoid carcinoma	Homo sapiens	CVCL_0455
	NCI-H1975	Lung adenocarcinoma	Homo sapiens	CVCL_1511
	NCI-H1650	Minimally invasive lung adenocarcinoma	Homo sapiens	CVCL_1483
	NCI-H1395	Lung adenocarcinoma	Homo sapiens	CVCL_1467
	EBC-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_2891
	Calu-3	Lung adenocarcinoma	Homo sapiens	CVCL_0609
	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
In-vivo Model	HCC827 (3×10⁶) cells suspended in 100 uL of PBS were injected into the left inguen of female Balb/c nude mice (body weight 18-20 g; age 6 weeks; Beijing Huafukang Bioscience Co., Inc.). When the tumor volumes reached 50-100 mm³ on the 10th posttransplantation day, the mice were randomized into four groups (10 mice per group) and were intragastrically administered vehicle (normal saline), crizotinib (25 mg/kg body weight), chidamide (5 mg/kg), or the combination of the two drugs daily for 21 days. The tumor volumes and body weights of the mice were measured every 3 days.
Response Summary	Chidamide could decrease Hepatocyte growth factor receptor (c-Met/MET) expression by inhibiting mRNA N6-methyladenosine (m6A) modification through the downregulation of METTL3 and WTAP expression, subsequently increasing the crizotinib sensitivity of NSCLC cells in a c-MET-/HGF-dependent manner.

Hexokinase-2 (HK2)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mouse embryonic stem cells	Mus musculus
Treatment: WTAP-/- ESCs Control: Wild type ESCs		GSE145309
Regulation		logFC: -8.37E-01 p-value: 2.23E-65
More Results	Click to View More RNA-seq Results

Gastric cancer [ICD-11: 2B72]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[9]
Responsed Disease	Gastric cancer [ICD-11: 2B72]
Target Regulation	Up regulation
Pathway Response	Glycolysis / Gluconeogenesis			hsa00010
Cell Process	Glycolysis
In-vitro Model	SGC-7901	Gastric carcinoma	Homo sapiens	CVCL_0520
	MGC-803	Gastric mucinous adenocarcinoma	Homo sapiens	CVCL_5334
	GES-1	Normal	Homo sapiens	CVCL_EQ22
	BGC-823	Gastric carcinoma	Homo sapiens	CVCL_3360
	AGS	Gastric adenocarcinoma	Homo sapiens	CVCL_0139
Response Summary	Oncogenic role of WTAP and its m6A-mediated regulation on gastric cancer Warburg effect, providing a novel approach and therapeutic target in gastric cancer. WTAP enhanced the stability of Hexokinase-2 (HK2) mRNA through binding with the 3'-UTR m6A site.

Diffuse large B-cell lymphomas [ICD-11: 2A81]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[24]
Responsed Disease	Diffuse large B-cell lymphomas [ICD-11: 2A81]
In-vitro Model	SU-DHL-8	Diffuse large B-cell lymphoma germinal center B-cell type	Homo sapiens	CVCL_2207

LIM and SH3 domain protein 1 (LASP1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mice hepatocyte	Mus musculus
Treatment: Wtap Hknockout mice hepatocyte Control: Wtap flox/flox mice hepatocyte		GSE168850
Regulation		logFC: 9.34E-01 p-value: 1.43E-03
More Results	Click to View More RNA-seq Results

Nasopharyngeal carcinoma [ICD-11: 2B6B]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[10]
Responsed Disease	Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation	Up regulation
Response Summary	WTAP-mediated m6A modification of LIM and SH3 domain protein 1 (LASP1) enhanced its stability relying on the m6A reader IGF2BP2-dependent pathway. Furthermore, DIAPH1-AS1 acted as a molecular adaptor that promoted MTDH-LASP1 complex formation and upregulated LASP1 expression, ultimately facilitating NPC growth and metastasis.

Myc proto-oncogene protein (MYC)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mice hepatocyte	Mus musculus
Treatment: Wtap Hknockout mice hepatocyte Control: Wtap flox/flox mice hepatocyte		GSE168850
Regulation		logFC: 2.89E+00 p-value: 1.82E-04
More Results	Click to View More RNA-seq Results

Acute myeloid leukaemia [ICD-11: 2A60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[11]
Responsed Disease	Acute myeloid leukaemia [ICD-11: 2A60]
Responsed Drug	Daunorubicin		Approved	Drug Info
Target Regulation	Up regulation
Cell Process	Cell cycle
	Cell proliferation
	Cell apoptosis
In-vitro Model	K-562	Chronic myelogenous leukemia	Homo sapiens	CVCL_0004
	MV4-11	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0064
Response Summary	WTAP made acute myeloid leukemia cells resistant to daunorubicin. In further investigations, m6A methylation level was downregulated when knocking down WTAP, and Myc proto-oncogene protein (MYC) was upregulated due to the decreased m6A methylation of MYC mRNA.

Pancreatic cancer [ICD-11: 2C10]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[27]
Responsed Disease	Pancreatic cancer [ICD-11: 2C10]
Responsed Drug	Gemcitabine		Approved	Drug Info
Target Regulation	Up regulation
In-vitro Model	PANC-1	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0480
In-vitro Model	CFPAC-1	Cystic fibrosis	Homo sapiens	CVCL_1119
In-vivo Model	To evaluate the effect of gemcitabine on the tumor formation ability and gemcitabine/WTAP/MYC axis in vivo, we injected 2×10⁶ PANC1 cells at logarithmic growth phase into the axilla of 4-week-old nude mice for subcutaneous tumor formation. The mice were randomly divided into phosphate buffered saline (PBS) group and gemcitabine treatment group. PBS or gemcitabine was injected into the mice via the abdominal cavity at a concentration of 50 mg/kg once every 5 days. The tumor dimension was measured every 5 days. After 30 days, the tumors were excised and weighed to compare the tumor size and volume, WTAP and MYC mRNA and protein expression was detected by real-time quantitative reverse transcription polymerase chain reaction (qRT-PCR) and immunofluorescence.

Nuclear factor NF-kappa-B p105 subunit (NF-Kappa-B/NFKB1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mice hepatocyte	Mus musculus
Treatment: Wtap Hknockout mice hepatocyte Control: Wtap flox/flox mice hepatocyte		GSE168850
Regulation		logFC: 9.05E-01 p-value: 1.07E-04
More Results	Click to View More RNA-seq Results

Endometrial cancer [ICD-11: 2C76]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Endometrial cancer [ICD-11: 2C76]
Pathway Response	NF-kappa B signaling pathway			hsa04064
	Apoptosis			hsa04210
Cell Process	Cell proliferation
	Cell migration
	Cell invasion
	Cell apoptosis
In-vitro Model	Ishikawa	Endometrial adenocarcinoma	Homo sapiens	CVCL_2529
	HEC-1-A	Endometrial adenocarcinoma	Homo sapiens	CVCL_0293
Response Summary	WTAP could methylate 3'-UTR of CAV-1 and downregulate CAV-1 expression to activate Nuclear factor NF-kappa-B p105 subunit (NF-Kappa-B/NFKB1) signaling pathway in EC, which promoted EC progression.

PI3-kinase subunit beta (PIK3CB)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mice hepatocyte	Mus musculus
Treatment: Wtap Hknockout mice hepatocyte Control: Wtap flox/flox mice hepatocyte		GSE168850
Regulation		logFC: 5.88E-01 p-value: 1.20E-03
More Results	Click to View More RNA-seq Results

Pancreatic cancer [ICD-11: 2C10]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[12]
Responsed Disease	Pancreatic cancer [ICD-11: 2C10]
Responsed Drug	AZD6482		Terminated	Drug Info
Target Regulation	Up regulation
Pathway Response	PI3K-Akt signaling pathway			hsa04151
	Glycolysis / Gluconeogenesis			hsa00010
Cell Process	Glucose metabolism
In-vitro Model	BxPC-3	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0186
	PANC-1	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0480
In-vivo Model	Established cohorts of mice bearing tumour xenografts driven by PTEN-deficient BxPC-3 and PANC-1 cells with PIK3CB overexpression. When tumours grew to ~300 mm³, mice were grouped and administered with vehicle (DMSO) or KIN-193 via intraperitoneal injection (20 mg/kg) once daily.
Response Summary	N6-methyladenosine mRNA methylation of PIK3CB regulates AKT signalling to promote PTEN-deficient pancreatic cancer progression. Rs142933486 is significantly associated with the overall survival of PDAC by reducing the PIK3CB m6A level, which facilitated its mRNA and protein expression levels mediated by the m6A 'writer' complex (METTL13/METTL14/WTAP) and the m6A 'reader' YTHDF2. KIN-193, a PI3-kinase subunit beta (PIK3CB)-selective inhibitor, is shown to serve as an effective anticancer agent for blocking PTEN-deficient PDAC.

Protein C-ets-1 (ETS1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mice hepatocyte	Mus musculus
Treatment: Wtap Hknockout mice hepatocyte Control: Wtap flox/flox mice hepatocyte		GSE168850
Regulation		logFC: 1.11E+00 p-value: 3.10E-03
More Results	Click to View More RNA-seq Results

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[13]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Down regulation
Pathway Response	Cell cycle			hsa04110
Cell Process	Cell proliferation and tumor growth
	Cell apoptosis
	Arrest cell cycle at G2/M phase
In-vitro Model	HCCLM3	Adult hepatocellular carcinoma	Homo sapiens	CVCL_6832
	Hep 3B2.1-7	Childhood hepatocellular carcinoma	Homo sapiens	CVCL_0326
	Huh-7	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0336
	MHCC97-H	Adult hepatocellular carcinoma	Homo sapiens	CVCL_4972
	PLC/PRF/5	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0485
	QSG-7701	Endocervical adenocarcinoma	Homo sapiens	CVCL_6944
	SMMC-7721	Endocervical adenocarcinoma	Homo sapiens	CVCL_0534
In-vivo Model	3 × 10⁶ treated HCC cells resuspended in 100 uL PBS were subcutaneously injected to the left flank of the mice, which were randomly divided into several groups. Tumor sizes were measured every 3 to 5 days.
Response Summary	WTAP-guided m6A modification contributes to the progression of Hepatocellular carcinoma cells via the HuR-Protein C-ets-1 (ETS1)-p21/p27 axis.

Rheumatoid arthritis [ICD-11: FA20]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[31]
Responsed Disease	Rheumatoid arthritis [ICD-11: FA20]
Target Regulation	Down regulation

Protein patched homolog 1 (PTCH1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mouse embryonic stem cells	Mus musculus
Treatment: WTAP-/- ESCs Control: Wild type ESCs		GSE145309
Regulation		logFC: 1.15E+00 p-value: 6.91E-68
More Results	Click to View More RNA-seq Results

Hepatic fibrosis/cirrhosis [ICD-11: DB93]

In total 1 item(s) under this disease			Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene			[14]
Responsed Disease	Hepatic fibrosis [ICD-11: DB93.0]
Responsed Drug	AcSDKP	Phase 2	Drug Info
Target Regulation	Down regulation
Pathway Response	Hedgehog signaling pathway		hsa04340
Cell Process	Cell apoptosis
In-vitro Model	HSC (Hematopoietic stem cell)
In-vivo Model	Male Sprague-Dawley rats (375-400 g) liver fibrosis was induced by subcutaneous injection of carbon tetrachloride (CCl4) and olive oil (a ratio of 2:3) twice per week.
Response Summary	AcSDKP in liver fibrosis via m6A modification and Hedgehog pathway, which helps us to shed light on the molecular mechanism in liver fibrosis progression. WTAP targeted the 3'-UTR of Protein patched homolog 1 (PTCH1) mRNA, and administration of AcSDKP reduced the stability of Ptch1 mRNA.

Serine/threonine-protein kinase STK11 (STK11/LKB1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	CD4+ T cells	Mus musculus
Treatment: Wtap knockout CD4+ T cells Control: Wild type CD4+ T cells		GSE188814
Regulation		logFC: 1.01E+00 p-value: 6.29E-04
More Results	Click to View More RNA-seq Results

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[2]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Up regulation
Pathway Response	AMPK signaling pathway			hsa04152
Pathway Response	Autophagy			hsa04140
Cell Process	Cell autophagy
In-vitro Model	BEL-7402	Endocervical adenocarcinoma	Homo sapiens	CVCL_5492
	BEL-7404	Endocervical adenocarcinoma	Homo sapiens	CVCL_6568
	HEK293T	Normal	Homo sapiens	CVCL_0063
	L-02	Endocervical adenocarcinoma	Homo sapiens	CVCL_6926
	SMMC-7721	Endocervical adenocarcinoma	Homo sapiens	CVCL_0534
Response Summary	WTAP/Serine/threonine-protein kinase STK11 (STK11/LKB1)/AMPK axis in hepatocellular carcinoma cells acted as a key regulator, linking m6A with autophagy. WTAP-mediated m6A modification plays an important role in the regulation of autophagy in hepatocellular carcinoma cells, which provides a promising target for the treatment of hepatocellular carcinoma.

Tumor necrosis factor receptor superfamily member 10A (TNFRSF10A)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	Human umbilical vein endothelial cells	Homo sapiens
Treatment: siWTAP HUVECs Control: siControl HUVECs		GSE167067
Regulation		logFC: 1.73E+00 p-value: 1.15E-04
More Results	Click to View More RNA-seq Results

Rheumatoid arthritis [ICD-11: FA20]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[15]
Responsed Disease	Rheumatoid arthritis [ICD-11: FA20]
Pathway Response	JAK-STAT signaling pathway			hsa04630
	Cytokine-cytokine receptor interaction			hsa04060
Cell Process	Cell proliferation
	Cell apoptosis
In-vitro Model	MH7A	Normal	Homo sapiens	CVCL_0427
In-vivo Model	The rats were adaptively fed for 1 week and then subcutaneous injection of complete Freund's adjuvant into the left hindfoot toe to establish an adjuvant arthritis (AA) rat model. After induction of the immune response for 20 days, all rats were anesthetized by the intraperitoneal injection of 1% sodium pentobarbital (60 mg/kg) and sacrificed by exsanguination of the abdominal aorta.
Response Summary	This study established the transcriptional map of m6A in MH7A cells and revealed the potential relationship between RNA methylation modification and rheumatoid arthritis related genes. The results suggested that m6A modification was associated with the occurrence and course of RA to some extent. The validations of WTAP, RIPK2, JAK3 and Tumor necrosis factor receptor superfamily member 10A (TNFRSF10A) were in accordance with the m6A and RNA sequencing results.

