m6A Regulator Information

General Information of the m6A Regulator (ID: REG00022)

Regulator Name	YTH domain-containing protein 1 (YTHDC1)
Synonyms	Splicing factor YT521; YT521-B; KIAA1966; YT521 Click to Show/Hide
Gene Name	YTHDC1
Sequence	MAADSREEKDGELNVLDDILTEVPEQDDELYNPESEQDKNEKKGSKRKSDRMESTDTKRQ KPSVHSRQLVSKPLSSSVSNNKRIVSTKGKSATEYKNEEYQRSERNKRLDADRKIRLSSS ASREPYKNQPEKTCVRKRDPERRAKSPTPDGSERIGLEVDRRASRSSQSSKEEVNSEEYG SDHETGSSGSSDEQGNNTENEEEGVEEDVEEDEEVEEDAEEDEEVDEDGEEEEEEEEEEE EEEEEEEEEYEQDERDQKEEGNDYDTRSEASDSGSESVSFTDGSVRSGSGTDGSDEKKKE RKRARGISPIVFDRSGSSASESYAGSEKKHEKLSSSVRAVRKDQTSKLKYVLQDARFFLI KSNNHENVSLAKAKGVWSTLPVNEKKLNLAFRSARSVILIFSVRESGKFQGFARLSSESH HGGSPIHWVLPAGMSAKMLGGVFKIDWICRRELPFTKSAHLTNPWNEHKPVKIGRDGQEI ELECGTQLCLLFPPDESIDLYQVIHKMRHKRRMHSQPRSRGRPSRREPVRDVGRRRPEDY DIHNSRKKPRIDYPPEFHQRPGYLKDPRYQEVDRRFSGVRRDVFLNGSYNDYVREFHNMG PPPPWQGMPPYPGMEQPPHHPYYQHHAPPPQAHPPYSGHHPVPHEARYRDKRVHDYDMRV DDFLRRTQAVVSGRRSRPRERDRERERDRPRDNRRDRERDRGRDRERERERLCDRDRDRG ERGRYRR Click to Show/Hide
Function	Regulator of alternative splicing that specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability. Acts as a key regulator of exon-inclusion or exon-skipping during alternative splicing via interaction with mRNA splicing factors SRSF3 and SRSF10. Specifically binds m6A-containing mRNAs and promotes recruitment of SRSF3 to its mRNA-binding elements adjacent to m6A sites, leading to exon-inclusion during alternative splicing. In contrast, interaction with SRSF3 prevents interaction with SRSF10, a splicing factor that promotes exon skipping: this prevents SRSF10 from binding to its mRNA-binding sites close to m6A-containing regions, leading to inhibit exon skipping during alternative splicing. May also regulate alternative splice site selection. Also involved in nuclear export of m6A-containing mRNAs via interaction with SRSF3: interaction with SRSF3 facilitates m6A-containing mRNA-binding to both SRSF3 and NXF1, promoting mRNA nuclear export. Involved in S-adenosyl-L-methionine homeostasis by regulating expression of MAT2A transcripts, probably by binding m6A-containing MAT2A mRNAs (By similarity). Also recognizes and binds m6A on other RNA molecules. Involved in random X inactivation mediated by Xist RNA: recognizes and binds m6A-containing Xist and promotes transcription repression activity of Xist. Also recognizes and binds m6A-containing single-stranded DNA. Involved in germline development: required for spermatogonial development in males and oocyte growth and maturation in females, probably via its role in alternative splicing (By similarity). Click to Show/Hide
Gene ID	91746
Uniprot ID	YTDC1_HUMAN
Regulator Type	WRITER ERASER READER
Mechanism Diagram	Click to View the Original Diagram

Target Genes	Click to View Potential Target Genes of This Regulator

Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)

YTHDC1 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.

Browse Target Gene related Disease

Browse Target Gene related Drug

DNA replication licensing factor MCM4 (MCM4)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by YTHDC1*
Cell Line	MOLM-13 cell line	Homo sapiens
Treatment: shYTHDC1 MOLM13 cells Control: shControl MOLM13 cells		GSE168565
Regulation		logFC: -1.63E+00 p-value: 3.74E-32
More Results	Click to View More RNA-seq Results

Acute myeloid leukaemia [ICD-11: 2A60]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[1]
Responsed Disease	Acute myeloid leukaemia [ICD-11: 2A60]
Pathway Response	DNA replication	hsa03030
Cell Process	DNA replication
Response Summary	YTHDC1 knockdown has a strong inhibitory effect on proliferation of primary AML cells. YTHDC1 regulates leukemogenesis through DNA replication licensing factor MCM4 (MCM4), which is a critical regulator of DNA replication.

Heat shock 70 kDa protein 1A (HSPA1A)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by YTHDC1*
Cell Line	MOLM-13 cell line	Homo sapiens
Treatment: shYTHDC1 MOLM13 cells Control: shControl MOLM13 cells		GSE178859
Regulation		logFC: 8.78E-01 p-value: 3.66E-03
More Results	Click to View More RNA-seq Results

Effects of heat [ICD-11: NF01]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[2]
Responsed Disease	Effects of heat [ICD-11: NF01]
Target Regulation	Down regulation
Pathway Response	RNA degradation			hsa03018
In-vitro Model	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	MEF (Mouse embryonic fibroblasts)
Response Summary	Heat directly binds to Heat shock 70 kDa protein 1A (HSPA1A), thereby targeting stress genes in a trans-acting manner. Intriguingly, Heat is heavily methylated in the form of m6A. Heat mediates these effects via the nuclear m6A reader YTHDC1, forming a transcriptional silencing complex for stress genes. Reveals a crucial role of nuclear epitranscriptome in the transcriptional regulation of heat shock response.

Mutated in multiple advanced cancers 1 (PTEN)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by YTHDC1*
Cell Line	MOLM-13 cell line	Homo sapiens
Treatment: shYTHDC1 MOLM13 cells Control: shControl MOLM13 cells		GSE168565
Regulation		logFC: 7.38E-01 p-value: 4.67E-08
More Results	Click to View More RNA-seq Results

Acute ischemic stroke [ICD-11: 8B11]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Acute ischemic stroke [ICD-11: 8B11]
Target Regulation	Down regulation
In-vitro Model	HEK293T	Normal	Homo sapiens	CVCL_0063
In-vivo Model	Male SD rats weighing 200-250 g were anesthetized using 4% isoflurane in 70% N₂O and 30% O₂ with a mask. A midline incision was made in the neck, the left external carotid artery (ECA) was carefully exposed and dissected, a monofilament nylon suture with a diameter of about 0.22 mm was inserted from the ECA into the internal carotid artery, and the left middle cerebral artery (MCA) was blocked. After occlusion for 90 minutes, the suture was removed for reperfusion, and ECA was ligated to close the wound. Sham-operated rats underwent the same surgery except for suture insertion. Rats were maintained on top of a warming pad (RWD, 69003) during the above procedures. The breathing machine was used to monitor the respiration of rats. The rats were returned to a heated cage during the recovery phase with free access to food and water.
Response Summary	YTHDC1 promoted Mutated in multiple advanced cancers 1 (PTEN) mRNA degradation to increase Akt phosphorylation, thus facilitating neuronal survival in particular after ischemia, modulating m6A reader YTHDC1 provide a potential therapeutic target for ischemic stroke.