Tyrosine-protein kinase JAK3 (JAK3)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	Human umbilical vein endothelial cells	Homo sapiens
Treatment: siWTAP HUVECs Control: siControl HUVECs		GSE167067
Regulation		logFC: 1.47E+00 p-value: 6.40E-04
More Results	Click to View More RNA-seq Results

Rheumatoid arthritis [ICD-11: FA20]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[15]
Responsed Disease	Rheumatoid arthritis [ICD-11: FA20]
Pathway Response	JAK-STAT signaling pathway			hsa04630
	Cytokine-cytokine receptor interaction			hsa04060
Cell Process	Cell proliferation
	Cell apoptosis
In-vitro Model	MH7A	Normal	Homo sapiens	CVCL_0427
In-vivo Model	The rats were adaptively fed for 1 week and then subcutaneous injection of complete Freund's adjuvant into the left hindfoot toe to establish an adjuvant arthritis (AA) rat model. After induction of the immune response for 20 days, all rats were anesthetized by the intraperitoneal injection of 1% sodium pentobarbital (60 mg/kg) and sacrificed by exsanguination of the abdominal aorta.
Response Summary	This study established the transcriptional map of m6A in MH7A cells and revealed the potential relationship between RNA methylation modification and rheumatoid arthritis related genes. The results suggested that m6A modification was associated with the occurrence and course of RA to some extent. The validations of WTAP, RIPK2, Tyrosine-protein kinase JAK3 (JAK3) and TNFRSF10A were in accordance with the m6A and RNA sequencing results.

Long intergenic non-protein coding RNA 657 (NORAD)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	Human umbilical vein endothelial cells	Homo sapiens
Treatment: siWTAP HUVECs Control: siControl HUVECs		GSE167067
Regulation		logFC: -7.45E-01 p-value: 4.90E-04
More Results	Click to View More RNA-seq Results

Intervertebral disc degeneration [ICD-11: FA80]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[16]
Responsed Disease	Intervertebral disc degeneration [ICD-11: FA80]
Pathway Response	Cellular senescence	hsa04218
Cell Process	Cell senescence
In-vitro Model	Nucleus pulposus cells (NPCs) (Nucleus pulposus cells)
In-vivo Model	After 50g male NORAD-KO or C57 mice at age of 8 weeks were anesthetized with 3% (w/v) pentobarbital (2 ml/kg) and grouped randomly, investigators blinded to the group allocation performed the experiment. The disc levels in rat tail (Co6/7, 7/8, and 8/9) were located by palpation on the coccygeal vertebrae and confirmed by trial radiography. Needles (33-G) were used to puncture the annulus fibrosus layer though the tail skin, in parallel to the end plates. To ensure that the needle did not penetrate too deeply , the length of the needle was pre-determined according to the dimensions of annulus fibrosus and the NP , which were measured in a preliminary experiment and found to be approximately 4 mm. Five kinds of solution were prepared for intradisc injection, including AA V vector, AAV containing shPUM1, AAV containing shPUM2 for Norad KO mice, AAV vector, AAV containing shE2F3, AAVcontaining OE-E2F3 for WT mice.
Response Summary	Subsequent loss- and gain-of-function experiments reveal WTAP is increased in senescent nucleus pulposus cells, and significantly promotes Long intergenic non-protein coding RNA 657 (NORAD) m6A modification. This study shows interruption of NORAD m6A modification or the NORAD/PUMILIO/E2F3 axis could serve as a potential therapeutic target to inhibit the senescence of NPCs and development of intervertebral disc degeneration(IVDD).

Apoptosis regulator Bcl-2 (BCL2)

Target Gene

Breast cancer [ICD-11: 2C60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[17]
Responsed Disease	Breast cancer [ICD-11: 2C60]
In-vitro Model	SK-BR-3	Breast adenocarcinoma	Homo sapiens	CVCL_0033
	MDA-MB-468	Breast adenocarcinoma	Homo sapiens	CVCL_0419
	MDA-MB-231	Breast adenocarcinoma	Homo sapiens	CVCL_0062
	MCF-7	Invasive breast carcinoma	Homo sapiens	CVCL_0031
	MCF-10A	Normal	Homo sapiens	CVCL_0598
In-vivo Model	Injected into the mice of the flanks subcutaneously with shNC/shNRP1 MDA-MB-231(4 × 10⁶) cells. Using calipers to examined the tumors of length and width, calculated the volumes of tumors twice every week. After 14 days, divided BALB/c nude mice randomly into four groups: control, shNRP1, local IR, and shNRP1 + local IR. Within 15 to 20 days of tumor inoculation, radiation was given at a dose of 2 Gy per day (the treatment lasted for 5 days). All experimental mice were euthanized by intraperitoneally injecting 3% pentobarbital sodium (Sigma-Aldrich, USA) at the completion of 35 days. H&E staining and immunohistochemistry staining were performed on all tumor tissues.

Autophagy protein 5 (ATG5)

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[18]
Responsed Disease	Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Up regulation
In-vitro Model	Huh-7	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0336
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
In-vivo Model	Four-week-old BALB/C-nu nude male mice were used for animal studies, and all animals were maintained in the specific pathogen-free (SPF) conditions at our institution. Huh-7 and stable YTHDC2 knockdown Huh-7 cells (approximately 1 × 10⁷) resuspended with 50 μl of PBS and 50 μl of stromal gel were injected subcutaneously into the axilla of BALB/c nude mice to establish the subcutaneous xenograft model. When the volume of xenograft tumors up to 100 mm3, the mice were randomly divided into six groups, with five mice in each group. Erastin and sorafenib were dissolved in 10 % DMSO and 90 % corn oil and injected intraperitoneally into the mice every other day. After 28 days, mice were deeply anesthetized by intraperitoneal injection of sodium thiopental before decapitation, followed by tumors extraction, and stored in a -80 °C refrigerator for subsequent experiments. There were no occurrences of mouse mortality throughout the entire experimental period.

Cyclin-dependent kinase 2 (CDK2)

Target Gene

Kidney cancer [ICD-11: 2C90-2C91]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[19]
Responsed Disease	Kidney cancer [ICD-11: 2C90-2C91]
In-vitro Model	786-O	Renal cell carcinoma	Homo sapiens	CVCL_1051
In-vitro Model	Caki-1	Clear cell renal cell carcinoma	Homo sapiens	CVCL_0234

Eukaryotic translation initiation factor 2 subunit 1 (EIF2S1/eIF2-Alpha)

Target Gene

Pulmonary hypertension [ICD-11: BB01]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[20]
Responsed Disease	Pulmonary arterial hypertension [ICD-11: BB01.0]
Target Regulation	Up regulation
In-vivo Model	Adult male Sprague-Dawley (150-200 g in body weight) rats were randomly divided into control or MCT/vehicle rats. Experimental rats were administered an intraperitoneal injection of monocrotaline (60 mg/kg, Sigma, 315-22-0), and their littermates were injected with saline. For GSK2606414 treatment, rats that underwent monocrotaline treatment were treated either with vehicle or GSK2606414 (10 mg/kg, Sigma, 1,337,531-89-1) by intraperitoneal injection per day. GSK2606414 was dissolved in a mixture of dimethyl sulfoxide (DMSO): polyethylene glycol (PEG) 400: distilled water (1: 4: 5). After 4 weeks, RV systolic blood pressure (RVSP) was measured with pressure transducers under anesthesia. The RV hypertrophy was analyzed as a ratio of RV to left ventricular and septal weight. Left lung tissues were fixed in 4% paraformaldehyde solution for the following histology staining; right lung tissues and pulmonary arteries were excised and immediately frozen in liquid nitrogen for other experiments.

Eukaryotic translation initiation factor 3 subunit C (EIF3C)

Target Gene

Prostate cancer [ICD-11: 2C82]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[21]
Responsed Disease	Prostate cancer [ICD-11: 2C82]
Target Regulation	Up regulation

Forkhead box protein O1 (FOXO1)

Target Gene

Urinary/pelvic organs injury [ICD-11: NB92]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[22]
Responsed Disease	Renal ischemia-reperfusion injury [ICD-11: NB92.0Y]
Target Regulation	Up regulation
In-vitro Model	HK-2 [Human kidney]	Normal	Homo sapiens	CVCL_0302

Forkhead box protein O3 (FOXO3)

Target Gene

Injury of heart [ICD-11: NB31]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[23]
Responsed Disease	Myocardial injury [ICD-11: NB31.Z]
Target Regulation	Up regulation
In-vitro Model	H9c2(2-1)	Normal	Rattus norvegicus	CVCL_0286
In-vivo Model	For exercise-trained rats, SD rats were treadmill trained 5 days per week continuing six weeks. In brief, exercise was carried out on a motor-driven treadmill, set at a 10.5% incline, 5 days per week for 6 weeks in an adjoining room maintained at 20 °C. Running duration and speed were gradually increased more than 22 days to 60 min at 30 m/min, corresponding to about 80% VO2 max, and maintained for 2-3 weeks.

Homeobox-containing protein 1 (HMBOX1)

Target Gene

Osteosarcoma [ICD-11: 2B51]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[25]
Responsed Disease	Osteosarcoma [ICD-11: 2B51]
Target Regulation	Down regulation
Pathway Response	PI3K-Akt signaling pathway			hsa04151
In-vitro Model	U2OS	Osteosarcoma	Homo sapiens	CVCL_0042
	SJSA-1	Osteosarcoma	Homo sapiens	CVCL_1697
	MG-63	Osteosarcoma	Homo sapiens	CVCL_0426
	HOS	Osteosarcoma	Homo sapiens	CVCL_0312
	hFOB 1.19	Normal	Homo sapiens	CVCL_3708
	143B	Osteosarcoma	Homo sapiens	CVCL_2270
In-vivo Model	Nude mice (4 weeks, male) were used for tumor model.For the subcutaneous tumor model, 1 × 10⁶ shNC, shWTAP or shHMBOX1 or shWTAP/shHMBOX1 U2OS cells seeded into mice via subcutaneous injection. Tumor volume and tumor weight were measured to analyze tumor growth as previous described. For orthotopic xenograft tumor model, shNC, shWTAP, shHMBOX1, or shWTAP/shHMBOX1 U2OS cells were labeled with a luminescent dye and GFP, and injected into the cavity of the tibia of mice. Thirty days after injection, tumor growth was detected. For the metastasis model, the cells were injected into the tail vein, and the lung metastasis were detected 30 days after injection using in vivo bioluminescence imaging system.
Response Summary	Homeobox-containing protein 1 (HMBOX1) was identified as the target gene of WTAP, WTAP/HMBOX1 regulated osteosarcoma growth and metastasis via PI3K/AKT pathway.

Metalloproteinase inhibitor 3 (TIMP3)

Target Gene

Intervertebral disc degeneration [ICD-11: FA80]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[26]
Responsed Disease	Intervertebral disc degeneration [ICD-11: FA80]
In-vitro Model	Pten-/- P2	Carcinoma of the mouse prostate gland	Mus musculus	CVCL_VQ83
In-vivo Model	We also used surgery to cause spine instability in rats to observe IVD changes under abnormal stress (Figure 1f). X-ray scans 6 months after surgery showed that the lumbar vertebral sequence line was continuous, with no stenosis in various intervertebral foramen in the ctrl group.

NACHT, LRR and PYD domains-containing protein 3 (NLRP3)

Target Gene

Chronic kidney disease [ICD-11: GB61]

In total 1 item(s) under this disease			Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene			[28]
Responsed Disease	Diabetic nephropathy [ICD-11: GB61.Z]
Responsed Drug	SETDB1-TTD-IN-1	Investigative	Drug Info
Target Regulation	Up regulation

Nuclear factor erythroid 2-related factor 2 (NFE2L2)

Target Gene

Bladder cancer [ICD-11: 2C94]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[29]
Responsed Disease	Bladder cancer [ICD-11: 2C94]
Target Regulation	Up regulation
In-vitro Model	SV-HUC-1	Normal	Homo sapiens	CVCL_3798
	J82	Bladder carcinoma	Homo sapiens	CVCL_0359
	UM-UC-3	Bladder carcinoma	Homo sapiens	CVCL_1783

Prostaglandin G/H synthase 2 (Coll X/PTGS2)

Target Gene

Acute ischemic stroke [ICD-11: 8B11]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[30]
Responsed Disease	Acute ischemic stroke [ICD-11: 8B11]
In-vitro Model	BV-2	Normal	Mus musculus	CVCL_0182
In-vivo Model	The mice underwent sevoflurane inhalation anesthesia (5% induction and 2% maintenance with spontaneous respiration in 50% O2; Baxter), and a neck incision was made to expose the left common carotid artery along with the internal and external carotid arteries through surgical means. A nylon monofilament coated with silicone rubber (602256PK10, Doccol Corporation) was introduced through an incision in the left external carotid artery. Subsequently, guided through the bifurcation into the internal carotid artery, the monofilament was advanced by approximately 11 mm to induce 90-min occlusion of the middle cerebral artery, followed by a 24-h reperfusion period. Mice in the sham-operated group underwent a matching surgical process, excluding the embolization stage.

Putative C->U-editing enzyme APOBEC-4 (APOBEC4)

Target Gene

Ovarian cancer [ICD-11: 2C73]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[32]
Responsed Disease	Ovarian cancer [ICD-11: 2C73]
In-vitro Model	HEY	Ovarian serous adenocarcinoma	Homo sapiens	CVCL_0297
In-vitro Model	THP-1	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0006
Response Summary	Putative C->U-editing enzyme APOBEC-4 (APOBEC4) was found to be significantly correlated with m6A regulators such as WTAP, METTL14, ZC3H13, RBM15B, and FMR1. APOBEC3A was identified as a protective factor from comprehensive analyses based on the immune microenvironment and genomic instability of ovarian cancer. APOBEC3A had the potential to serve as a promising prognostic biomarker for foretelling the survival and immunotherapy response of ovarian cancer patients.

Pyruvate dehydrogenase kinase isoform 4 (PDK4)

Target Gene

Colorectal cancer [ICD-11: 2B91]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[33]
Responsed Disease	Colorectal cancer [ICD-11: 2B91]
Target Regulation	Down regulation
In-vitro Model	NCM460	Normal	Homo sapiens	CVCL_0460
	HCT 116	Colon carcinoma	Homo sapiens	CVCL_0291
	HT-29	Colon adenocarcinoma	Homo sapiens	CVCL_0320
In-vivo Model	The in vivo experiments were conducted in line with a previous report with some modifications [29]. Male BALB/c nude mice (6-week-old, n=48) were bought from Cavens (Changzhou, China) and housed in a spe cific pathogen-free condition. All mice were given a free diet with an alternating 12 h light/dark cycle. All mice were acclimated for 5 days prior to the commencement of the experiments. Then, the mice were divided into four groups: CRC group (n=12), shNC group (n=12), shPDK4 group (n=12), and shPDK4+shWTAP group (n=12). Mice in the CRC group received no treatment, while those in the other three groups received a subcutaneous injection of 1×10⁶ HCT116 cells (for six mice) and HT-29 cells (for six mice). Moreover, mice received the intervention with shNC in shNC group, shPDK in shPDK group, and shPDK and shWTAP together in the shPDK + shWTAP group. Then, the mice were normally reared for 4 weeks, and the tumor volume was calculated eve ry week as per the formula (volume = 3.14 × tumor length× tumor width2/6).

Receptor-interacting serine/threonine-protein kinase 2 (RIPK2)

Target Gene

Rheumatoid arthritis [ICD-11: FA20]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[15]
Responsed Disease	Rheumatoid arthritis [ICD-11: FA20]
Pathway Response	JAK-STAT signaling pathway			hsa04630
	Cytokine-cytokine receptor interaction			hsa04060
Cell Process	Cell proliferation
	Cell apoptosis
In-vitro Model	MH7A	Normal	Homo sapiens	CVCL_0427
In-vivo Model	The rats were adaptively fed for 1 week and then subcutaneous injection of complete Freund's adjuvant into the left hindfoot toe to establish an adjuvant arthritis (AA) rat model. After induction of the immune response for 20 days, all rats were anesthetized by the intraperitoneal injection of 1% sodium pentobarbital (60 mg/kg) and sacrificed by exsanguination of the abdominal aorta.
Response Summary	This study established the transcriptional map of m6A in MH7A cells and revealed the potential relationship between RNA methylation modification and rheumatoid arthritis related genes. The results suggested that m6A modification was associated with the occurrence and course of RA to some extent. The validations of WTAP, Receptor-interacting serine/threonine-protein kinase 2 (RIPK2), JAK3 and TNFRSF10A were in accordance with the m6A and RNA sequencing results.

Signal transducer and activator of transcription 3 (STAT3)

Target Gene

Gastric cancer [ICD-11: 2B72]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[34]
Responsed Disease	Gastric cancer [ICD-11: 2B72]
In-vitro Model	GES-1	Normal	Homo sapiens	CVCL_EQ22
	AGS	Gastric adenocarcinoma	Homo sapiens	CVCL_0139
	HGC-27	Gastric carcinoma	Homo sapiens	CVCL_1279
In-vivo Model	Male nude mice (age: 4 weeks) were obtained from Charles River (Hangzhou, Zhejiang, China). For tumorigenesis analysis, AGS cells (1 × 10⁶) with stable knockdown of AGAP2-AS1 or scramble, were injected into mice. Next, we detected and measured the tumor volume each week. The weight of the tumor in each nude mouse was also measured at 4 weeks after injection. Immunohistochemistry (IHC) was used to detect Ki67- and caspase-3- positive cells in the tumor.

Transcription factor p65 (RELA)

Target Gene

Inflammatory response [ICD-11: MG46]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[35]
Responsed Disease	Inflammatory response [ICD-11: MG46]
In-vitro Model	THP-1	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0006
In-vitro Model	HEK293T	Normal	Homo sapiens	CVCL_0063

Transforming growth factor beta-1 proprotein (TGFB1)

Target Gene

Gastric cancer [ICD-11: 2B72]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[36]
Responsed Disease	Gastric cancer [ICD-11: 2B72]
Target Regulation	Up regulation
In-vitro Model	MKN45	Gastric adenocarcinoma	Homo sapiens	CVCL_0434
In-vitro Model	AGS	Gastric adenocarcinoma	Homo sapiens	CVCL_0139

Vascular endothelial growth factor A (VEGFA)

Target Gene

Colorectal cancer [ICD-11: 2B91]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[37]
Responsed Disease	Colorectal cancer [ICD-11: 2B91]
Target Regulation	Up regulation
In-vitro Model	SW480	Colon adenocarcinoma	Homo sapiens	CVCL_0546
In-vitro Model	HCT 116	Colon carcinoma	Homo sapiens	CVCL_0291
In-vivo Model	The cells were then washed with PBS and digested with trypsin. After counting, 1 × 10⁶ cells were injected subcutaneously into the flank regions of female BALB/c nude mice (4-6 weeks) to establish a subcutaneous implantation model. After 4 weeks, the volume and weight of the tumors were measured after the mice were sacrificed by CO2 inhalation and cervical dislocation.

Placental development [ICD-11: XA90F8]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[38]
Responsed Disease	Placental development [ICD-11: XA90F8]
In-vitro Model	JEG-3	Gestational choriocarcinoma	Homo sapiens	CVCL_0363
	BeWo	Gestational choriocarcinoma	Homo sapiens	CVCL_0044
	HEK293T	Normal	Homo sapiens	CVCL_0063
In-vivo Model	Sexually mature mice (older than 8 weeks of age) were mated and the vaginal plugs were confirmed the following morning. The day that a vaginal plug was observed was considered 0.5 days post coitum (0.5 dpc) or embryonic day 0.5 (E0.5). The uterus was cut along the side bearing the embryos and then cut open on the side opposite the placenta. Forceps were used to gently separate the uterus and the maternal surface of the placenta, and then the fetal surface of the placenta and the amniotic sac were separated. Dissected placentas and fetuses were photographed and weighted individually.

DIAPH1 antisense RNA 1 (DIAPH1-AS1)

Target Gene

Nasopharyngeal carcinoma [ICD-11: 2B6B]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[10]
Responsed Disease	Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation	Up regulation
Response Summary	WTAP-mediated m6A modification of DIAPH1 antisense RNA 1 (DIAPH1-AS1) enhanced its stability relying on the m6A reader IGF2BP2-dependent pathway. Furthermore, DIAPH1-AS1 acted as a molecular adaptor that promoted MTDH-LASP1 complex formation and upregulated LASP1 expression, ultimately facilitating NPC growth and metastasis.

DLGAP1 antisense RNA 1 (DLGAP1-AS1)

Target Gene

Breast cancer [ICD-11: 2C60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[39]
Responsed Disease	Breast cancer [ICD-11: 2C60]
Responsed Drug	Doxil		Approved	Drug Info
Target Regulation	Up regulation
Cell Process	Cell proliferation
In-vitro Model	ADR-resistant MCF-7 (MCF-7/ADR) cells (Human breast cancer doxorubicin-resistant cell line)
	BT-549	Invasive breast carcinoma	Homo sapiens	CVCL_1092
	MCF-7	Invasive breast carcinoma	Homo sapiens	CVCL_0031
	MDA-MB-231	Breast adenocarcinoma	Homo sapiens	CVCL_0062
	MCF-10A	Normal	Homo sapiens	CVCL_0598
Response Summary	LncRNA DLGAP1-AS1 promotes BC ADR-resistance through WTAP/DLGAP1 antisense RNA 1 (DLGAP1-AS1)/miR-299-3p feedback loop in breast cancer.

FOXD2 adjacent opposite strand RNA 1 (FOXD2-AS1)

Target Gene

Osteosarcoma [ICD-11: 2B51]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[7]
Responsed Disease	Osteosarcoma [ICD-11: 2B51]
Target Regulation	Up regulation
In-vitro Model	SaOS-2	Osteosarcoma	Homo sapiens	CVCL_0548
	MG-63	Osteosarcoma	Homo sapiens	CVCL_0426
	hFOB 1.19	Normal	Homo sapiens	CVCL_3708
In-vivo Model	In vivo animal assay, FOXD2-AS1 overexpression promoted the tumor growth in mice subcutaneous injection.
Response Summary	A remarkable m6A-modified site was found on the 3'-UTR of FOXD2 adjacent opposite strand RNA 1 (FOXD2-AS1), and m6A methyltransferase WTAP promoted the methylation modification, thus enhancing the stability of FOXD2-AS1 transcripts. m6A-modified FOXD2-AS1 accelerates the osteosarcoma progression through m6A manner, which provides new concepts for osteosarcoma tumorigenesis. FOXD2-AS1 interacted with downstream target FOXM1 mRNA through m6A sites, forming a FOXD2-AS1/m6A/FOXM1 complex to heighten FOXM1 mRNA stability.

hsa-miR-29b-3p

Target Gene

Low bone mass disorder [ICD-11: FB83]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[40]
Responsed Disease	Osteoporosis [ICD-11: FB83.1]
Target Regulation	Up regulation
In-vitro Model	RAW 264.7	Mouse leukemia	Mus musculus	CVCL_0493
In-vivo Model	15 L of an empty vector-carrying lentivirus (5 × 10⁷ copies/mL) was administered to the control group. The lentivirus as an in vivo delivery system can carry a luciferase transgene. The delivery system was injected into the marrow cavity of the femur 4 times at week 1, and luciferase expression in live mice was followed with a whole-animal fluorescence imaging system (IVIS Spectrum, USA) at 3 weeks post-injection.

hsa_circ_0008399 (Circ_RBM3)

Target Gene

Bladder cancer [ICD-11: 2C94]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[41]
Responsed Disease	Bladder cancer [ICD-11: 2C94]
Responsed Drug	Cisplatin		Approved	Drug Info
Target Regulation	Up regulation
Pathway Response	Protein export			hsa03060
Cell Process	Eukaryotic translation
	Cell apoptosis
In-vitro Model	5637	Bladder carcinoma	Homo sapiens	CVCL_0126
	RT-4	Bladder carcinoma	Homo sapiens	CVCL_0036
	UM-UC-3	Bladder carcinoma	Homo sapiens	CVCL_1783
In-vivo Model	Chose 4-week-old female BALB/c nude mice for tumor xenograft experiments, which randomly were divided into four groups (n = 5 per group). Bladder cancer cells (3 × 10⁶) were subcutaneously injected into the right axilla of the nude mice.
Response Summary	Circ0008399 bound WTAP to promote formation of the WTAP/METTL3/METTL14 m6A methyltransferase complex, reduce cisplatin sensitivity in bladder cancer, implicating the potential therapeutic value of targeting this axis.

5'-nucleotidase domain-containing protein 3 (NT5DC3)

Target Gene

Colon cancer [ICD-11: 2B90]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[42]
Responsed Disease	Colon cancer [ICD-11: 2B90]
In-vitro Model	GES-1	Normal	Homo sapiens	CVCL_EQ22
	MGC-803	Gastric mucinous adenocarcinoma	Homo sapiens	CVCL_5334
	HK2	Normal	Acipenser baerii	CVCL_YE28
	SW839	Clear cell renal cell carcinoma	Homo sapiens	CVCL_3604
	NCM460	Normal	Homo sapiens	CVCL_0460
	HT29	Colon cancer	Mus musculus	CVCL_A8EZ
	HCT 116	Colon carcinoma	Homo sapiens	CVCL_0291
	SW620	Colon adenocarcinoma	Homo sapiens	CVCL_0547

AC026356.1

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[43]
Responsed Disease	Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Up regulation
In-vitro Model	THLE-2	Normal	Homo sapiens	CVCL_3803
	SNU-398	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0077
	Huh-7	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0336
	Hep 3B2.1-7	Childhood hepatocellular carcinoma	Homo sapiens	CVCL_0326
	HCCLM3	Adult hepatocellular carcinoma	Homo sapiens	CVCL_6832
In-vivo Model	Indicated HCC cells were intrasplenically injected into 5-week-old male BALB/C athymic nude mice (SpePharm Biotechnology, Beijing, China). After being fed in specific pathogen free condition for 35 days, the mice were euthanized and the livers were resected and subjected to HE staining.

Albumin (ALB)

Target Gene

Osteosarcoma [ICD-11: 2B51]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[44]
Responsed Disease	Osteosarcoma [ICD-11: 2B51]
Target Regulation	Down regulation
In-vitro Model	HOS	Osteosarcoma	Homo sapiens	CVCL_0312
	U2OS	Osteosarcoma	Homo sapiens	CVCL_0042
	hFOB 1.19	Normal	Homo sapiens	CVCL_3708
In-vivo Model	Lentiviral vectors for sh-WTAP#1#2#NC were constructed and transfected into U2OS cells (1 × 10⁶ cells/100 μL) using Lipofectamine 3000 (Invitrogen), followed by subcutaneous injection into the right flank of mice. Tumor volume was measured at the time point of 1st, 2nd, 3rd, and 4th week. At the end of 4th week, the mice were anesthetized by pentobarbital sodium (50 mg/kg) with intraperitoneal injection and sacrificed using euthanasia method.

Alpha-actinin-4 (ACTN4)

Target Gene

SARS-CoV-2 [ICD-11: XN109]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[45]
Responsed Disease	SARS-CoV-2 [ICD-11: XN109]
In-vitro Model	A549-ACE2	Lung adenocarcinoma	Homo sapiens	CVCL_C0Q5
	A549-ACE2	Lung adenocarcinoma	Homo sapiens	CVCL_C0Q5
	Vero C1008	N.A.	Chlorocebus sabaeus	CVCL_0574
	HEK293T	Normal	Homo sapiens	CVCL_0063

Anillin (ANLN)

Target Gene

Placental development [ICD-11: XA90F8]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[38]
Responsed Disease	Placental development [ICD-11: XA90F8]
In-vitro Model	JEG-3	Gestational choriocarcinoma	Homo sapiens	CVCL_0363
	BeWo	Gestational choriocarcinoma	Homo sapiens	CVCL_0044
	HEK293T	Normal	Homo sapiens	CVCL_0063
In-vivo Model	Sexually mature mice (older than 8 weeks of age) were mated and the vaginal plugs were confirmed the following morning. The day that a vaginal plug was observed was considered 0.5 days post coitum (0.5 dpc) or embryonic day 0.5 (E0.5). The uterus was cut along the side bearing the embryos and then cut open on the side opposite the placenta. Forceps were used to gently separate the uterus and the maternal surface of the placenta, and then the fetal surface of the placenta and the amniotic sac were separated. Dissected placentas and fetuses were photographed and weighted individually.

BET1-like protein (BET1L)

Target Gene

Colorectal cancer [ICD-11: 2B91]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[46]
Responsed Disease	Colorectal cancer [ICD-11: 2B91]
In-vitro Model	HCT 116	Colon carcinoma	Homo sapiens	CVCL_0291
	SW620	Colon adenocarcinoma	Homo sapiens	CVCL_0547
	LoVo	Colon adenocarcinoma	Homo sapiens	CVCL_0399
	DLD-1	Colon adenocarcinoma	Homo sapiens	CVCL_0248
	FHC	Normal	Homo sapiens	CVCL_3688
In-vivo Model	For subcutaneous xenotransplantation, 3- to 4-week-old male BALB/c nude mice were randomly divided into groups (8 mice per group) and injected in the back flank with 100 μL of 1.0 × 10⁷ suspended cells.

Carbonic anhydrase 12 (CA12)

Target Gene

Osteoarthritis [ICD-11: FA05]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[47]
Responsed Disease	Osteoarthritis [ICD-11: FA05]
In-vitro Model	CHON-001	N.A.	Homo sapiens	CVCL_C462
In-vivo Model	After anesthesia, mice in the Sham group underwent a sham operation via an incision in the medial capsule of the knee joint (n = 6). Twelve C57BL/6 mice were separated into 2 groups: DMM and DMM + sh-WTAP.Adeno-associated virus 9 containing sh-WTAP (sh-WTAP) and its control virus (WZ Biosciences, Jinan, China) was administered to C57BL/6 J mice (10 μl, 1 × 1012 vg/ml) by intra-articular injection. Three weeks later, the DMM surgery was performed to establish posttraumatic OA mouse models. The knee joints of the mice were collected for subsequent experiments at the eighth week after surgery.