Sequestosome-1 (SQSTM1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by YTHDC1*
Cell Line	MOLM-13 cell line	Homo sapiens
Treatment: shYTHDC1 MOLM13 cells Control: shControl MOLM13 cells		GSE168565
Regulation		logFC: 1.02E+00 p-value: 3.33E-09
More Results	Click to View More RNA-seq Results

Diabetes [ICD-11: 5A10-5A14]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[4]
Responsed Disease	Diabetes [ICD-11: 5A10-5A14]
Target Regulation	Up regulation
Pathway Response	Autophagy			hsa04140
Cell Process	Cellular Processes
	Cellular Transport
	Cellular catabolism
	Cell apoptosis
	Cell autophagy
In-vitro Model	HaCaT	Normal	Homo sapiens	CVCL_0038
	NHEK (Normal human epithelial keratinocytes)
In-vivo Model	The WT-si-NC, WT-si-Ythdc1 and WT-si-Sqstm1 groups were intracutaneously injected with corresponding siRNAs (si-NC, si-Ythdc1, or si-Sqstm1, 2.5 nmol) on the circle.
Response Summary	In diabetes/diabetic skin, YTHDC1 interacted and cooperated with ELAVL1/HuR (ELAV like RNA binding protein 1) in modulating the expression of Sequestosome-1 (SQSTM1).

Diabetic skin lesions [ICD-11: EB90]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[4]
Responsed Disease	Diabetic skin lesions [ICD-11: EB90.0]
Target Regulation	Up regulation
Pathway Response	Autophagy			hsa04140
Cell Process	Cellular Processes
	Cellular Transport
	Cellular catabolism
	Cell apoptosis
	Cell autophagy
In-vitro Model	HaCaT	Normal	Homo sapiens	CVCL_0038
	NHEK (Normal human epithelial keratinocytes)
In-vivo Model	The WT-si-NC, WT-si-Ythdc1 and WT-si-Sqstm1 groups were intracutaneously injected with corresponding siRNAs (si-NC, si-Ythdc1, or si-Sqstm1, 2.5 nmol) on the circle.
Response Summary	In diabetes/diabetic skin, YTHDC1 interacted and cooperated with ELAVL1/HuR (ELAV like RNA binding protein 1) in modulating the expression of Sequestosome-1 (SQSTM1).

Serine/arginine-rich splicing factor 10 (SRSF10)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by YTHDC1*
Cell Line	MOLM-13 cell line	Homo sapiens
Treatment: shYTHDC1 MOLM13 cells Control: shControl MOLM13 cells		GSE168565
Regulation		logFC: -6.79E-01 p-value: 2.34E-06
More Results	Click to View More RNA-seq Results

Kaposi's sarcoma [ICD-11: 2B57]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Kaposi's sarcoma [ICD-11: 2B57]
Target Regulation	Up regulation
Pathway Response	Spliceosome			hsa03040
In-vitro Model	TIVE-KSHV (KSHV-infected telomerase-immortalized human umbilical vein endothelial cells (TIVE-KSHV cells))
	iSLK-BAC16 cells (Kaposi's sarcoma cells carrying the recombinant KSHV bacterial artificial chromosome 16 (BAC16) (iSLK-BAC16 cells))
	HUVEC-C	Normal	Homo sapiens	CVCL_2959
Response Summary	Kaposi's sarcoma-associated herpesvirus(KSHV) productive lytic replication plays a pivotal role in the initiation and progression of Kaposi's sarcoma tumors. m6A sites in RTA pre-mRNA crucial for splicing through interactions with YTHDC1, SRSF3 and Serine/arginine-rich splicing factor 10 (SRSF10). m6A in regulating RTA pre-mRNA splicing but also suggest that KSHV has evolved a mechanism to manipulate the host m6A machinery to its advantage in promoting lytic replication.

Serine/arginine-rich splicing factor 11 (SRSF11)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by YTHDC1*
Cell Line	ICM cell line	Mus musculus
Treatment: YTHDC1 knockout ICM cells Control: Wild type ICM cells		GSE157267
Regulation		logFC: -2.75E+00 p-value: 7.07E-03
More Results	Click to View More RNA-seq Results

Brain cancer [ICD-11: 2A00]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[6]
Responsed Disease	Glioblastoma [ICD-11: 2A00.00]
Target Regulation	Up regulation
Pathway Response	RNA degradation			hsa03018
Cell Process	mRNA decay
In-vitro Model	U251 (Fibroblasts or fibroblast like cells)
	U-87MG ATCC	Glioblastoma	Homo sapiens	CVCL_0022
In-vivo Model	For subcutaneous tumor model, each mouse was injected subcutaneously in the right flank with 2 × 10⁶ U87MG cells (METTL3-KD or control) in 100 uL PBS.
Response Summary	Silencing METTL3 or overexpressing dominant-negative mutant METTL3 suppressed the growth and self-renewal of Glioblastoma cells. Integrated transcriptome and MeRIP-seq analyses revealed that downregulating the expression of METTL3 decreased m6A modification levels of Serine/arginine-rich splicing factor 11 (SRSF11), which led to YTHDC1-dependent NMD of SRSF transcripts and decreased SRSF protein expression.

Serine/arginine-rich splicing factor 3 (SRSF3)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by YTHDC1*
Cell Line	ICM cell line	Mus musculus
Treatment: YTHDC1 knockout ICM cells Control: Wild type ICM cells		GSE157267
Regulation		logFC: -1.77E+00 p-value: 4.66E-05
More Results	Click to View More RNA-seq Results

Brain cancer [ICD-11: 2A00]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[6]
Responsed Disease	Glioblastoma [ICD-11: 2A00.00]
Target Regulation	Up regulation
Pathway Response	RNA degradation			hsa03018
Cell Process	mRNA decay
In-vitro Model	U251 (Fibroblasts or fibroblast like cells)
	U-87MG ATCC	Glioblastoma	Homo sapiens	CVCL_0022
In-vivo Model	For subcutaneous tumor model, each mouse was injected subcutaneously in the right flank with 2 × 10⁶ U87MG cells (METTL3-KD or control) in 100 uL PBS.
Response Summary	Silencing METTL3 or overexpressing dominant-negative mutant METTL3 suppressed the growth and self-renewal of Glioblastoma cells. Integrated transcriptome and MeRIP-seq analyses revealed that downregulating the expression of METTL3 decreased m6A modification levels of Serine/arginine-rich splicing factor 3 (SRSF3), which led to YTHDC1-dependent NMD of SRSF transcripts and decreased SRSF protein expression.

Kaposi's sarcoma [ICD-11: 2B57]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Kaposi's sarcoma [ICD-11: 2B57]
Target Regulation	Up regulation
Pathway Response	Spliceosome			hsa03040
In-vitro Model	TIVE-KSHV (KSHV-infected telomerase-immortalized human umbilical vein endothelial cells (TIVE-KSHV cells))
	iSLK-BAC16 cells (Kaposi's sarcoma cells carrying the recombinant KSHV bacterial artificial chromosome 16 (BAC16) (iSLK-BAC16 cells))
	HUVEC-C	Normal	Homo sapiens	CVCL_2959
Response Summary	Kaposi's sarcoma-associated herpesvirus(KSHV) productive lytic replication plays a pivotal role in the initiation and progression of Kaposi's sarcoma tumors. m6A sites in RTA pre-mRNA crucial for splicing through interactions with YTHDC1, Serine/arginine-rich splicing factor 3 (SRSF3) and SRSF10. m6A in regulating RTA pre-mRNA splicing but also suggest that KSHV has evolved a mechanism to manipulate the host m6A machinery to its advantage in promoting lytic replication.