Caspase-8 (CASP8)

Target Gene

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[48]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Target Regulation	Up regulation
In-vitro Model	NCI-H226	Pleural epithelioid mesothelioma	Homo sapiens	CVCL_1544
	NCI-H1703	Lung squamous cell carcinoma	Homo sapiens	CVCL_1490
	HCC827	Lung adenocarcinoma	Homo sapiens	CVCL_2063
	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	HEK293T	Normal	Homo sapiens	CVCL_0063

CCN family member 2 (CTGF)

Target Gene

Chronic kidney disease [ICD-11: GB61]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[49]
Responsed Disease	Chronic kidney disease [ICD-11: GB61]
Target Regulation	Up regulation
In-vitro Model	SV40 MES 13	N.A.	Mus musculus	CVCL_5368
In-vitro Model	NRK-52E	Normal	Rattus norvegicus	CVCL_0468

Dickkopf-related protein 3 (DKK3)

Target Gene

Chronic kidney disease [ICD-11: GB61]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[50]
Responsed Disease	Diabetic nephropathy [ICD-11: GB61.Z]
In-vitro Model	HK-2 [Human kidney]	Normal	Homo sapiens	CVCL_0302
In-vivo Model	Female mice (8 weeks old, 20-25 g) on a C57BL/6J background were fasted for 12 h but were allowed to drink water freely. They were then injected intraperitoneally with 50 mg/kg body weight of freshly dissolved STZ in sterile PBS for four consecutive days. Mice were given sterile PBS alone in the same way as an untreated control. The mice's blood glucose levels were assessed two weeks after their most recent treatment. Mice that exhibited glucose levels greater than 201 mg/dL were classified as successful hyperglycemic models and were utilized in subsequent studies. Five months after the final dose of STZ, the mice were euthanized, and the renal tissues were collected for pathological examination to confirm the successful establishment of the model of diabetes nephropathy induced by hyperglycemia. All animal experiments were performed according to the guidelines of the Institutional Animal Care and Use Committee at the China Pharmaceutical University. Isoflurane was used to anesthetize mice.

DNA (cytosine-5)-methyltransferase 1 (DNMT1)

Target Gene

Diabetic [ICD-11: 5A14]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[51]
Responsed Disease	Diabetic [ICD-11: 5A14]
In-vitro Model	HUVEC-CS	N.A.	Homo sapiens	CVCL_0F27
In-vivo Model	Eight-week-old male BALB/c mice were intraperitoneally injected with streptozotocin (50 mg/kg) for five days to induce diabetes. Two weeks post-injection, blood glucose levels were measured using a blood glucose monitor. Successful induction of diabetes was confirmed when the blood glucose level exceeded 16.7 mmol/L and was sustained for an additional four weeks before creating full-thickness cutaneous wounds.

Exosome complex component RRP4 (EXOSC2)

Target Gene

Breast cancer [ICD-11: 2C60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[52]
Responsed Disease	Breast cancer [ICD-11: 2C60]
Target Regulation	Up regulation
In-vitro Model	MCF-10A	Normal	Homo sapiens	CVCL_0598
	MCF-7	Invasive breast carcinoma	Homo sapiens	CVCL_0031
	HCC1937	Breast ductal carcinoma	Homo sapiens	CVCL_0290
	BT-20	Invasive breast carcinoma of no special type	Homo sapiens	CVCL_0178
In-vivo Model	EXOSC2 overexpression vector was transfected to MCF-7 cells, and stably infected cells (5 × 10⁶) were injected subcutaneously into the left axilla of mice to induce BC in vivo [22]. Tumor size was examined every 3 days and calculated according to the formula.

Filamin-A (FLNA)

Target Gene

Colon cancer [ICD-11: 2B90]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[53]
Responsed Disease	Colon cancer [ICD-11: 2B90]
Target Regulation	Down regulation
In-vitro Model	HCT 116	Colon carcinoma	Homo sapiens	CVCL_0291
	SW620	Colon adenocarcinoma	Homo sapiens	CVCL_0547
	LoVo	Colon adenocarcinoma	Homo sapiens	CVCL_0399
	HCoEpiC (Healthy colon epithelial HCoEpiC cells)

Flotillin-1 (FLOT1)

Target Gene

Brain cancer [ICD-11: 2A00]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[54]
Responsed Disease	Glioma [ICD-11: 2A00.0]
Target Regulation	Up regulation
In-vitro Model	U-251MG	Astrocytoma	Homo sapiens	CVCL_0021
	T98G	Glioblastoma	Homo sapiens	CVCL_0556
	U-87MG ATCC	Glioblastoma	Homo sapiens	CVCL_0022
	U-118MG	Astrocytoma	Homo sapiens	CVCL_0633

GNAS antisense RNA 1 (GNAS-AS1)

Target Gene

Acute myeloid leukaemia [ICD-11: 2A60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[55]
Responsed Disease	Acute myeloid leukaemia [ICD-11: 2A60]
Responsed Drug	Chidamide		Investigative	Drug Info
In-vitro Model	HL-60	Adult acute myeloid leukemia	Homo sapiens	CVCL_0002
	HEL	Erythroleukemia	Homo sapiens	CVCL_0001
	MOLM-13	Adult acute myeloid leukemia	Homo sapiens	CVCL_2119
	MV4-11	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0064
	Kasumi-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_0589
	HS-5	N.A.	Homo sapiens	CVCL_3720
In-vivo Model	Subcutaneous tumorigenesis was induced in mice by subcutaneous transplantation of 1 × 10⁶ HL-60 cells. To stably overexpress GNAS-AS1, lentivirus-packaged OE-GNAS-AS1 (1 × 108 plaque-forming units). When the tumor volume reached 150-200 mm3, mice in the control group were orally treated with 1% DMSO (containing 0.2% carboxymethylcellulose and 0.1% Tween 80). Mice in the Chidamide, Chidamide + OE-NC, and Chidamide + OE-GNAS-AS1 groups were orally treated with Chidamide (25 mg/kg body weight, formulated with 1% DMSO containing 0.2% carboxymethylcellulose and 0.1% Tween 80). All treatments were repeated three times a week and for two weeks. Tumor volume was recorded every 5 days.

Histone-lysine N-methyltransferase SUV39H1 (SUV39H1)

Target Gene

Certain specified disorders of cornea [ICD-11: 9A78]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[56]
Responsed Disease	Certain specified disorders of cornea [ICD-11: 9A78.0]
In-vitro Model	THP-1	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0006

hsa-miR-92b-5p

Target Gene

Osteoarthritis [ICD-11: FA05]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[57]
Responsed Disease	Osteoarthritis [ICD-11: FA05]
Target Regulation	Down regulation
In-vivo Model	The male C57BL/6 mice (SPF, Eight-week-old) were randomly divided into four groups: sham (n = 6), model (n = 6), model + adeno-associated virus-negative control (AVV-shNC) (n = 6), and model + AVV-shWTAP groups (n = 6). After acclimating for one week, mice in other groups were treated with DMM surgery to induce OA as previously described except for the sham groups [19]. The mice in sham group were underwent only the skin of the right knee joint incision. The AAV-shNC and AAV-shWTAP were constructed by HANBIO (Shanghai, China). The AAV-shNC and AAV-shWTAP groups were intra-articularly injected with 10 μL of AAV-shNC and AAV-shWTAP (1 × 1013 vg/ml) through the medial parapatellar area at two weeks after the DMM operation, respectively.

Interferon epsilon (IFNE)

Target Gene

Condyloma acuminata [ICD-11: 1A95]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[58]
Responsed Disease	Condyloma acuminata [ICD-11: 1A95]
In-vitro Model	HaCaT	Normal	Homo sapiens	CVCL_0038

Interleukin-12 subunit beta (IL12B)

Target Gene

Inflammatory response [ICD-11: MG46]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[59]
Responsed Disease	Inflammatory response [ICD-11: MG46]
Cell Process	RNA decay

IQ motif and ankyrin repeat containing 1 (IQANK1)

Target Gene

Gastric cancer [ICD-11: 2B72]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[60]
Responsed Disease	Gastric cancer [ICD-11: 2B72]
Target Regulation	Up regulation
In-vitro Model	SNU-1	Gastric adenocarcinoma	Homo sapiens	CVCL_0099
	NCI-N87	Gastric tubular adenocarcinoma	Homo sapiens	CVCL_1603
	AGS	Gastric adenocarcinoma	Homo sapiens	CVCL_0139
	GES-1	Normal	Homo sapiens	CVCL_EQ22

Lysine-specific demethylase 4B (KDM4B)

Target Gene

Acute myeloid leukaemia [ICD-11: 2A60]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[61]
Responsed Disease	Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation	Down regulation

T(8;21) acute myeloid leukemia [ICD-11: XH3CX5]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[62]
Responsed Disease	T(8;21) acute myeloid leukemia [ICD-11: XH3CX5]
Target Regulation	Up regulation

Metalloproteinase inhibitor 4 (TIMP4)

Target Gene

Osteoarthritis [ICD-11: FA05]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[57]
Responsed Disease	Osteoarthritis [ICD-11: FA05]
Target Regulation	Up regulation
In-vivo Model	The male C57BL/6 mice (SPF, Eight-week-old) were randomly divided into four groups: sham (n = 6), model (n = 6), model + adeno-associated virus-negative control (AVV-shNC) (n = 6), and model + AVV-shWTAP groups (n = 6). After acclimating for one week, mice in other groups were treated with DMM surgery to induce OA as previously described except for the sham groups [19]. The mice in sham group were underwent only the skin of the right knee joint incision. The AAV-shNC and AAV-shWTAP were constructed by HANBIO (Shanghai, China). The AAV-shNC and AAV-shWTAP groups were intra-articularly injected with 10 μL of AAV-shNC and AAV-shWTAP (1 × 1014 vg/ml) through the medial parapatellar area at two weeks after the DMM operation, respectively.

miR-181a

Target Gene

Low bone mass disorder [ICD-11: FB83]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[63]
Responsed Disease	Osteoporosis [ICD-11: FB83.1]
Target Regulation	Up regulation

miR-181c

Target Gene

Low bone mass disorder [ICD-11: FB83]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[63]
Responsed Disease	Osteoporosis [ICD-11: FB83.1]
Target Regulation	Up regulation

Mucolipin-1 (TRPML1)

Target Gene

Epilepsy due to structural or metabolic conditions or diseases [ICD-11: 8A60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[65]
Responsed Disease	Epilepsy due to structural or metabolic conditions or diseases [ICD-11: 8A60.5]
In-vitro Model	HT22	Normal	Mus musculus	CVCL_0321

Nuclear protein 1 (NUPR1)

Target Gene

Triple-negative breast cancer [ICD-11: 2C6Z]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[66]
Responsed Disease	Triple-negative breast cancer [ICD-11: 2C6Z]
Target Regulation	Up regulation
In-vitro Model	MCF-7	Invasive breast carcinoma	Homo sapiens	CVCL_0031
	MDA-MB-231	Breast adenocarcinoma	Homo sapiens	CVCL_0062
	ZR75-30	Breast cancer	Homo sapiens	CVCL_1661
	T-47D	Invasive breast carcinoma	Homo sapiens	CVCL_0553
	BT-549	Invasive breast carcinoma	Homo sapiens	CVCL_1092
	MCF-10A	Normal	Homo sapiens	CVCL_0598

PHD finger protein 19 (PHF19)

Target Gene

T(8;21) acute myeloid leukemia [ICD-11: XH3CX5]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[67]
Responsed Disease	T(8;21) acute myeloid leukemia [ICD-11: XH3CX5]
Target Regulation	Up regulation

piRNA-17458

Target Gene

Cervical cancer [ICD-11: 2C77]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[68]
Responsed Disease	Cervical cancer [ICD-11: 2C77]
Target Regulation	Up regulation
In-vitro Model	Ca Ski	Cervical squamous cell carcinoma	Homo sapiens	CVCL_1100
	SiHa	Cervical squamous cell carcinoma	Homo sapiens	CVCL_0032
	End1/E6E7	Normal	Homo sapiens	CVCL_3684
In-vivo Model	A total of 5×10⁶ Caski cells were subcutaneously injected into the left inguen of mice. When tumors were ~50 mm3±10% (day16). The mice were randomly divided into 4 groups and received piRNA-17458 mimic or piRNA-17458 inhibitor by intratumor injection for every 4 days for a total of five injections. On the 36th day, the tumor weight and lymph node metastasis of the nude mice were assessed after mice were euthanized.

Protein S100-A9 (S100A9)

Target Gene

Atopic eczema [ICD-11: EA80]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[69]
Responsed Disease	Atopic eczema [ICD-11: EA80]
Target Regulation	Up regulation
In-vitro Model	HaCaT	Normal	Homo sapiens	CVCL_0038
In-vitro Model	HEK	Human papillomavirus-related cervical adenocarcinoma	Homo sapiens	CVCL_M624

Retinoic Acid Receptor Alpha-Retinoic Acid Receptor Alpha (PML-RARalpha)

Target Gene

Malignant haematopoietic neoplasm [ICD-11: 2B33]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[70]
Responsed Disease	Blood malignancies [ICD-11: 2B33.Y]
Target Regulation	Up regulation
Cell Process	Cell differentiation

Serpin B3 (SERPINB3)

Target Gene

Atopic eczema [ICD-11: EA80]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[69]
Responsed Disease	Atopic eczema [ICD-11: EA80]
Target Regulation	Up regulation
In-vitro Model	HaCaT	Normal	Homo sapiens	CVCL_0038
In-vitro Model	HEK	Human papillomavirus-related cervical adenocarcinoma	Homo sapiens	CVCL_M624

testis expressed 41 (TEX41)

Target Gene

Renal cell carcinoma [ICD-11: 2C90]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[71]
Responsed Disease	Renal cell carcinoma [ICD-11: 2C90]
Target Regulation	Up regulation

Transcription factor SOX-9 (SOX9)

Target Gene

Rheumatoid arthritis [ICD-11: FA20]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[72]
Responsed Disease	Rheumatoid arthritis [ICD-11: FA20]

Transmembrane protein 127 (TMEM127)

Target Gene

Breast cancer [ICD-11: 2C60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[73]
Responsed Disease	Breast cancer [ICD-11: 2C60]
Responsed Drug	Rapamycin		Approved	Drug Info
Target Regulation	Up regulation
In-vitro Model	MDA-MB-231	Breast adenocarcinoma	Homo sapiens	CVCL_0062
	T-47D	Invasive breast carcinoma	Homo sapiens	CVCL_0553
	HEK293T	Normal	Homo sapiens	CVCL_0063
In-vivo Model	Approximately 1 × 10⁶ viable MDA-MB-231 breast cancer cells were resuspended in 1:1 ratio in 50 μl medium and 50 μl matrigel (Corning, 354234) and injected orthotopically into the fourth mammary fat pad of each mouse. After injection, tumor size was measured twice a week using an electronic caliper. Tumor volumes were calculated with the formula: volume = (L × W2)/2, where L is the tumor length and W is the tumor width measured in millimeters.

WW domain-containing transcription regulator protein 1 (WWTR1)

Target Gene

Acute myeloid leukaemia [ICD-11: 2A60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[74]
Responsed Disease	Acute myeloid leukaemia [ICD-11: 2A60]
Cell Process	Cell proliferation
	Cell apoptosis
In-vitro Model	Kasumi-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_0589
	MV4-11	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0064
Response Summary	MicroRNA 550a-1 mediated a decrease in m6A levels via targeting WTAP, which led to a further reduction in WWTR1 stability. Using gain- and loss-of-function approaches, we were able to determine that miR-550-1 disrupted the proliferation and tumorigenesis of acute myeloid leukemia cells at least in part via the direct targeting of WWTR1.