Type 2 diabetes mellitus [ICD-11: 5A11]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[12]
Responsed Disease	Type 2 diabetes mellitus [ICD-11: 5A11]
In-vitro Model	MIN6	Mouse insulinoma	Mus musculus	CVCL_0431

Titin

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by YTHDC1*
Cell Line	MOLM-13 cell line	Homo sapiens
Treatment: shYTHDC1 MOLM13 cells Control: shControl MOLM13 cells		GSE168565
Regulation		logFC: 1.29E+00 p-value: 9.48E-11
More Results	Click to View More RNA-seq Results

Cardiomyopathy [ICD-11: BC43]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[7]
Responsed Disease	Dilated cardiomyopathy [ICD-11: BC43.0]
In-vitro Model	Neonatal rat ventricular cardiomyocytes (Primary myocyte cells)
Response Summary	This study suggests that YTHDC1 plays crucial role in regulating the normal contractile function and the development of dilated cardiomyopathy.

Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by YTHDC1*
Cell Line	MOLM-13 cell line	Homo sapiens
Treatment: shYTHDC1 MOLM13 cells Control: shControl MOLM13 cells		GSE168565
Regulation		logFC: 1.45E+00 p-value: 5.75E-21
More Results	Click to View More RNA-seq Results

Malignant haematopoietic neoplasm [ICD-11: 2B33]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[8]
Responsed Disease	Blood malignancies [ICD-11: 2B33.Y]
Target Regulation	Up regulation
Cell Process	Oncogenic fusion protein expression
In-vitro Model	HEK293T	Normal	Homo sapiens	CVCL_0063
	HL-60	Adult acute myeloid leukemia	Homo sapiens	CVCL_0002
	K-562	Chronic myelogenous leukemia	Homo sapiens	CVCL_0004
	Kasumi-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_0589
	MOLM-13	Adult acute myeloid leukemia	Homo sapiens	CVCL_2119
	NB4	Acute promyelocytic leukemia	Homo sapiens	CVCL_0005
In-vivo Model	The NOD-SCID mice were intravenously (tail vein) implanted with sh-RNA-established NB4 cells. Direct injection of 5 × 10⁶ shRNA-transformed NB4 cells into 150 uL of PBS was performed to establish intravenous (tail vein) leukemia.
Response Summary	MALAT1 hijacks both chimeric mRNAs and fusion protein in nuclear speckles during chromosomal translocation and mediates colocalization with METTL14 in an oncogenic fusion protein such as PML-RARalpha. Reducing MALAT1 or m6A methyltransferases and the 'reader' YTHDC1 result in the universal retention of distinct oncogenic gene (PML-RARalpha) mRNAs in nucleus. Targeting the lncRNA-triggered autoregulatory loop to disrupt chimeric mRNA transport represents a new common paradigm for treating blood malignancies.

Epithelial membrane protein 3 (EMP3)

Target Gene

Breast cancer [ICD-11: 2C60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[9]
Responsed Disease	Breast cancer [ICD-11: 2C60]
Responsed Drug	Doxil		Approved	Drug Info
Target Regulation	Down regulation
Pathway Response	Nucleotide excision repair			hsa03420
	mTOR signaling pathway			hsa04150
	PI3K-Akt signaling pathway			hsa04151
Cell Process	DNA repair
In-vitro Model	BT-474	Invasive breast carcinoma	Homo sapiens	CVCL_0179
	Hs 578T	Invasive breast carcinoma	Homo sapiens	CVCL_0332
	MCF-7	Invasive breast carcinoma	Homo sapiens	CVCL_0031
	MDA-MB-231	Breast adenocarcinoma	Homo sapiens	CVCL_0062
	SK-BR-3	Breast adenocarcinoma	Homo sapiens	CVCL_0033
Response Summary	Epithelial membrane protein 3 (EMP3) blocks Akt-mTOR signaling activation and induces autophagy. EMP3 downregulates YTHDC1, which at least in part mediates the effects of EMP3 on breast cancer cells. EMP3 sensitizes breast cancer cells to the DNA-damaging drug Adriamycin. EMP3 downregulation can be responsible for breast cancer chemoresistance.

High mobility group protein HMGI-C (HMGA2)

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[10]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Up regulation
Pathway Response	Transcriptional misregulation in cancer			hsa05202
Cell Process	Epithelial-mesenchymal transition
	Cell autophagy
In-vitro Model	Hep 3B2.1-7	Childhood hepatocellular carcinoma	Homo sapiens	CVCL_0326
	L-02	Endocervical adenocarcinoma	Homo sapiens	CVCL_6926
In-vivo Model	To create the xenograft neoplasm system, 40 male BALB/c nude mice aged 5 weeks were randomly separated into sh-NC, sh-circHPS5, sh-circHPS5+CTRL, and sh-circHPS5+SAH groups (n = 5 for each group). HCC cells were subcutaneously injected into the axilla of the nude mice.
Response Summary	In hepatocellular carcinoma, METTL3 could direct the formation of circHPS5, and specific m6A controlled the accumulation of circHPS5. YTHDC1 facilitated the cytoplasmic output of circHPS5 under m6A modification. CircHPS5 can act as a miR-370 sponge to regulate the expression of High mobility group protein HMGI-C (HMGA2) and further accelerate hepatocellular carcinoma cell tumorigenesis.

Programmed cell death 1 ligand 1 (CD274/PD-L1)

Target Gene

Prostate cancer [ICD-11: 2C82]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[11]
Responsed Disease	Prostate cancer [ICD-11: 2C82]
Target Regulation	Up regulation
In-vitro Model	RWPE-1	Normal	Homo sapiens	CVCL_3791
	DU145	Prostate carcinoma	Homo sapiens	CVCL_0105
	PC-3	Prostate carcinoma	Homo sapiens	CVCL_0035
	LNCaP	Prostate carcinoma	Homo sapiens	CVCL_0395
	VCaP	Prostate carcinoma	Homo sapiens	CVCL_2235

Serine/arginine-rich splicing factor 6 (SRSF6)

Target Gene

Brain cancer [ICD-11: 2A00]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[6]
Responsed Disease	Glioblastoma [ICD-11: 2A00.00]
Target Regulation	Up regulation
Pathway Response	RNA degradation			hsa03018
Cell Process	mRNA decay
In-vitro Model	U251 (Fibroblasts or fibroblast like cells)
	U-87MG ATCC	Glioblastoma	Homo sapiens	CVCL_0022
In-vivo Model	For subcutaneous tumor model, each mouse was injected subcutaneously in the right flank with 2 × 10⁶ U87MG cells (METTL3-KD or control) in 100 uL PBS.
Response Summary	Silencing METTL3 or overexpressing dominant-negative mutant METTL3 suppressed the growth and self-renewal of Glioblastoma cells. Integrated transcriptome and MeRIP-seq analyses revealed that downregulating the expression of METTL3 decreased m6A modification levels of Serine/arginine-rich splicing factor 6 (SRSF6), which led to YTHDC1-dependent NMD of SRSF transcripts and decreased SRSF protein expression.

Vacuolar protein-sorting-associated protein 25 (VPS25)

Target Gene

Brain cancer [ICD-11: 2A00]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[13]
Responsed Disease	Glioma [ICD-11: 2A00.0]
Target Regulation	Down regulation
Pathway Response	JAK-STAT signaling pathway			hsa04630
Cell Process	Arrest cell cycle at G0/G1 phase
	Cell apoptosis
In-vitro Model	U251 (Fibroblasts or fibroblast like cells)
	U-87MG ATCC	Glioblastoma	Homo sapiens	CVCL_0022
In-vivo Model	The U87MG cells (1 × 10⁷ cells in 0.1 ml PBS) were injected subcutaneously into BALB/c nude mice. Tumor width and length were recorded every 5 days.
Response Summary	YTHDC1 inhibited glioma proliferation by reducing the expression of Vacuolar protein-sorting-associated protein 25 (VPS25).

Vascular endothelial growth factor A (VEGFA)

Target Gene

Colorectal cancer [ICD-11: 2B91]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[14]
Responsed Disease	Colorectal cancer [ICD-11: 2B91]
Target Regulation	Up regulation
In-vitro Model	SW480	Colon adenocarcinoma	Homo sapiens	CVCL_0546
In-vitro Model	HCT 116	Colon carcinoma	Homo sapiens	CVCL_0291
In-vivo Model	The cells were then washed with PBS and digested with trypsin. After counting, 1 × 10⁶ cells were injected subcutaneously into the flank regions of female BALB/c nude mice (4-6 weeks) to establish a subcutaneous implantation model. After 4 weeks, the volume and weight of the tumors were measured after the mice were sacrificed by CO2 inhalation and cervical dislocation.

FOXF1 adjacent non-coding developmental regulatory RNA (FENDRR)

Target Gene

Pulmonary hypertension [ICD-11: BB01]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[15]
Responsed Disease	Hypoxic pulmonary hypertension [ICD-11: BB01.2]
Target Regulation	Down regulation
In-vivo Model	An aliquot of the vector at 1011genome equivalents was prepared in 20-30 μL of HBSS and isoflurane anesthesia followed by nasal drops. Mice were randomly divided into five groups as follows: normoxic environment plus control vector group (NOR + NC, n = 20), hypoxic environment plus control vector group (HYP + NC, n = 10), hypoxic environment plus FENDRR TFO2 adenovirus group (HYP + FENDRR TFO2, n = 10), normoxic environment plus FENDRR TFO2 adenovirus group (NOR + FENDRR TFO2, n = 10).

Maternally expressed 3 (MEG3)

Target Gene

Head and neck squamous carcinoma [ICD-11: 2B6E]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[16]
Responsed Disease	Oral squamous cell carcinoma [ICD-11: 2B6E.0]
In-vitro Model	SCC-9	Tongue squamous cell carcinoma	Homo sapiens	CVCL_1685
	SCC-25	Tongue squamous cell carcinoma	Homo sapiens	CVCL_1682
	CAL-27	Tongue squamous cell carcinoma	Homo sapiens	CVCL_1107

Abortion [ICD-11: JA00]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[17]
Responsed Disease	Abortion [ICD-11: JA00.0]
In-vivo Model	Sexually mature ICR mice, aged at least 10 weeks, were paired as one female and one male per cage to obtain pregnancies. The time of the vaginal plug sighting was denoted as day 0.5 of the pregnancy. The mice were divided into an FTO protein group and control group, with 10 pairs of mice in each group. Starting on day 0.5 of the pregnancy, mice in the FTO protein group were intraperitoneally injected daily with FTO protein (3.5 ng/kg), whereas those in the control group had daily intraperitoneal injections of equal volumes of saline. Female mice were euthanised on day 13.5 of the pregnancy (day 12.5-14.5), and the total numbers of normal and resorbed embryos were determined, along with the rate of embryo resorption.

Nuclear paraspeckle assembly transcript 1 (NEAT1)

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[18]
Responsed Disease	Liver cancer [ICD-11: 2C12]
Target Regulation	Up regulation

Coronary atherosclerosis [ICD-11: BA52]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[19]
Responsed Disease	Coronary atherosclerosis [ICD-11: BA52.0]
Target Regulation	Up regulation

Atherosclerosis [ICD-11: BD40]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[19]
Responsed Disease	Atherosclerosis [ICD-11: BD40]
Target Regulation	Up regulation

Pvt1 oncogene (PVT1)

Target Gene

Chronic respiratory disease originating in the perinatal period [ICD-11: KB29]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[20]
Responsed Disease	Chronic respiratory disease originating in the perinatal period [ICD-11: KB29.0]
Target Regulation	Up regulation
In-vitro Model	MLE-12	N.A.	Mus musculus	CVCL_3751
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
In-vivo Model	Before hyperoxia treatment, mice in the BPD/PVT1 KO group were intratracheally instilled with 5 μL adenovirus vector expressing sh-PVT1 at a titer of 1 × 109 pfu/100 μL. Mice in the BPD/PVT1 KO + IL-33 group were intratracheally instilled with 5 μL adenovirus vector expressing sh-PVT1 and 5 μL adenovirus vector expressing IL-33.

microRNA 370 (MIR370)

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[10]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Pathway Response	Transcriptional misregulation in cancer			hsa05202
Cell Process	Epithelial-mesenchymal transition
	Cell autophagy
In-vitro Model	Hep 3B2.1-7	Childhood hepatocellular carcinoma	Homo sapiens	CVCL_0326
	L-02	Endocervical adenocarcinoma	Homo sapiens	CVCL_6926
In-vivo Model	To create the xenograft neoplasm system, 40 male BALB/c nude mice aged 5 weeks were randomly separated into sh-NC, sh-circHPS5, sh-circHPS5+CTRL, and sh-circHPS5+SAH groups (n = 5 for each group). HCC cells were subcutaneously injected into the axilla of the nude mice.
Response Summary	In hepatocellular carcinoma, METTL3 could direct the formation of circHPS5, and specific m6A controlled the accumulation of circHPS5. YTHDC1 facilitated the cytoplasmic output of circHPS5 under m6A modification. CircHPS5 can act as a microRNA 370 (MIR370) sponge to regulate the expression of HMGA2 and further accelerate hepatocellular carcinoma cell tumorigenesis.

hsa-miR-30d

Target Gene

Pancreatic cancer [ICD-11: 2C10]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[21]
Responsed Disease	Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
Pathway Response	Central carbon metabolism in cancer			hsa05230
Pathway Response	Glycolysis / Gluconeogenesis			hsa00010
Cell Process	Glycolysis
In-vitro Model	SW1990	Pancreatic adenocarcinoma	Homo sapiens	CVCL_1723
	PANC-1	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0480
	MIA PaCa-2	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0428
	HPNE (Pancreatic ductal adenocarcinoma cell line HPNE were a gift from Dr. Lingye Tao from Renji hospital)
	HPAC	Pancreatic adenocarcinoma	Homo sapiens	CVCL_3517
	CFPAC-1	Cystic fibrosis	Homo sapiens	CVCL_1119
	Capan-2	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0026
	Capan-1	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0237
	BxPC-3	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0186
	AsPC-1	Pancreatic ductal adenocarcinoma	Homo sapiens	CVCL_0152
In-vivo Model	To study the effect of miR-30d on liver metastasis of PDACs, 5 × 10⁶ cells in 50 uL of PBS were injected into the spleens of nude mice (6 mice per group). Anesthetized mice were injected intraperitoneally with D-luciferin (150 mg/kg) every other week and imaged using an IVIS 100 imaging system (Xenogen, CA, USA) 10 min after the injection. The mice were sacrificed and their liver metastases were checked by standard histological examination 8-9 weeks after injection.
Response Summary	MiR-30d is a novel target for YTHDC1 through m6A modification, and hsa-miR-30d represses pancreatic ductal adenocarcinoma tumorigenesis via suppressing aerobic glycolysis.