Unspecific Target Gene

Brain cancer [ICD-11: 2A00]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[76]
Responsed Disease	Brain cancer [ICD-11: 2A00]
In-vitro Model	U-87MG ATCC	Glioblastoma	Homo sapiens	CVCL_0022
	U-251MG	Astrocytoma	Homo sapiens	CVCL_0021
	HEK293T	Normal	Homo sapiens	CVCL_0063
In-vivo Model	Each group contained 15 mice. Mice were injected subcutaneously with 3×10⁵ cells in the right axillary fossa. Tumor size was measured every five days until 60 days after injection.

Gastric cancer [ICD-11: 2B72]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[77]
Responsed Disease	Gastric cancer [ICD-11: 2B72]
Pathway Response	T cell receptor signaling pathway	hsa04660
Cell Process	Immunity
Response Summary	Wilms' tumour 1-associated protein was highly expressed in gastric cancer, which indicated a poor prognosis, and WTAP expression served as an independent predictor of GC survival. High WTAP expression correlated with RNA methylation and that low expression correlated with a high T cell-related immune response.

Ovarian cancer [ICD-11: 2C73]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[78]
Responsed Disease	Ovarian cancer [ICD-11: 2C73]
Cell Process	Cell apoptosis
In-vitro Model	CRL-11731D cell line (Human ovarian cancer cell)
	TOV-112D	Ovarian endometrioid adenocarcinoma	Homo sapiens	CVCL_3612
Response Summary	METTL3 can regulate m6A methylation independently of METTL14 and WTAP in endometrioid epithelial ovarian cancer.

Hematological disorders [ICD-11: 3C0Z]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[79]
Responsed Disease	Hematological disorders [ICD-11: 3C0Z]
Response Summary	This reviewed summarize and discuss recent findings regarding the biological functions and underlying mechanisms of m6A modification(i.e., the METTL3/METTL14/WTAP complex and other cofactor proteins) and the associated machinery in normal hematopoiesis and the initiation, progression, and drug response of acute myeloid leukemia (AML), a major subtype of leukemia usually associated with unfavorable prognosis.

Obesity [ICD-11: 5B81]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[80]
Responsed Disease	Obesity [ICD-11: 5B81]
Cell Process	Adipogenesis
In-vitro Model	3T3F442A	Normal	Mus musculus	CVCL_0122
	3T3-L1	Normal	Mus musculus	CVCL_0123
	COS (From the African green monkey cell line (CV-1).)
	MEF (Mouse embryonic fibroblasts)
In-vivo Model	Mice were anesthetized after 24 h of fasting, and 5 U of human insulin (Humalin R; Eli Lilly) was injected into the inferior vena cava. After 5 min, the liver and hind limb muscles were dissected and immediately frozen in liquid nitrogen.
Response Summary	WTAP, coupled with METTL3 and METTL14, is increased and distributed in nucleus by the induction of adipogenesis dependently on RNA in vitro Knockdown of each of these three proteins leads to cell cycle arrest and impaired adipogenesis associated with suppression of cyclin A2 upregulation during MCE, whose knockdown also impairs adipogenesis.

Cerebrovascular diseases [ICD-11: 8B22]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[81]
Responsed Disease	Arteriovenous malformation of cerebral vessels [ICD-11: 8B22.40]
In-vitro Model	HUVEC-C	Normal	Homo sapiens	CVCL_2959
Response Summary	WTAP has been identified as a key subunit of the m6A methyltransferase complex, was down-regulated in brain arteriovenous malformations (AVMs) lesions.

Presbycusis [ICD-11: AB54]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[82]
Responsed Disease	Presbycusis [ICD-11: AB54]

Diseases of the circulatory system [ICD-11: BE2Z]

In total 1 item(s) under this disease			Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene			[83]
Responsed Disease	Diseases of the circulatory system [ICD-11: BE2Z]
Responsed Drug	Sunitinib	Approved	Drug Info
In-vitro Model	hiPSCs (Urinary epithelial cell-derived hiPSCs)
	CMECs (Cardiac Microvascular Endothelial Cells )
	CFs (Cardiac Fibroblasts)
Response Summary	The RNA demethylase FTO was downregulated, whereas METTL14 and WTAP were upregulated. Furthermore, gain- and loss-of-function studies substantiated that FTO is cardioprotective in TKI(Sunitinib).

Inflammatory response [ICD-11: MG46]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[84]
Responsed Disease	Inflammatory response [ICD-11: MG46]
In-vitro Model	THP-1	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0006
In-vitro Model	HEK293T	Normal	Homo sapiens	CVCL_0063

Dual specificity protein phosphatase 6 (DUSP6)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mouse embryonic stem cells	Mus musculus
Treatment: WTAP-/- ESCs Control: Wild type ESCs		GSE145309
Regulation		logFC: -6.99E-01 p-value: 7.61E-15
More Results	Click to View More RNA-seq Results

Cisplatin [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[5]
Responsed Disease	Malignant haematopoietic neoplasm		ICD-11: 2B33	Disease Info
Target Regulation	Up regulation
Cell Process	Cell apoptosis
In-vitro Model	Normal NK cells (CD3-negative lymphocytes)
	SNK-6	Nasal type extranodal NK/T-cell lymphoma	Homo sapiens	CVCL_A673
	YTS	Lymphoblastic leukemia/lymphoma	Homo sapiens	CVCL_D324
Response Summary	m6A methyltransferase Wilms' tumor 1-associated protein facilitates cell proliferation and cisplatin resistance in NK/T cell lymphoma by regulating dual-specificity phosphatases 6 expression via m6A RNA methylation. WTAP enhanced Dual specificity protein phosphatase 6 (DUSP6) expression by increasing m6A levels of DUSP6 mRNA transcript, leading to oncogenic functions in NKTCL.

Focal adhesion kinase 1 (Fak)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mouse embryonic stem cells	Mus musculus
Treatment: WTAP-/- ESCs Control: Wild type ESCs		GSE145309
Regulation		logFC: 5.98E-01 p-value: 1.29E-24
More Results	Click to View More RNA-seq Results

Gemcitabine [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[6]
Responsed Disease	Pancreatic cancer		ICD-11: 2C10	Disease Info
Target Regulation	Up regulation
Pathway Response	PI3K-Akt signaling pathway			hsa04151
Cell Process	RNA stability
In-vitro Model	T3M-4	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_4056
	PANC-1	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0480
	MIA PaCa-2	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0428
	hTERT-HPNE	Normal	Homo sapiens	CVCL_C466
	HPDE6c7	Normal	Homo sapiens	CVCL_0P38
	BxPC-3	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0186
	AsPC-1	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0152
In-vivo Model	Twenty-four female BALB/c athymic nude mice, which were 4-6 weeks old and weighed 20.0-25.0 g, were obtained from the Animal Research Center of PUMCH. WTAP-OE, WTAP-NC, shWTAP and shNC-lentivirus infected MIA PaCa-2 cells (5 × 10⁶) were suspended in 50 uL PBS and then injected subcapsularly into the pancreatic tissue by 1-mL syringes.
Response Summary	WTAP could promote migration/invasion and suppress chemo-sensitivity to gemcitabine in PC. Further mechanical investigation revealed that WTAP could bind to and stabilize Focal adhesion kinase 1 (Fak) mRNA which in turn activated the Fak-PI3K-AKT and Fak-Src-GRB2-Erk1/2 signaling pathways.

Hepatocyte growth factor receptor (c-Met/MET)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mouse embryonic stem cells	Mus musculus
Treatment: WTAP-/- ESCs Control: Wild type ESCs		GSE145309
Regulation		logFC: -2.39E+00 p-value: 1.81E-38
More Results	Click to View More RNA-seq Results

Crizotinib [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[8]
Responsed Disease	Non-small-cell lung carcinoma		ICD-11: 2C25.Y	Disease Info
Target Regulation	Up regulation
Pathway Response	EGFR tyrosine kinase inhibitor resistance			hsa01521
In-vitro Model	HCC827	Lung adenocarcinoma	Homo sapiens	CVCL_2063
	NCI-H661	Lung large cell carcinoma	Homo sapiens	CVCL_1577
	NCI-H596	Lung adenosquamous carcinoma	Homo sapiens	CVCL_1571
	NCI-H460	Lung large cell carcinoma	Homo sapiens	CVCL_0459
	NCI-H358	Minimally invasive lung adenocarcinoma	Homo sapiens	CVCL_1559
	NCI-H292	Lung mucoepidermoid carcinoma	Homo sapiens	CVCL_0455
	NCI-H1975	Lung adenocarcinoma	Homo sapiens	CVCL_1511
	NCI-H1650	Minimally invasive lung adenocarcinoma	Homo sapiens	CVCL_1483
	NCI-H1395	Lung adenocarcinoma	Homo sapiens	CVCL_1467
	EBC-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_2891
	Calu-3	Lung adenocarcinoma	Homo sapiens	CVCL_0609
	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
In-vivo Model	HCC827 (3×10⁶) cells suspended in 100 uL of PBS were injected into the left inguen of female Balb/c nude mice (body weight 18-20 g; age 6 weeks; Beijing Huafukang Bioscience Co., Inc.). When the tumor volumes reached 50-100 mm³ on the 10th posttransplantation day, the mice were randomized into four groups (10 mice per group) and were intragastrically administered vehicle (normal saline), crizotinib (25 mg/kg body weight), chidamide (5 mg/kg), or the combination of the two drugs daily for 21 days. The tumor volumes and body weights of the mice were measured every 3 days.
Response Summary	Chidamide could decrease Hepatocyte growth factor receptor (c-Met/MET) expression by inhibiting mRNA N6-methyladenosine (m6A) modification through the downregulation of METTL3 and WTAP expression, subsequently increasing the crizotinib sensitivity of NSCLC cells in a c-MET-/HGF-dependent manner.

Myc proto-oncogene protein (MYC)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mice hepatocyte	Mus musculus
Treatment: Wtap Hknockout mice hepatocyte Control: Wtap flox/flox mice hepatocyte		GSE168850
Regulation		logFC: 2.89E+00 p-value: 1.82E-04
More Results	Click to View More RNA-seq Results

Daunorubicin [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[11]
Responsed Disease	Acute myeloid leukaemia		ICD-11: 2A60	Disease Info
Target Regulation	Up regulation
Cell Process	Cell cycle
	Cell proliferation
	Cell apoptosis
In-vitro Model	K-562	Chronic myelogenous leukemia	Homo sapiens	CVCL_0004
	MV4-11	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0064
Response Summary	WTAP made acute myeloid leukemia cells resistant to daunorubicin. In further investigations, m6A methylation level was downregulated when knocking down WTAP, and Myc proto-oncogene protein (MYC) was upregulated due to the decreased m6A methylation of MYC mRNA.

Gemcitabine [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[27]
Responsed Disease	Pancreatic cancer		ICD-11: 2C10	Disease Info
Target Regulation	Up regulation
In-vitro Model	PANC-1	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0480
In-vitro Model	CFPAC-1	Cystic fibrosis	Homo sapiens	CVCL_1119
In-vivo Model	To evaluate the effect of gemcitabine on the tumor formation ability and gemcitabine/WTAP/MYC axis in vivo, we injected 2×10⁶ PANC1 cells at logarithmic growth phase into the axilla of 4-week-old nude mice for subcutaneous tumor formation. The mice were randomly divided into phosphate buffered saline (PBS) group and gemcitabine treatment group. PBS or gemcitabine was injected into the mice via the abdominal cavity at a concentration of 50 mg/kg once every 5 days. The tumor dimension was measured every 5 days. After 30 days, the tumors were excised and weighed to compare the tumor size and volume, WTAP and MYC mRNA and protein expression was detected by real-time quantitative reverse transcription polymerase chain reaction (qRT-PCR) and immunofluorescence.

PI3-kinase subunit beta (PIK3CB)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mice hepatocyte	Mus musculus
Treatment: Wtap Hknockout mice hepatocyte Control: Wtap flox/flox mice hepatocyte		GSE168850
Regulation		logFC: 5.88E-01 p-value: 1.20E-03
More Results	Click to View More RNA-seq Results

AZD6482 [Terminated]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[12]
Responsed Disease	Pancreatic cancer		ICD-11: 2C10	Disease Info
Target Regulation	Up regulation
Pathway Response	PI3K-Akt signaling pathway			hsa04151
	Glycolysis / Gluconeogenesis			hsa00010
Cell Process	Glucose metabolism
In-vitro Model	BxPC-3	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0186
	PANC-1	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0480
In-vivo Model	Established cohorts of mice bearing tumour xenografts driven by PTEN-deficient BxPC-3 and PANC-1 cells with PIK3CB overexpression. When tumours grew to ~300 mm³, mice were grouped and administered with vehicle (DMSO) or KIN-193 via intraperitoneal injection (20 mg/kg) once daily.
Response Summary	N6-methyladenosine mRNA methylation of PIK3CB regulates AKT signalling to promote PTEN-deficient pancreatic cancer progression. Rs142933486 is significantly associated with the overall survival of PDAC by reducing the PIK3CB m6A level, which facilitated its mRNA and protein expression levels mediated by the m6A 'writer' complex (METTL13/METTL14/WTAP) and the m6A 'reader' YTHDF2. KIN-193, a PI3-kinase subunit beta (PIK3CB)-selective inhibitor, is shown to serve as an effective anticancer agent for blocking PTEN-deficient PDAC.

Protein patched homolog 1 (PTCH1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by WTAP*
Cell Line	mouse embryonic stem cells	Mus musculus
Treatment: WTAP-/- ESCs Control: Wild type ESCs		GSE145309
Regulation		logFC: 1.15E+00 p-value: 6.91E-68
More Results	Click to View More RNA-seq Results

AcSDKP [Phase 2]

In total 1 item(s) under this drug			Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene			[14]
Responsed Disease	Hepatic fibrosis	ICD-11: DB93.0	Disease Info
Target Regulation	Down regulation
Pathway Response	Hedgehog signaling pathway		hsa04340
Cell Process	Cell apoptosis
In-vitro Model	HSC (Hematopoietic stem cell)
In-vivo Model	Male Sprague-Dawley rats (375-400 g) liver fibrosis was induced by subcutaneous injection of carbon tetrachloride (CCl4) and olive oil (a ratio of 2:3) twice per week.
Response Summary	AcSDKP in liver fibrosis via m6A modification and Hedgehog pathway, which helps us to shed light on the molecular mechanism in liver fibrosis progression. WTAP targeted the 3'-UTR of Protein patched homolog 1 (PTCH1) mRNA, and administration of AcSDKP reduced the stability of Ptch1 mRNA.

NACHT, LRR and PYD domains-containing protein 3 (NLRP3)

Target Gene

SETDB1-TTD-IN-1 [Investigative]

In total 1 item(s) under this drug			Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene			[28]
Responsed Disease	Diabetic nephropathy	ICD-11: GB61.Z	Disease Info
Target Regulation	Up regulation

DLGAP1 antisense RNA 1 (DLGAP1-AS1)

Target Gene

Doxil [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[39]
Responsed Disease	Breast cancer		ICD-11: 2C60	Disease Info
Target Regulation	Up regulation
Cell Process	Cell proliferation
In-vitro Model	ADR-resistant MCF-7 (MCF-7/ADR) cells (Human breast cancer doxorubicin-resistant cell line)
	BT-549	Invasive breast carcinoma	Homo sapiens	CVCL_1092
	MCF-7	Invasive breast carcinoma	Homo sapiens	CVCL_0031
	MDA-MB-231	Breast adenocarcinoma	Homo sapiens	CVCL_0062
	MCF-10A	Normal	Homo sapiens	CVCL_0598
Response Summary	LncRNA DLGAP1-AS1 promotes BC ADR-resistance through WTAP/DLGAP1 antisense RNA 1 (DLGAP1-AS1)/miR-299-3p feedback loop in breast cancer.

hsa_circ_0008399 (Circ_RBM3)

Target Gene

Cisplatin [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[41]
Responsed Disease	Bladder cancer		ICD-11: 2C94	Disease Info
Target Regulation	Up regulation
Pathway Response	Protein export			hsa03060
Cell Process	Eukaryotic translation
Cell Process	Cell apoptosis
In-vitro Model	5637	Bladder carcinoma	Homo sapiens	CVCL_0126
	RT-4	Bladder carcinoma	Homo sapiens	CVCL_0036
	UM-UC-3	Bladder carcinoma	Homo sapiens	CVCL_1783
In-vivo Model	Chose 4-week-old female BALB/c nude mice for tumor xenograft experiments, which randomly were divided into four groups (n = 5 per group). Bladder cancer cells (3 × 10⁶) were subcutaneously injected into the right axilla of the nude mice.
Response Summary	Circ0008399 bound WTAP to promote formation of the WTAP/METTL3/METTL14 m6A methyltransferase complex, reduce cisplatin sensitivity in bladder cancer, implicating the potential therapeutic value of targeting this axis.

GNAS antisense RNA 1 (GNAS-AS1)

Target Gene

Chidamide [Investigative]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[55]
Responsed Disease	Acute myeloid leukaemia		ICD-11: 2A60	Disease Info
In-vitro Model	HL-60	Adult acute myeloid leukemia	Homo sapiens	CVCL_0002
	HEL	Erythroleukemia	Homo sapiens	CVCL_0001
	MOLM-13	Adult acute myeloid leukemia	Homo sapiens	CVCL_2119
	MV4-11	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0064
	Kasumi-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_0589
	HS-5	N.A.	Homo sapiens	CVCL_3720
In-vivo Model	Subcutaneous tumorigenesis was induced in mice by subcutaneous transplantation of 1 × 10⁶ HL-60 cells. To stably overexpress GNAS-AS1, lentivirus-packaged OE-GNAS-AS1 (1 × 108 plaque-forming units). When the tumor volume reached 150-200 mm3, mice in the control group were orally treated with 1% DMSO (containing 0.2% carboxymethylcellulose and 0.1% Tween 80). Mice in the Chidamide, Chidamide + OE-NC, and Chidamide + OE-GNAS-AS1 groups were orally treated with Chidamide (25 mg/kg body weight, formulated with 1% DMSO containing 0.2% carboxymethylcellulose and 0.1% Tween 80). All treatments were repeated three times a week and for two weeks. Tumor volume was recorded every 5 days.

Mitogen-activated protein kinase 13 (MAPK13)

Target Gene

Rapamycin [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[64]
Target Regulation	Down regulation
In-vitro Model	621-101	Lung lymphangioleiomyomatosis	Homo sapiens	CVCL_S879
	HEK293-EBNA	N.A.	Homo sapiens	CVCL_6974
	MCF-7	Invasive breast carcinoma	Homo sapiens	CVCL_0031
	BT-549	Invasive breast carcinoma	Homo sapiens	CVCL_1092
	UMB1949	Kidney angiomyolipoma	Homo sapiens	CVCL_C471

Transmembrane protein 127 (TMEM127)

Target Gene

Rapamycin [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[73]
Responsed Disease	Breast cancer		ICD-11: 2C60	Disease Info
Target Regulation	Up regulation
In-vitro Model	MDA-MB-231	Breast adenocarcinoma	Homo sapiens	CVCL_0062
	T-47D	Invasive breast carcinoma	Homo sapiens	CVCL_0553
	HEK293T	Normal	Homo sapiens	CVCL_0063
In-vivo Model	Approximately 1 × 10⁶ viable MDA-MB-231 breast cancer cells were resuspended in 1:1 ratio in 50 μl medium and 50 μl matrigel (Corning, 354234) and injected orthotopically into the fourth mammary fat pad of each mouse. After injection, tumor size was measured twice a week using an electronic caliper. Tumor volumes were calculated with the formula: volume = (L × W2)/2, where L is the tumor length and W is the tumor width measured in millimeters.

Unspecific Target Gene

Arsenite [Phase 2]

In total 1 item(s) under this drug		Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene		[75]
Cell Process	Cell apoptosis
In-vitro Model	HBE (Human bronchial epithelial cell line)
Response Summary	m6A modification on RNA was significantly increased in arsenite-transformed cells and this modification was synergistically regulated by METTL3, METTL14, WTAP and FTO. Demonstrated the significant role of m6A in the prevention of tumor occurrence and progression induced by arsenite.

Sunitinib [Approved]

In total 1 item(s) under this drug			Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene			[83]
Responsed Disease	Diseases of the circulatory system	ICD-11: BE2Z	Disease Info
In-vitro Model	hiPSCs (Urinary epithelial cell-derived hiPSCs)
	CMECs (Cardiac Microvascular Endothelial Cells )
	CFs (Cardiac Fibroblasts)
Response Summary	The RNA demethylase FTO was downregulated, whereas METTL14 and WTAP were upregulated. Furthermore, gain- and loss-of-function studies substantiated that FTO is cardioprotective in TKI(Sunitinib).

Click to View Potential Drug Response of This Regulator

Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator

RNA modification

m6A Target: X inactive specific transcript (XIST)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00425		Crosstalk Info
Epigenetic Regulator	Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target	MicroRNA 21 (MIR21)
Crosstalk relationship	m6A → A-to-I
Crosstalk ID: M6ACROT00426		Crosstalk Info
Epigenetic Regulator	Interferon-inducible protein 4 (ADAR1)
Regulated Target	MicroRNA 21 (MIR21)
Crosstalk relationship	m6A → A-to-I

m6A Target: Cyclin-dependent kinase 6 (CDK6)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00457		Crosstalk Info
Epigenetic Regulator	Interferon-inducible protein 4 (ADAR1)
Regulated Target	MicroRNA 149 (MIR149)
Crosstalk relationship	A-to-I → m6A
Crosstalk ID: M6ACROT00458		Crosstalk Info
Epigenetic Regulator	Methyltransferase-like protein 1 (METTL1)
Regulated Target	MicroRNA 149 (MIR149)
Crosstalk relationship	m7G → m6A

m6A Target: Cyclin-dependent kinase inhibitor 1B (CDKN1B/p27)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00501		Crosstalk Info
Epigenetic Regulator	Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target	MicroRNA 222 (MIR222)
Crosstalk relationship	A-to-I → m6A
Crosstalk ID: M6ACROT00502		Crosstalk Info
Epigenetic Regulator	Interferon-inducible protein 4 (ADAR1)
Regulated Target	MicroRNA 222 (MIR222)
Crosstalk relationship	A-to-I → m6A

DNA modification

m6A Target: DNA (cytosine-5)-methyltransferase 1 (DNMT1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02046		Crosstalk Info
Epigenetic Regulator	DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Crosstalk relationship	m6A → DNA modification
Disease	Diabetic	Disease Info

m6A Target: WW domain-containing transcription regulator protein 1 (WWTR1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02104		Crosstalk Info
Regulated Target	hsa-miR-550-1
Crosstalk relationship	DNA modification → m6A
Disease	Acute myeloid leukaemia	Disease Info

m6A Target: GNAS antisense RNA 1 (GNAS-AS1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02275		Crosstalk Info
Regulated Target	hsa-miR-550-1
Crosstalk relationship	DNA modification → m6A
Disease	Acute myeloid leukaemia	Disease Info
Drug	Chidamide	Drug Info

Histone modification

m6A Target: Interleukin-6 (IL-6)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03017		Crosstalk Info
Epigenetic Regulator	Lysine-specific demethylase 6B (KDM6B)
Regulated Target	Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship	Histone modification → m6A
Disease	Inflammatory response	Disease Info

m6A Target: Histone-lysine N-methyltransferase SETD1A (SETD1A)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03033		Crosstalk Info
Epigenetic Regulator	Histone-lysine N-methyltransferase SETD1A (SETD1A)
Regulated Target	Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship	m6A → Histone modification

m6A Target: Histone-lysine N-methyltransferase SETD1B (SETD1B)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03034		Crosstalk Info
Epigenetic Regulator	Histone-lysine N-methyltransferase SETD1B (SETD1B)
Regulated Target	Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship	m6A → Histone modification

m6A Target: Histone-lysine N-methyltransferase 2D (KMT2D)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03035		Crosstalk Info
Epigenetic Regulator	Histone-lysine N-methyltransferase 2D (KMT2D)
Regulated Target	Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship	m6A → Histone modification

m6A Target: DIAPH1 antisense RNA 1 (DIAPH1-AS1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03065		Crosstalk Info
Epigenetic Regulator	CREB-binding protein (CREBBP)
Regulated Target	Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship	Histone modification → m6A
Disease	Nasopharyngeal carcinoma	Disease Info

m6A Target: NACHT, LRR and PYD domains-containing protein 3 (NLRP3)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03095		Crosstalk Info
Epigenetic Regulator	Histone acetyltransferase p300 (P300)
Regulated Target	Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship	Histone modification → m6A
Disease	Diabetic nephropathy	Disease Info
Drug	SETDB1-TTD-IN-1	Drug Info

m6A Target: Lysine-specific demethylase 4B (KDM4B)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03181		Crosstalk Info
Epigenetic Regulator	Lysine-specific demethylase 4B (KDM4B)
Regulated Target	Histone H3 lysine 9 trimethylation (H3K9me3)
Crosstalk relationship	m6A → Histone modification
Disease	Acute myeloid leukaemia	Disease Info
Crosstalk ID: M6ACROT03227		Crosstalk Info
Epigenetic Regulator	Lysine-specific demethylase 4B (KDM4B)
Crosstalk relationship	m6A → Histone modification
Disease	T(8; 21) acute myeloid leukemia	Disease Info

m6A Target: testis expressed 41 (TEX41)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03196		Crosstalk Info
Epigenetic Regulator	Polycomb protein SUZ12 (SUZ12)
Regulated Target	Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship	m6A → Histone modification
Disease	Renal cell carcinoma	Disease Info

m6A Target: PHD finger protein 19 (PHF19)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03224		Crosstalk Info
Epigenetic Regulator	Polycomb Repressive Complex 2 (PRC2)
Regulated Target	Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship	m6A → Histone modification
Disease	T(8; 21) acute myeloid leukemia	Disease Info

m6A Target: LIM and SH3 domain protein 1 (LASP1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03310		Crosstalk Info
Epigenetic Regulator	CREB-binding protein (CREBBP)
Regulated Target	Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship	Histone modification → m6A
Disease	Nasopharyngeal carcinoma	Disease Info

m6A Target: Dickkopf-related protein 3 (DKK3)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03353		Crosstalk Info
Epigenetic Regulator	Histone acetyltransferase p300 (P300)
Regulated Target	Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship	Histone modification → m6A
Disease	Diabetic nephropathy	Disease Info
Drug	SETDB1-TTD-IN-1	Drug Info

m6A Target: Long intergenic non-protein coding RNA 657 (NORAD)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05973		Crosstalk Info
Epigenetic Regulator	Lysine-specific demethylase 5A (KDM5A)
Regulated Target	Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship	Histone modification → m6A
Disease	Intervertebral disc degeneration	Disease Info

m6A Target: Interleukin-12 subunit beta (IL12B)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05998		Crosstalk Info
Epigenetic Regulator	Lysine-specific demethylase 6B (KDM6B)
Regulated Target	Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship	Histone modification → m6A
Disease	Inflammatory response	Disease Info

Non-coding RNA

m6A Target: Suppressor of cytokine signaling 2 (SOCS2)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05155		Crosstalk Info
Epigenetic Regulator	AC115619-22aa
Regulated Target	Pre-mRNA-splicing regulator WTAP (WTAP)
Crosstalk relationship	ncRNA → m6A
Disease	Liver cancer	Disease Info

m6A Target: Beclin 1-associated autophagy-related key regulator (ATG14)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05156		Crosstalk Info
Epigenetic Regulator	AC115619-22aa
Regulated Target	Pre-mRNA-splicing regulator WTAP (WTAP)
Crosstalk relationship	ncRNA → m6A
Disease	Liver cancer	Disease Info

m6A Target: Caspase-8 (CASP8)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05157		Crosstalk Info
Epigenetic Regulator	piR-27222
Regulated Target	Eukaryotic translation initiation factor 4B (EIF4B)
Crosstalk relationship	ncRNA → m6A
Disease	Lung cancer	Disease Info

m6A Target: CCN family member 2 (CTGF)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05186		Crosstalk Info
Epigenetic Regulator	AI662270
Regulated Target	Pre-mRNA-splicing regulator WTAP (WTAP)
Crosstalk relationship	ncRNA → m6A
Disease	Chronic kidney disease	Disease Info

m6A Target: Protein C-ets-1 (ETS1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05221		Crosstalk Info
Epigenetic Regulator	hsa_circ_0066715 (Circ_CBLB)
Regulated Target	Pre-mRNA-splicing regulator WTAP (WTAP)
Crosstalk relationship	ncRNA → m6A
Disease	Rheumatoid arthritis	Disease Info

m6A Target: Eukaryotic translation initiation factor 3 subunit C (EIF3C)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05265		Crosstalk Info
Epigenetic Regulator	Circ_PDE5A
Regulated Target	Pre-mRNA-splicing regulator WTAP (WTAP)
Crosstalk relationship	ncRNA → m6A
Disease	Prostate cancer	Disease Info

m6A Target: DLGAP1 antisense RNA 1 (DLGAP1-AS1)