hsa_circ_0021427 (circ_HPS5)

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[10]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Up regulation
Pathway Response	Transcriptional misregulation in cancer			hsa05202
Cell Process	Epithelial-mesenchymal transition
	Cell autophagy
In-vitro Model	Hep 3B2.1-7	Childhood hepatocellular carcinoma	Homo sapiens	CVCL_0326
	L-02	Endocervical adenocarcinoma	Homo sapiens	CVCL_6926
In-vivo Model	To create the xenograft neoplasm system, 40 male BALB/c nude mice aged 5 weeks were randomly separated into sh-NC, sh-circHPS5, sh-circHPS5+CTRL, and sh-circHPS5+SAH groups (n = 5 for each group). HCC cells were subcutaneously injected into the axilla of the nude mice.
Response Summary	In hepatocellular carcinoma, METTL3 could direct the formation of circHPS5, and specific m6A controlled the accumulation of circHPS5. YTHDC1 facilitated the cytoplasmic output of hsa_circ_0021427 (circHPS5) under m6A modification. CircHPS5 can act as a miR-370 sponge to regulate the expression of HMGA2 and further accelerate hepatocellular carcinoma cell tumorigenesis.

hsa_circ_0058493 (Circ_RHBDD1)

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[22]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Up regulation
Pathway Response	Hepatocellular carcinoma			hsa05225
Cell Process	Cell growth and metastasis
In-vitro Model	BEL-7404	Endocervical adenocarcinoma	Homo sapiens	CVCL_6568
	HCCLM3	Adult hepatocellular carcinoma	Homo sapiens	CVCL_6832
	L-02	Endocervical adenocarcinoma	Homo sapiens	CVCL_6926
	MHCC97-H	Adult hepatocellular carcinoma	Homo sapiens	CVCL_4972
	SK-HEP-1	Liver and intrahepatic bile duct epithelial neoplasm	Homo sapiens	CVCL_0525
	SMMC-7721	Endocervical adenocarcinoma	Homo sapiens	CVCL_0534
In-vivo Model	Groups of HCT116-Luc-shCtrl, HCT116-Luc-shLINC00460, and HCT116-Luc-shLINC00460 + HMGA1 cells (5 × 10⁶) were injected subcutaneously into the flanks of mice correspondingly.
Response Summary	In hepatocellular carcinoma, hsa_circ_0058493 contained m6A methylation sites and that METTL3 mediated the degree of methylation modification of hsa_circ_0058493. YTHDC1 could bind to hsa_circ_0058493 and promote its intracellular localization from the nucleus to the cytoplasm.

hsa_circ_0092493 (circ_ARL3)

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[23]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Up regulation
Cell Process	Reverse splicing and biogenesis
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
In-vivo Model	Mice were randomly divided into three groups, and subcutaneously injected with control, circ-ARL3-silenced and circ-ARL3&miR-1305-silenced HepG2.2.15 cells.
Response Summary	hsa_circ_0092493 (circ_ARL3) is a critical regulator in HBV-related HCC, targeting the axis of circ-ARL3/miR-1305 can be a promising treatment for HBV+ HCC patients. HBx protein upregulated N6 -methyladenosine (m6A) methyltransferases METTL3 expression, increasing the m6A modification of circ-ARL3; then, m6A reader YTHDC1 bound to m6A-modified of circ-ARL3 and favored its reverse splicing and biogenesis. Furthermore, circ-ARL3 was able to sponge miR-1305, antagonizing the inhibitory effects of miR-1305 on a cohort of target oncogenes, thereby promoting HBV+ HCC progression.

Annexin A1 (ANXA1)

Target Gene

Clear cell renal cell carcinoma [ICD-11: XH46F1]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[24]
Responsed Disease	Clear cell renal cell carcinoma [ICD-11: XH46F1]
Target Regulation	Down regulation

ATP8B1 antisense RNA 1 (ATP8B1-AS1)

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[25]
Responsed Disease	Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Up regulation
In-vitro Model	THLE-2	Normal	Homo sapiens	CVCL_3803
In-vitro Model	SNU-398	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0077
In-vivo Model	Indicated HCC cells were subcutaneously inoculated into the flank of 5-week-old male BALB/C athymic mice, which were purchased from Shanghai SLAC Laboratory Animal Co. and fed in specific pathogen-free condition. Subcutaneous tumor volumes were measured every week and calculated using the formula 0.5×length×width2. At the 28th day after inoculation, subcutaneous tumors were resected, weighed, and photographed. This study was approved by Affiliated Hospital of Youjiang Medical University for Nationalities Institutional Review Board.

Chromatin-associated RNAs (caRNAs)

Target Gene

Malignant haematopoietic neoplasm [ICD-11: 2B33]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[26]
Responsed Disease	Myeloid leukaemia [ICD-11: 2B33.1]
Target Regulation	Down regulation
Cell Process	Cell survival
	Cell proliferation
	Cell differentiation
	Cell invasion
	Apoptosis

Circ_EPHB4

Target Gene

Brain cancer [ICD-11: 2A00]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[27]
Responsed Disease	Glioma [ICD-11: 2A00.0]
Target Regulation	Up regulation

Circ_IGF2BP3

Target Gene

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[28]
Responsed Disease	Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation	Up regulation
Pathway Response	PD-L1 expression and PD-1 checkpoint pathway in cancer			hsa05235
Cell Process	Immunity
In-vitro Model	SW900	Lung squamous cell carcinoma	Homo sapiens	CVCL_1731
	SK-MES-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_0630
	NCI-H520	Lung squamous cell carcinoma	Homo sapiens	CVCL_1566
	NCI-H1975	Lung adenocarcinoma	Homo sapiens	CVCL_1511
	NCI-H1703	Lung squamous cell carcinoma	Homo sapiens	CVCL_1490
	NCI-H1650	Minimally invasive lung adenocarcinoma	Homo sapiens	CVCL_1483
	HEK293T	Normal	Homo sapiens	CVCL_0063
	BEAS-2B	Normal	Homo sapiens	CVCL_0168
	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	16HBE14o-	Normal	Homo sapiens	CVCL_0112
In-vivo Model	A total of 10⁶ LLC cells transfected with the following constructs were injected subcutaneously into C57BL/6 mice.
Response Summary	In non-small-cell lung carcinoma, METTL3 mediates the N6-methyladenosine (m6A) modification of Circ_IGF2BP3 and promotes its circularization in a manner dependent on the m6A reader protein YTHDC1.