Target Gene

In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT05284		Crosstalk Info
Epigenetic Regulator	DLGAP1 antisense RNA 1 (DLGAP1-AS1)
Regulated Target	hsa-miR-299-3p
Crosstalk relationship	m6A → ncRNA
Disease	Breast cancer	Disease Info
Drug	Adriamycin	Drug Info
Crosstalk ID: M6ACROT05285		Crosstalk Info
Epigenetic Regulator	hsa-miR-299-3p
Regulated Target	Pre-mRNA-splicing regulator WTAP (WTAP)
Crosstalk relationship	ncRNA → m6A
Disease	Breast cancer	Disease Info
Drug	Adriamycin	Drug Info
Crosstalk ID: M6ACROT05286		Crosstalk Info
Epigenetic Regulator	DLGAP1 antisense RNA 1 (DLGAP1-AS1)
Regulated Target	hsa-miR-299-3p
Crosstalk relationship	ncRNA → m6A
Disease	Breast cancer	Disease Info
Drug	Adriamycin	Drug Info
Crosstalk ID: M6ACROT05546		Crosstalk Info
Epigenetic Regulator	DLGAP1 antisense RNA 1 (DLGAP1-AS1)
Regulated Target	hsa-miR-299-3p
Crosstalk relationship	m6A → ncRNA
Disease	Breast cancer	Disease Info
Drug	ADR	Drug Info

m6A Target: WW domain-containing transcription regulator protein 1 (WWTR1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05321		Crosstalk Info
Epigenetic Regulator	hsa-miR-550-1
Regulated Target	Pre-mRNA-splicing regulator WTAP (WTAP)
Crosstalk relationship	ncRNA → m6A
Disease	Acute myeloid leukaemia	Disease Info

m6A Target: Signal transducer and activator of transcription 3 (STAT3)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05323		Crosstalk Info
Epigenetic Regulator	LOC10013.776 (AGAP2-AS1)
Regulated Target	Pre-mRNA-splicing regulator WTAP (WTAP)
Crosstalk relationship	ncRNA → m6A
Disease	Gastric cancer	Disease Info

m6A Target: Hexokinase-2 (HK2)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05328		Crosstalk Info
Epigenetic Regulator	piR-30473
Regulated Target	Pre-mRNA-splicing regulator WTAP (WTAP)
Crosstalk relationship	ncRNA → m6A
Disease	Diffuse large B-cell lymphomas	Disease Info

m6A Target: Cyclin-dependent kinase 2 (CDK2)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05345		Crosstalk Info
Epigenetic Regulator	hsa-miR-501-3p
Regulated Target	Pre-mRNA-splicing regulator WTAP (WTAP)
Crosstalk relationship	ncRNA → m6A
Disease	Kidney cancer	Disease Info

m6A Target: Transcription factor SOX-9 (SOX9)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05369		Crosstalk Info
Epigenetic Regulator	Circ_FTO
Regulated Target	Methyltransferase-like protein 14 (METTL14)
Crosstalk relationship	ncRNA → m6A
Disease	Rheumatoid arthritis	Disease Info

m6A Target: X inactive specific transcript (XIST)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05457		Crosstalk Info
Epigenetic Regulator	X inactive specific transcript (XIST)
Regulated Target	Glypican-4 (GPC4)
Crosstalk relationship	m6A → ncRNA
Crosstalk ID: M6ACROT06025		Crosstalk Info
Epigenetic Regulator	X inactive specific transcript (XIST)
Regulated Target	Transcriptional regulator ATRX (ATRX)
Crosstalk relationship	m6A → ncRNA

m6A Target: hsa_circ_0008399 (Circ_RBM3)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05529		Crosstalk Info
Epigenetic Regulator	hsa_circ_0008399 (Circ_RBM3)
Regulated Target	Pre-mRNA-splicing regulator WTAP (WTAP)
Crosstalk relationship	m6A → ncRNA
Disease	Bladder cancer	Disease Info
Drug	Cisplatin	Drug Info

m6A Target: Long intergenic non-protein coding RNA 657 (NORAD)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05557		Crosstalk Info
Epigenetic Regulator	Long intergenic non-protein coding RNA 657 (NORAD)
Regulated Target	Pumilio homolog 1 (PUM1)
Crosstalk relationship	m6A → ncRNA
Disease	Intervertebral disc degeneration	Disease Info
Crosstalk ID: M6ACROT05971		Crosstalk Info
Epigenetic Regulator	Long intergenic non-protein coding RNA 657 (NORAD)
Regulated Target	Pumilio homolog 2 (PUM2)
Crosstalk relationship	m6A → ncRNA
Disease	Intervertebral disc degeneration	Disease Info

m6A Target: FOXD2 adjacent opposite strand RNA 1 (FOXD2-AS1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05589		Crosstalk Info
Epigenetic Regulator	FOXD2 adjacent opposite strand RNA 1 (FOXD2-AS1)
Regulated Target	Forkhead box protein M1 (FOXM1)
Crosstalk relationship	m6A → ncRNA
Disease	Osteosarcoma	Disease Info

m6A Target: DIAPH1 antisense RNA 1 (DIAPH1-AS1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05601		Crosstalk Info
Epigenetic Regulator	DIAPH1 antisense RNA 1 (DIAPH1-AS1)
Regulated Target	LIM and SH3 domain protein 1 (LASP1)
Crosstalk relationship	m6A → ncRNA
Disease	Nasopharyngeal carcinoma	Disease Info

m6A Target: IQ motif and ankyrin repeat containing 1 (IQANK1)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05645		Crosstalk Info
Epigenetic Regulator	IQ motif and ankyrin repeat containing 1 (IQANK1)
Crosstalk relationship	m6A → ncRNA
Disease	Gastric cancer	Disease Info
Crosstalk ID: M6ACROT05825		Crosstalk Info
Epigenetic Regulator	IQ motif and ankyrin repeat containing 1 (IQANK1)
Crosstalk relationship	m6A → ncRNA
Disease	Gastric cancer	Disease Info

m6A Target: AC026356.1

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05655		Crosstalk Info
Epigenetic Regulator	AC026356.1
Regulated Target	Interleukin-11 (IL11)
Crosstalk relationship	m6A → ncRNA
Disease	Liver cancer	Disease Info

m6A Target: GNAS antisense RNA 1 (GNAS-AS1)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05668		Crosstalk Info
Epigenetic Regulator	GNAS antisense RNA 1 (GNAS-AS1)
Regulated Target	hsa-miR-34a-5p
Crosstalk relationship	m6A → ncRNA
Disease	Acute myeloid leukaemia	Disease Info
Drug	Chidamide	Drug Info
Crosstalk ID: M6ACROT05928		Crosstalk Info
Epigenetic Regulator	hsa-miR-34a-5p
Regulated Target	Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship	m6A → ncRNA
Disease	Acute myeloid leukaemia	Disease Info
Drug	Chidamide	Drug Info

m6A Target: hsa-miR-29b-3p

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05671		Crosstalk Info
Epigenetic Regulator	hsa-miR-29b-3p
Regulated Target	Histone deacetylase 4 (HDAC4)
Crosstalk relationship	m6A → ncRNA
Disease	Osteoporosis	Disease Info

m6A Target: hsa-miR-92b-5p

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05691		Crosstalk Info
Epigenetic Regulator	hsa-miR-92b-5p
Regulated Target	Metalloproteinase inhibitor 4 (TIMP4)
Crosstalk relationship	m6A → ncRNA
Disease	Osteoarthritis	Disease Info

m6A Target: miR-181a

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05752		Crosstalk Info
Epigenetic Regulator	miR-181a
Regulated Target	Secreted frizzled related protein 1 (SFRP1)
Crosstalk relationship	m6A → ncRNA
Disease	Osteoporosis	Disease Info

m6A Target: miR-181c

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05753		Crosstalk Info
Epigenetic Regulator	miR-181c
Regulated Target	Secreted frizzled related protein 1 (SFRP1)
Crosstalk relationship	m6A → ncRNA
Disease	Osteoporosis	Disease Info

m6A Target: Circ_CMTM3

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05762		Crosstalk Info
Epigenetic Regulator	Circ_CMTM3
Regulated Target	Insulin like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Crosstalk relationship	m6A → ncRNA
Disease	Hepatocellular carcinoma	Disease Info

m6A Target: Urothelial cancer associated 1 (UCA1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05816		Crosstalk Info
Epigenetic Regulator	Urothelial cancer associated 1 (UCA1)
Crosstalk relationship	m6A → ncRNA

m6A Target: Retinoic Acid Receptor Alpha-Retinoic Acid Receptor Alpha (PML-RARalpha)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05880		Crosstalk Info
Epigenetic Regulator	Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Regulated Target	Pre-mRNA-splicing regulator WTAP (WTAP)
Crosstalk relationship	ncRNA → m6A
Disease	Blood malignancies	Disease Info

Xenobiotics Compound(s) Regulating the m6A Methylation Regulator

Compound Name	4-PBA	Phase 2
Synonyms	Benzenebutyric acid; Phenyl butanoate; Phenyl butyrate; HDInhib_000004; Butanoic acid, phenyl ester; Butyric acid, phenyl ester; FR-2080; Gamma-Phenylbutyric acid; Omega-Phenylbutanoic acid; GAMMA-PHENYL-BUTYRIC ACID; Butyric acid, 4-phenyl-(8CI); 1-Phenylbutyric acid; 4-PHENYL-BUTANOIC ACID; 4-PHENYLBUTYRIC ACID; 4-Phenylbutanoic acid; 4-phenylbutans; 4-phenylbutyrate Click to Show/Hide
External link	CID: 4775 TTD: D0B7CH DrugBank: DB06819
Description	Myocardial infarction (MI) is one of the leading causes of death. WTAP promoted myocardial I/R injury through promoting ER stress and cell apoptosis by regulating m6A modification ofATF4 mRNA. H/R effects on ER stress and apoptosis were all blocked by silencing of WTAP, promoted by WTAP overexpression, and ameliorated by administration of ER stress inhibitor, 4-PBA.	[4]
Compound Name	4-(dimethylamino)-N-[3-[[2-(4-oxochromen-7-yl)oxyacetyl]amino]phenyl]benzamide	Investigative
Synonyms	CHEMBL4438748; BDBM50519662 Click to Show/Hide
External link	CID: 155513187
Activity	IC50=3141 nM	[85]