Circ_MPP1

Target Gene

Disorders of newborn related to slow fetal growth or fetal malnutrition [ICD-11: KA20]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[29]
Responsed Disease	Disorders of newborn related to slow fetal growth or fetal malnutrition [ICD-11: KA20.1]
Target Regulation	Down regulation
Pathway Response	NF-kappa B signaling pathway			hsa04064
	MAPK signaling pathway			hsa04010
In-vitro Model	JEG-3	Gestational choriocarcinoma	Homo sapiens	CVCL_0363

Circ_TET2

Target Gene

Leukemogenesis [ICD-11: 2A82]

In total 3 item(s) under this disease			Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene			[30]
Responsed Disease	Chronic lymphocytic leukemia [ICD-11: 2A82.0]
Responsed Drug	CP028	Investigative	Drug Info
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene			[30]
Responsed Disease	Chronic lymphocytic leukemia [ICD-11: 2A82.0]
Responsed Drug	Dactolisib	Investigative	Drug Info
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene			[30]
Responsed Disease	Chronic lymphocytic leukemia [ICD-11: 2A82.0]
Responsed Drug	Perhexiline	Approved	Drug Info

Cleavage and polyadenylation specificity factor subunit 6 (CPSF6)

Target Gene

Type 2 diabetes mellitus [ICD-11: 5A11]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[12]
Responsed Disease	Type 2 diabetes mellitus [ICD-11: 5A11]
In-vitro Model	MIN6	Mouse insulinoma	Mus musculus	CVCL_0431
In-vivo Model	Ythdc1flox/flox mice were maintained on a C57BL/6 background and normal chow. Ythdc1flox/flox mice were then crossed to a transgenic mouse line with MIP-CreERT [33]. MIP-CreERT mice have been described previously [15]. At the age of 10 weeks, both male and female mice were intraperitoneally injected with 100 mg/kg tamoxifen (T5648, Sigma) every other day for 3 times to delete Ythdc1 in beta-cells. Intraperitoneal glucose tolerance tests were performed on mice at age of 15 weeks after a 5-hour fast (2 g/kg dextrose). Insulin levels were measured at 0, 15 and 30 min after glucose challenge. Insulin tolerance tests were performed after a 5-hour fast by administering human recombinant insulin (0.75 U/kg).

Elongation factor Ts, mitochondrial (TSFM)

Target Gene

Ovarian cancer [ICD-11: 2C73]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[31]
Responsed Disease	Ovarian cancer [ICD-11: 2C73]
Target Regulation	Down regulation
In-vitro Model	A2780	Ovarian endometrioid adenocarcinoma	Homo sapiens	CVCL_0134
	Caov-3	Ovarian serous adenocarcinoma	Homo sapiens	CVCL_0201
	HO-8910	Endocervical adenocarcinoma	Homo sapiens	CVCL_6868
	OVCAR-3	Ovarian serous adenocarcinoma	Homo sapiens	CVCL_0465
In-vivo Model	In order to develop a xenograft model, 12 nude mice (1 × 10⁷cells per 200 μL of FBS-free medium) were injected subcutaneously with CAOV3 cells.

FAM111A divergent transcript (FAM111A-DT)

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[32]
Responsed Disease	Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Up regulation
In-vitro Model	SK-HEP-1	Liver and intrahepatic bile duct epithelial neoplasm	Homo sapiens	CVCL_0525
	Huh-7	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0336
	Hep 3B2.1-7	Childhood hepatocellular carcinoma	Homo sapiens	CVCL_0326
	SNU-398	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0077
	THLE-2	Normal	Homo sapiens	CVCL_3803
	THLE-3	Normal	Homo sapiens	CVCL_3804

Guanine nucleotide exchange factor C9orf72 (C9ORF72)

Target Gene

Frontotemporal dementia [ICD-11: 6D83]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[33]
Responsed Disease	Frontotemporal dementia [ICD-11: 6D83]
Target Regulation	Down regulation
In-vitro Model	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
In-vitro Model	HEK293T	Normal	Homo sapiens	CVCL_0063

Motor neuron disease [ICD-11: 8B60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[33]
Responsed Disease	Amyotrophic lateral sclerosis [ICD-11: 8B60.0]
Target Regulation	Down regulation
In-vitro Model	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
In-vitro Model	HEK293T	Normal	Homo sapiens	CVCL_0063

Histone-lysine N-methyltransferase 2C (KMT2C)

Target Gene

B-cell acute lymphoblastic leukemia [ICD-11: XH8NN2]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[34]
Responsed Disease	B-cell acute lymphoblastic leukemia [ICD-11: XH8NN2]
Target Regulation	Up regulation

Interleukin-33 (IL33)

Target Gene

Chronic respiratory disease originating in the perinatal period [ICD-11: KB29]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[20]
Responsed Disease	Chronic respiratory disease originating in the perinatal period [ICD-11: KB29.0]
Target Regulation	Up regulation
In-vitro Model	MLE-12	N.A.	Mus musculus	CVCL_3751
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
In-vivo Model	Before hyperoxia treatment, mice in the BPD/PVT1 KO group were intratracheally instilled with 5 μL adenovirus vector expressing sh-PVT1 at a titer of 1 × 109 pfu/100 μL. Mice in the BPD/PVT1 KO + IL-33 group were intratracheally instilled with 5 μL adenovirus vector expressing sh-PVT1 and 5 μL adenovirus vector expressing IL-33.

Lnc668

Target Gene

Silicosis [ICD-11: CA60]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[35]
Responsed Disease	Pulmonary fibrosis [ICD-11: CA60]
Target Regulation	Up regulation

long intergenic non-protein coding RNA 294 (LINC00294)

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[36]
Responsed Disease	Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Up regulation
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	PLC/PRF/5	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0485
	MHCC97-H	Adult hepatocellular carcinoma	Homo sapiens	CVCL_4972
	Huh-7	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0336
	Hep 3B2.1-7	Childhood hepatocellular carcinoma	Homo sapiens	CVCL_0326

long intergenic non-protein coding RNA 641 (LINC00641)

Target Gene

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[37]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Target Regulation	Up regulation
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	NCI-H1299	Lung large cell carcinoma	Homo sapiens	CVCL_0060
	NCI-H1975	Lung adenocarcinoma	Homo sapiens	CVCL_1511
	HBE1	N.A.	Homo sapiens	CVCL_0287
In-vivo Model	A549 cells (5 × 10⁶) with LINC00641 stable knockdown or control were suspended in 200 μL of 50% Matrigel (Corning), then injected subcutaneously into the flanks of the nude mice. For the metastatic tumor model, the male BALB/c-nude mice weighing 18-23 g were randomly divided into two groups. A549 cells with LINC00641 stable knockdown or control were injected into the tail veins of the nude mice (2 × 10⁶ cells per mice).