References

Ref 1	C5aR1-positive neutrophils promote breast cancer glycolysis through WTAP-dependent m6A methylation of ENO1. Cell Death Dis. 2021 Jul 26;12(8):737. doi: 10.1038/s41419-021-04028-5.
Ref 2	m(6)A mRNA Methylation Regulates LKB1 to Promote Autophagy of Hepatoblastoma Cells through Upregulated Phosphorylation of AMPK. Genes (Basel). 2021 Oct 30;12(11):1747. doi: 10.3390/genes12111747.
Ref 3	WTAP facilitates progression of endometrial cancer via CAV-1/NF-KappaB axis. Cell Biol Int. 2021 Jun;45(6):1269-1277. doi: 10.1002/cbin.11570. Epub 2021 Feb 19.
Ref 4	WTAP promotes myocardial ischemia/reperfusion injury by increasing endoplasmic reticulum stress via regulating m(6)A modification of ATF4 mRNA. Aging (Albany NY). 2021 Mar 26;13(8):11135-11149. doi: 10.18632/aging.202770. Epub 2021 Mar 26.
Ref 5	m6A methyltransferase Wilms' tumor 1-associated protein facilitates cell proliferation and cisplatin resistance in NK/T cell lymphoma by regulating dual-specificity phosphatases 6 expression via m6A RNA methylation. IUBMB Life. 2021 Jan;73(1):108-117. doi: 10.1002/iub.2410. Epub 2020 Nov 17.
Ref 6	WT1 associated protein promotes metastasis and chemo-resistance to gemcitabine by stabilizing Fak mRNA in pancreatic cancer. Cancer Lett. 2019 Jun 1;451:48-57. doi: 10.1016/j.canlet.2019.02.043. Epub 2019 Mar 6.
Ref 7	N(6)-methyladenosine methyltransferase WTAP-stabilized FOXD2-AS1 promotes the osteosarcoma progression through m(6)A/FOXM1 axis. Bioengineered. 2022 Apr;13(4):7963-7973. doi: 10.1080/21655979.2021.2008218.
Ref 8	Chidamide increases the sensitivity of Non-small Cell Lung Cancer to Crizotinib by decreasing c-MET mRNA methylation. Int J Biol Sci. 2020 Jul 19;16(14):2595-2611. doi: 10.7150/ijbs.45886. eCollection 2020.
Ref 9	N(6)-methyladenosine (m(6)A) methyltransferase WTAP accelerates the Warburg effect of gastric cancer through regulating HK2 stability. Biomed Pharmacother. 2021 Jan;133:111075. doi: 10.1016/j.biopha.2020.111075. Epub 2020 Dec 9.
Ref 10	WTAP-mediated m(6)A modification of lncRNA DIAPH1-AS1 enhances its stability to facilitate nasopharyngeal carcinoma growth and metastasis. Cell Death Differ. 2022 Jun;29(6):1137-1151. doi: 10.1038/s41418-021-00905-w. Epub 2022 Jan 8.
Ref 11	High Wilms' tumor 1 associating protein expression predicts poor prognosis in acute myeloid leukemia and regulates m(6)A methylation of MYC mRNA. J Cancer Res Clin Oncol. 2021 Jan;147(1):33-47. doi: 10.1007/s00432-020-03373-w. Epub 2020 Sep 3.
Ref 12	N(6)-methyladenosine mRNA methylation of PIK3CB regulates AKT signalling to promote PTEN-deficient pancreatic cancer progression. Gut. 2020 Dec;69(12):2180-2192. doi: 10.1136/gutjnl-2019-320179. Epub 2020 Apr 20.
Ref 13	WTAP facilitates progression of hepatocellular carcinoma via m6A-HuR-dependent epigenetic silencing of ETS1. Mol Cancer. 2019 Aug 22;18(1):127. doi: 10.1186/s12943-019-1053-8.
Ref 14	N-acetyl-seryl-aspartyl-lysyl-proline (AcSDKP) mitigates the liver fibrosis via WTAP/m(6)A/Ptch1 axis through Hedgehog pathway. Gene. 2022 Mar 1;813:146125. doi: 10.1016/j.gene.2021.146125. Epub 2021 Dec 16.
Ref 15	Transcriptome-Wide High-Throughput m6A Sequencing of Differential m6A Methylation Patterns in the Human Rheumatoid Arthritis Fibroblast-Like Synoviocytes Cell Line MH7A. J Inflamm Res. 2021 Feb 25;14:575-586. doi: 10.2147/JIR.S296006. eCollection 2021.
Ref 16	WTAP-mediated m(6)A modification of lncRNA NORAD promotes intervertebral disc degeneration. Nat Commun. 2022 Mar 18;13(1):1469. doi: 10.1038/s41467-022-28990-6.
Ref 17	Identification of cytochrome P450 isoforms involved in the metabolism of loperamide in human liver microsomes. Eur J Clin Pharmacol. 2004 Oct;60(8):575-81. doi: 10.1007/s00228-004-0815-3. Epub 2004 Sep 8.
Ref 18	A phase I dose escalation study with anti-CD44v6 bivatuzumab mertansine in patients with incurable squamous cell carcinoma of the head and neck or esophagus. Clin Cancer Res. 2006 Oct 15;12(20 Pt 1):6064-72. doi: 10.1158/1078-0432.CCR-06-0910.
Ref 19	Clinical pipeline report, company report or official report of Eli Lilly.
Ref 20	NRF2 Regulation Processes as a Source of Potential Drug Targets against Neurodegenerative Diseases. Biomolecules. 2020 Jun 14;10(6):904. doi: 10.3390/biom10060904.
Ref 21	PARP inhibitors as antitumor agents: a patent update (2013-2015). Expert Opin Ther Pat. 2017 Mar;27(3):363-382. doi: 10.1080/13543776.2017.1259413. Epub 2016 Nov 21.
Ref 22	US patent application no. 6,159,697, Antisense modulation of Smad7 expression.
Ref 23	Can we use interleukin-6 (IL-6) blockade for coronavirus disease 2019 (COVID-19)-induced cytokine release syndrome (CRS)?. J Autoimmun. 2020 Jul;111:102452. doi: 10.1016/j.jaut.2020.102452. Epub 2020 Apr 10.
Ref 24	US patent application no. 6,187,587, Antisense inhibition of e2f transcription factor 1 expression.
Ref 25	WTAP promotes osteosarcoma tumorigenesis by repressing HMBOX1 expression in an m(6)A-dependent manner. Cell Death Dis. 2020 Aug 19;11(8):659. doi: 10.1038/s41419-020-02847-6.
Ref 26	The glutamate/cystine antiporter SLC7A11/xCT enhances cancer cell dependency on glucose by exporting glutamate. J Biol Chem. 2017 Aug 25;292(34):14240-14249. doi: 10.1074/jbc.M117.798405. Epub 2017 Jun 19.
Ref 27	A patent review on PD-1/PD-L1 antagonists: small molecules, peptides, and macrocycles (2015-2018). Expert Opin Ther Pat. 2018 Sep;28(9):665-678. doi: 10.1080/13543776.2018.1512706. Epub 2018 Sep 10.
Ref 28	Inhibition of Wnt/beta-catenin/CREB binding protein (CBP) signaling reverses pulmonary fibrosis. Proc Natl Acad Sci U S A. 2010 Aug 10;107(32):14309-14. doi: 10.1073/pnas.1001520107. Epub 2010 Jul 21.
Ref 29	Specific recognition of the bicyclic pyrimidine nucleoside analogs, a new class of highly potent and selective inhibitors of varicella-zoster virus (VZV), by the VZV-encoded thymidine kinase. Mol Pharmacol. 2002 Feb;61(2):249-54. doi: 10.1124/mol.61.2.249.
Ref 30	ABCG2: a potential marker of stem cells and novel target in stem cell and cancer therapy. Life Sci. 2010 Apr 24;86(17-18):631-7.
Ref 31	Clinical pipeline report, company report or official report of Kadmon.
Ref 32	Comprehensive Analyses Identify APOBEC3A as a Genomic Instability-Associated Immune Prognostic Biomarker in Ovarian Cancer. Front Immunol. 2021 Oct 21;12:749369. doi: 10.3389/fimmu.2021.749369. eCollection 2021.
Ref 33	US patent application no. 8007,790, Methods for treating polycystic kidney disease (pkd) or other cyst forming diseases.
Ref 34	DOI: 10.1158/1538-7445.AM2015-4693
Ref 35	Glyburide transport across the human placenta. Obstet Gynecol. 2015 Mar;125(3):583-588. doi: 10.1097/AOG.0000000000000672.
Ref 36	Genetic variation: impact on folate (and choline) bioefficacy. Int J Vitam Nutr Res. 2010 Oct;80(4-5):319-29. doi: 10.1024/0300-9831/a000040.
Ref 37	PharmGKB summary: very important pharmacogene information for PTGS2. Pharmacogenet Genomics. 2011 Sep;21(9):607-13. doi: 10.1097/FPC.0b013e3283415515.
Ref 38	Unveiling the role of multidrug resistance proteins in hypertension. Hypertension. 2009 Aug;54(2):210-6.
Ref 39	N(6)-methyladenosine (m(6)A)-mediated lncRNA DLGAP1-AS1enhances breast canceradriamycin resistance through miR-299-3p/WTAP feedback loop. Bioengineered. 2021 Dec;12(2):10935-10944. doi: 10.1080/21655979.2021.2000198.
Ref 40	CenterWatch. Drugs in Clinical Trials Database. CenterWatch. 2008.
Ref 41	Circ0008399 Interaction with WTAP Promotes Assembly and Activity of the m(6)A Methyltransferase Complex and Promotes Cisplatin Resistance in Bladder Cancer. Cancer Res. 2021 Dec 15;81(24):6142-6156. doi: 10.1158/0008-5472.CAN-21-1518. Epub 2021 Oct 26.
Ref 42	Bidirectional transfer of methadone across human placenta. Biochem Pharmacol. 2005 Jan 1;69(1):187-97. doi: 10.1016/j.bcp.2004.09.008.
Ref 43	Clinical pipeline report, company report or official report of Gan & Lee Pharmaceuticals.
Ref 44	A novel oxyiminoalkanoic acid derivative, TAK-559, activates human peroxisome proliferator-activated receptor subtypes. Eur J Pharmacol. 2004 Jul 8;495(1):17-26. doi: 10.1016/j.ejphar.2004.05.020.
Ref 45	P-glycoprotein (ABCB1) and breast cancer resistance protein (ABCG2) restrict brain accumulation of the active sunitinib metabolite N-desethyl sunitinib. J Pharmacol Exp Ther. 2012 Apr;341(1):164-73.
Ref 46	Human CYP2C19 is a major omeprazole 5-hydroxylase, as demonstrated with recombinant cytochrome P450 enzymes. Drug Metab Dispos. 1996 Oct;24(10):1081-7.
Ref 47	Functional regulation of Na+-dependent neutral amino acid transporter ASCT2 by S-nitrosothiols and nitric oxide in Caco-2 cells. FEBS Lett. 2005 Apr 25;579(11):2499-506. doi: 10.1016/j.febslet.2005.03.065.
Ref 48	NKP-1339, a first-in-class anticancer drug showing mild side effects and activity in patients suffering from advanced refractory cancer. BMC Pharmacol Toxicol. 2012; 13(Suppl 1): A82.
Ref 49	Clinical pipeline report, company report or official report of GlycoMimetics.
Ref 50	Role of BCRP as a biomarker for predicting resistance to 5-fluorouracil in breast cancer. Cancer Chemother Pharmacol. 2009 May;63(6):1103-10. doi: 10.1007/s00280-008-0838-z. Epub 2008 Sep 27.
Ref 51	Discovery and preclinical evaluation of anti-miR-17 oligonucleotide RGLS4326 for the treatment of polycystic kidney disease. Nat Commun. 2019 Sep 12;10(1):4148. doi: 10.1038/s41467-019-11918-y.
Ref 52	Effects of MTHFR and MS gene polymorphisms on baseline blood pressure and Benazepril effectiveness in Chinese hypertensive patients. J Hum Hypertens. 2011 Mar;25(3):172-7. doi: 10.1038/jhh.2010.50. Epub 2010 May 6.
Ref 53	US patent application no. 5,789,573, Antisense inhibition of ICAM-1, E-selectin, and CMV IE1/IE2.
Ref 54	Characterization of sirtuin inhibitors in nematodes expressing a muscular dystrophy protein reveals muscle cell and behavioral protection by specific sirtinol analogues. J Med Chem. 2010 Feb 11;53(3):1407-11. doi: 10.1021/jm9013345.
Ref 55	MI-219-zinc combination: a new paradigm in MDM2 inhibitor-based therapy. Oncogene. 2011 Jan 6;30(1):117-26. doi: 10.1038/onc.2010.403. Epub 2010 Sep 6.
Ref 56	Orally bioavailable isothioureas block function of the chemokine receptor CXCR4 in vitro and in vivo. J Med Chem. 2008 Dec 25;51(24):7915-20. doi: 10.1021/jm801065q.
Ref 57	Transferrin receptor targeting nanomedicine delivering wild-type p53 gene sensitizes pancreatic cancer to gemcitabine therapy. Cancer Gene Ther. 2013 Apr;20(4):222-8. doi: 10.1038/cgt.2013.9. Epub 2013 Mar 8.
Ref 58	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1443).
Ref 59	Interplay of m(6)A and H3K27 trimethylation restrains inflammation during bacterial infection. Sci Adv. 2020 Aug 19;6(34):eaba0647. doi: 10.1126/sciadv.aba0647. eCollection 2020 Aug.
Ref 60	ClinicalTrials.gov (NCT01869166) Treatment of Chemotherapy Refractory EGFR(Epidermal Growth Factor Receptor) Positive Advanced Solid Tumors (CART-EGFR)
Ref 61	Clinical pipeline report, company report or official report of INmune Bio.
Ref 62	A Novel BCL-2 Inhibitor APG-2575 Exerts Synthetic Lethality With BTK or MDM2-p53 Inhibitor in Diffuse Large B-Cell Lymphoma. Oncol Res. 2020 Sep 1;28(4):331-344. doi: 10.3727/096504020X15825405463920. Epub 2020 Feb 24.
Ref 63	Mecasermin rinfabate: insulin-like growth factor-I/insulin-like growth factor binding protein-3, mecaserimin rinfibate, rhIGF-I/rhIGFBP-3. Drugs R D. 2005;6(2):120-7. doi: 10.2165/00126839-200506020-00008.
Ref 64	Designing drugs for the treatment of female sexual dysfunction. Drug Discov Today. 2007 Sep;12(17-18):757-66. doi: 10.1016/j.drudis.2007.07.007. Epub 2007 Aug 27.
Ref 65	P-glycoprotein increases the efflux of the androgen dihydrotestosterone and reduces androgen responsive gene activity in prostate tumor cells. Prostate. 2004 Apr 1;59(1):77-90.
Ref 66	Structure-activity relationships for a series of bis(phenylalkyl)amines: potent subtype-selective inhibitors of N-methyl-D-aspartate receptors. J Med Chem. 1998 Aug 27;41(18):3499-506. doi: 10.1021/jm980235+.
Ref 67	WL-276, an antagonist against Bcl-2 proteins, overcomes drug resistance and suppresses prostate tumor growth. Cancer Res. 2008 Jun 1;68(11):4377-83. doi: 10.1158/0008-5472.CAN-07-6590.
Ref 68	The influence of metabolic gene polymorphisms on urinary 1-hydroxypyrene concentrations in Chinese coke oven workers. Sci Total Environ. 2007 Aug 1;381(1-3):38-46. doi: 10.1016/j.scitotenv.2007.02.021. Epub 2007 May 11.
Ref 69	WO patent application no. 2013,1850,32, Nanotherapeutics for drug targeting.
Ref 70	Nuclear export of chimeric mRNAs depends on an lncRNA-triggered autoregulatory loop in blood malignancies. Cell Death Dis. 2020 Jul 23;11(7):566. doi: 10.1038/s41419-020-02795-1.
Ref 71	Clinical pipeline report, company report or official report of HaiHe Biopharma.
Ref 72	MBX-102/JNJ39659100, a novel peroxisome proliferator-activated receptor-ligand with weak transactivation activity retains antidiabetic properties in the absence of weight gain and edema. Mol Endocrinol. 2009 Jul;23(7):975-88. doi: 10.1210/me.2008-0473. Epub 2009 Apr 23.
Ref 73	Tyrosine kinase inhibitors. 9. Synthesis and evaluation of fused tricyclic quinazoline analogues as ATP site inhibitors of the tyrosine kinase activity of the epidermal growth factor receptor. J Med Chem. 1996 Feb 16;39(4):918-28. doi: 10.1021/jm950692f.
Ref 74	miR-550-1 functions as a tumor suppressor in acute myeloid leukemia via the hippo signaling pathway. Int J Biol Sci. 2020 Sep 1;16(15):2853-2867. doi: 10.7150/ijbs.44365. eCollection 2020.
Ref 75	N(6)-methyladenosine mediates the cellular proliferation and apoptosis via microRNAs in arsenite-transformed cells. Toxicol Lett. 2018 Aug;292:1-11. doi: 10.1016/j.toxlet.2018.04.018. Epub 2018 Apr 20.
Ref 76	Combination of novel imidazopyridazine mps-1 kinase inhibitors and bcl-2 family protein inhibitors. ACS Med Chem Lett. 2014 Jul 30;6(1):7-8. doi: 10.1021/ml5003037. eCollection 2015 Jan 8.
Ref 77	High expression of WTAP leads to poor prognosis of gastric cancer by influencing tumour-associated T lymphocyte infiltration. J Cell Mol Med. 2020 Apr;24(8):4452-4465. doi: 10.1111/jcmm.15104. Epub 2020 Mar 16.
Ref 78	METTL3 regulates m6A in endometrioid epithelial ovarian cancer independently of METTl14 and WTAP. Cell Biol Int. 2020 Dec;44(12):2524-2531. doi: 10.1002/cbin.11459. Epub 2020 Sep 11.
Ref 79	RNA N (6)-Methyladenosine Modification in Normal and Malignant Hematopoiesis. Adv Exp Med Biol. 2019;1143:75-93. doi: 10.1007/978-981-13-7342-8_4.
Ref 80	The RNA Methyltransferase Complex of WTAP, METTL3, and METTL14 Regulates Mitotic Clonal Expansion in Adipogenesis. Mol Cell Biol. 2018 Jul 30;38(16):e00116-18. doi: 10.1128/MCB.00116-18. Print 2018 Aug 15.
Ref 81	Wilms' tumour 1-associating protein inhibits endothelial cell angiogenesis by m6A-dependent epigenetic silencing of desmoplakin in brain arteriovenous malformation. J Cell Mol Med. 2020 May;24(9):4981-4991. doi: 10.1111/jcmm.15101. Epub 2020 Apr 13.
Ref 82	The effect of intravenous interferon-beta-1a (FP-1201) on lung CD73 expression and on acute respiratory distress syndrome mortality: an open-label study. Lancet Respir Med. 2014 Feb;2(2):98-107. doi: 10.1016/S2213-2600(13)70259-5. Epub 2013 Dec 23.
Ref 83	Alteration of N(6)-Methyladenosine mRNA Methylation in a Human Stem Cell-Derived Cardiomyocyte Model of Tyrosine Kinase Inhibitor-Induced Cardiotoxicity. Front Cardiovasc Med. 2022 Mar 23;9:849175. doi: 10.3389/fcvm.2022.849175. eCollection 2022.
Ref 84	AGIX-4207 [2-[4-[[1-[[3,5-bis(1,1-dimethylethyl)-4-hydroxyphenyl]thio]-1-methylethyl]thio]-2,6-bis(1,1-dimethylethyl)phenoxy]acetic acid], a novel antioxidant and anti-inflammatory compound: cellular and biochemical characterization of antioxidant activity and inhibition of redox-sensitive inflammatory gene expression. J Pharmacol Exp Ther. 2005 May;313(2):492-501. doi: 10.1124/jpet.104.080804. Epub 2005 Feb 8.
Ref 85	Discovery of 4H-Chromen-4-one Derivatives as a New Class of Selective Rho Kinase (ROCK) Inhibitors, which Showed Potent Activity in ex Vivo Diabetic Retinopathy Models. J Med Chem. 2019 Dec 12;62(23):10691-10710. doi: 10.1021/acs.jmedchem.9b01143. Epub 2019 Nov 20.

m6A Regulator Information

Cite M6AREG

Correspondence

Prof. Feng ZHU

Prof. Shuiping Liu

Visitor Map