Long non-coding RNA epigenetically activating Wnt/beta-catenin signalling in HCC (LEAWBIH)

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[38]
Responsed Disease	Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Up regulation
Pathway Response	Wnt signaling pathway			hsa04310
In-vitro Model	THLE-2	Normal	Homo sapiens	CVCL_3803
	SK-HEP-1	Liver and intrahepatic bile duct epithelial neoplasm	Homo sapiens	CVCL_0525
	Huh-7	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0336
	Hep 3B2.1-7	Childhood hepatocellular carcinoma	Homo sapiens	CVCL_0326

Long-chain-fatty-acid--CoA ligase 4 (ACSL4)

Target Gene

Injury of blood vessels of thorax [ICD-11: NB30]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[39]
Responsed Disease	Sepsis-associated lung injury [ICD-11: NB30.4]
Target Regulation	Down regulation
In-vitro Model	MLE-12	N.A.	Mus musculus	CVCL_3751

miR-181a

Target Gene

Low bone mass disorder [ICD-11: FB83]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[40]
Responsed Disease	Osteoporosis [ICD-11: FB83.1]
Target Regulation	Up regulation

miR-181c

Target Gene

Low bone mass disorder [ICD-11: FB83]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[40]
Responsed Disease	Osteoporosis [ICD-11: FB83.1]
Target Regulation	Up regulation

Paired box protein Pax-8 (PAX8)

Target Gene

Thyroid Cancer [ICD-11: 2D10]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[41]
Responsed Disease	Thyroid Cancer [ICD-11: 2D10]
Responsed Drug	Sodium iodide I 131		Approved	Drug Info
Target Regulation	Up regulation
In-vitro Model	B-CPAP	Thyroid gland carcinoma	Homo sapiens	CVCL_0153
	KTC-1	Thyroid carcinoma	Homo sapiens	CVCL_6300
	TPC-1	Thyroid gland papillary carcinoma	Homo sapiens	CVCL_6298
	K1	Thyroid gland papillary carcinoma	Homo sapiens	CVCL_2537
	CAL-62	Thyroid gland anaplastic carcinoma	Homo sapiens	CVCL_1112
	C-643	Thyroid gland anaplastic carcinoma	Homo sapiens	CVCL_5969
	Nthy-ori 3-1	Normal	Homo sapiens	CVCL_2659
In-vivo Model	A concentration of 1 × 10⁷ CAL62 cells stably transfected with OE METTL3 or OE METTL3/shPAX8-transfected CAL-62 cells were injected subcutaneously into the dorsal flanks of the mice (five mice per group) to establish a xenograft model.

Phosphatidylinositol 3-kinase regulatory subunit alpha (PIK3R1)

Target Gene

Ovarian cancer [ICD-11: 2C73]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[42]
Responsed Disease	Ovarian cancer [ICD-11: 2C73]
Target Regulation	Up regulation
Pathway Response	JAK-STAT signaling pathway			hsa04630
In-vitro Model	HEK293T	Normal	Homo sapiens	CVCL_0063
	SK-OV-3	Ovarian serous cystadenocarcinoma	Homo sapiens	CVCL_0532
	OVCAR-3	Ovarian serous adenocarcinoma	Homo sapiens	CVCL_0465
	A2780	Ovarian endometrioid adenocarcinoma	Homo sapiens	CVCL_0134

PncRNA-D

Target Gene

Liposarcoma [ICD-11: 2B59]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[43]
Responsed Disease	Liposarcoma [ICD-11: 2B59]
Target Regulation	Down regulation
Pathway Response	Cell cycle			hsa04110
Cell Process	Cell cycle
In-vitro Model	HAP1	Chronic myelogenous leukemia	Homo sapiens	CVCL_Y019
In-vitro Model	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
Response Summary	Knockdown of METTL3 prolonged the half-life of PncRNA-D, and among the known m6A recognition proteins, YTHDC1 was responsible for binding m6A of pncRNA-D Knockdown of METTL3 or YTHDC1 also enhanced the interaction of pncRNA-D with TLS, and results from RNA pulldown assays implicated YTHDC1 in the inhibitory effect on the TLS-pncRNA-D interaction.

Protein E6 (E6)

Target Gene

Malignant neoplasms of tonsil [ICD-11: 2B69]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[44]
Responsed Disease	Malignant neoplasms of tonsil [ICD-11: 2B69]
Target Regulation	Up regulation
In-vitro Model	WSU-HN26	Squamous cell carcinoma of the oral cavity	Homo sapiens	CVCL_5523
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	C33A2 (The C33A2 cell line originates from C33A and has the subgenomic HPV16 plasmid pBELsLuc stably integrated into the genome)
Response Summary	Overexpression of the ALKBH5 promoted production of intron retention on the human papillomavirus type 16 (HPV16) E6 mRNAs thereby promoting Protein E6 (E6) mRNA production. METLL3 induced production of intron-containing HPV16 E1 mRNAs over spliced E2 mRNAs and altered HPV16 L1 mRNA splicing in a manner opposite to ALKBH5. Overexpression of YTHDC1, enhanced retention of the E6-encoding intron and promoted E6 mRNA production. HPV16 mRNAs are m6A-methylated in tonsillar cancer cells.

Retinoic Acid Receptor Alpha-Retinoic Acid Receptor Alpha (PML-RARalpha)

Target Gene

Brain cancer [ICD-11: 2A00]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[8]
Responsed Disease	Glioblastoma [ICD-11: 2A00.00]
Target Regulation	Up regulation
Cell Process	Cell differentiation

RNA, U1 small nuclear 8, pseudogene (RNU1-8P)

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[45]
Responsed Disease	Intrahepatic cholangiocarcinoma [ICD-11: 2C12.10]
Target Regulation	Up regulation
In-vitro Model	HuCC-T1	Intrahepatic cholangiocarcinoma	Homo sapiens	CVCL_0324

Ubiquitin-like-conjugating enzyme ATG10 (ATG10)

Target Gene

Acute ischemic stroke [ICD-11: 8B11]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[47]
Responsed Disease	Acute ischemic stroke [ICD-11: 8B11]
Target Regulation	Down regulation
In-vitro Model	SH-SY5Y	Neuroblastoma	Homo sapiens	CVCL_0019

Unspecific Target Gene

Prostate cancer [ICD-11: 2C82]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[48]
Responsed Disease	Prostate cancer [ICD-11: 2C82]
Cell Process	Cell migration
	Cell invasion
In-vitro Model	PC-3	Prostate carcinoma	Homo sapiens	CVCL_0035
	DU145	Prostate carcinoma	Homo sapiens	CVCL_0105
Response Summary	Knockdown of HNRNPA2B1 or FTO prominently inhibited prostate cancer cells migration and invasion in vitro experiment. Determined CBLL1, FTO, YTHDC1, HNRNPA2B1 as crucial m6A regulators of prostate cancer.

Epilepsy due to structural or metabolic conditions or diseases [ICD-11: 8A60]

In total 1 item(s) under this disease			Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene			[49]
Responsed Disease	Epilepsy due to structural or metabolic conditions or diseases [ICD-11: 8A60.5]
Responsed Drug	Betaine	Approved	Drug Info
Target Regulation	Down regulation
In-vivo Model	Mice were treated with a single i.p. injection of pentylenetetrazol (PTZ, Sigma-Aldrich, P6500) at a dose of 50 mg/kg to establish the animal model of acute seizures [16]. Betaine (Sigma-Aldrich, B2629) was dissolved in normal saline, and administrated at a dose of 200 mg/kg or 600 mg/kg, i.p., to mice for 14 days before PTZ injection in reference to a previous study.

Acute ischemic stroke [ICD-11: 8B11]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[50]
Responsed Disease	Acute ischemic stroke [ICD-11: 8B11]
In-vivo Model	36 male C57BL/6J mice (20-22 g, 2-month-old) were purchased from SPF (Beijing) biotechnology co., Ltd (Beijing, China) and maintained in the specific pathogen-free (SPF) animal laboratory with a 12/12 h light/dark cycle with free access to food and water. The mice were randomly assigned into six groups (n = 6 per group): (1) sham-operated group (Sham), (2) MCAO 6 h, (3) MCAO 12 h, (4) MCAO 1 d, (5) MCAO 3 d, and (6) MCAO 7 d.

Asthma [ICD-11: CA23]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[51]
Responsed Disease	Asthma [ICD-11: CA23]
In-vivo Model	Modelled two groups of female 6-week-old BALB/C mice: severe asthma group and blank control group (n = 3 per group). They had the same feeding conditions and growth environment. Immunization solution: Dissolve 20 mg ovalbumin (OVA) in 1 ml normal saline (NS), after OVA is completely dissolved, dilute 0.4-10 ml and mix well, then it was mixed with the same volume of liquid aluminium adjuvant and placed on a shaking table at 4℃ for 30 min. Challenge solution: Add 0.5 g OVA into 10 ml NS, fully dissolve it, and shake it on a shaking table at 4℃ for 30 min. Immunization: Mice were injected intraperitoneally on days 0 and 12, each with 0.2 ml; the control group was treated with equal volume of normal saline. Challenge: On days 18-23, the mice were atomized by ultrasound in a closed container at a dose of 10 ml once a day for 20 min. Lung tissue was taken 24 h after the last atomization and immediately stored in liquid nitrogen.
Response Summary	m6A(YTHDF3 and YTHDC1) modification plays a key role in severe asthma, and is able to guide the future strategy of immunotherapy.

Epithelial membrane protein 3 (EMP3)

Target Gene

Doxil [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[9]
Responsed Disease	Breast cancer		ICD-11: 2C60	Disease Info
Target Regulation	Down regulation
Pathway Response	Nucleotide excision repair			hsa03420
	mTOR signaling pathway			hsa04150
	PI3K-Akt signaling pathway			hsa04151
Cell Process	DNA repair
In-vitro Model	BT-474	Invasive breast carcinoma	Homo sapiens	CVCL_0179
	Hs 578T	Invasive breast carcinoma	Homo sapiens	CVCL_0332
	MCF-7	Invasive breast carcinoma	Homo sapiens	CVCL_0031
	MDA-MB-231	Breast adenocarcinoma	Homo sapiens	CVCL_0062
	SK-BR-3	Breast adenocarcinoma	Homo sapiens	CVCL_0033
Response Summary	Epithelial membrane protein 3 (EMP3) blocks Akt-mTOR signaling activation and induces autophagy. EMP3 downregulates YTHDC1, which at least in part mediates the effects of EMP3 on breast cancer cells. EMP3 sensitizes breast cancer cells to the DNA-damaging drug Adriamycin. EMP3 downregulation can be responsible for breast cancer chemoresistance.

Circ_TET2

Target Gene

CP028 [Investigative]

In total 1 item(s) under this drug			Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene			[30]
Responsed Disease	Chronic lymphocytic leukemia	ICD-11: 2A82.0	Disease Info

Dactolisib [Investigative]

In total 1 item(s) under this drug			Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene			[30]
Responsed Disease	Chronic lymphocytic leukemia	ICD-11: 2A82.0	Disease Info

Perhexiline [Approved]

In total 1 item(s) under this drug			Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene			[30]
Responsed Disease	Chronic lymphocytic leukemia	ICD-11: 2A82.0	Disease Info

Paired box protein Pax-8 (PAX8)

Target Gene

Sodium iodide I 131 [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[41]
Responsed Disease	Thyroid Cancer		ICD-11: 2D10	Disease Info
Target Regulation	Up regulation
In-vitro Model	B-CPAP	Thyroid gland carcinoma	Homo sapiens	CVCL_0153
	KTC-1	Thyroid carcinoma	Homo sapiens	CVCL_6300
	TPC-1	Thyroid gland papillary carcinoma	Homo sapiens	CVCL_6298
	K1	Thyroid gland papillary carcinoma	Homo sapiens	CVCL_2537
	CAL-62	Thyroid gland anaplastic carcinoma	Homo sapiens	CVCL_1112
	C-643	Thyroid gland anaplastic carcinoma	Homo sapiens	CVCL_5969
	Nthy-ori 3-1	Normal	Homo sapiens	CVCL_2659
In-vivo Model	A concentration of 1 × 10⁷ CAL62 cells stably transfected with OE METTL3 or OE METTL3/shPAX8-transfected CAL-62 cells were injected subcutaneously into the dorsal flanks of the mice (five mice per group) to establish a xenograft model.

S-mu-GLT (SugLT)

Target Gene

Tamoxifen [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[46]
Target Regulation	Up regulation
Pathway Response	Nucleotide excision repair			hsa03420
Cell Process	DNA repair
In-vitro Model	CH12F3	Mouse lymphoma	Mus musculus	CVCL_E067
	CH12F3	Mouse lymphoma	Mus musculus	CVCL_E067
	HEK293T	Normal	Homo sapiens	CVCL_0063
In-vivo Model	6- to 12-week-old mice were used for experiments.
Response Summary	Direct suppression of m6A modification of S-mu-GLT (SugLT) or of m6A reader YTHDC1 reduces CSR. METTL3 enzyme-catalyzed N6-methyladenosine (m6A) RNA modification drives recognition and 3' end processing of S-mu-GLT by the RNA exosome, promoting class switch recombination and suppressing chromosomal translocations. Tamoxifen affects the role of METTL3 in B cell development.

Unspecific Target Gene

Betaine [Approved]

In total 1 item(s) under this drug			Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene			[49]
Responsed Disease	Epilepsy due to structural or metabolic conditions or diseases	ICD-11: 8A60.5	Disease Info
Target Regulation	Down regulation
In-vivo Model	Mice were treated with a single i.p. injection of pentylenetetrazol (PTZ, Sigma-Aldrich, P6500) at a dose of 50 mg/kg to establish the animal model of acute seizures [16]. Betaine (Sigma-Aldrich, B2629) was dissolved in normal saline, and administrated at a dose of 200 mg/kg or 600 mg/kg, i.p., to mice for 14 days before PTZ injection in reference to a previous study.

Click to View Potential Drug Response of This Regulator

Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator

DNA modification

m6A Target: FOXF1 adjacent non-coding developmental regulatory RNA (FENDRR)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02013		Crosstalk Info
Regulated Target	Dynamin-1-like protein (DRP1)
Crosstalk relationship	m6A → DNA modification
Disease	Hypoxic pulmonary hypertension	Disease Info

Histone modification

m6A Target: Long-chain-fatty-acid--CoA ligase 4 (ACSL4)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03060		Crosstalk Info
Epigenetic Regulator	Histone acetyltransferase p300 (P300)
Regulated Target	Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship	Histone modification → m6A
Disease	Sepsis-associated lung injury	Disease Info
Crosstalk ID: M6ACROT03061		Crosstalk Info
Epigenetic Regulator	CREB-binding protein (CREBBP)
Regulated Target	Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship	Histone modification → m6A
Disease	Sepsis-associated lung injury	Disease Info

m6A Target: Maternally expressed 3 (MEG3)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03062		Crosstalk Info
Epigenetic Regulator	Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target	Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship	Histone modification → m6A
Disease	Oral squamous cell carcinoma	Disease Info
Crosstalk ID: M6ACROT05952		Crosstalk Info
Epigenetic Regulator	Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target	Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship	m6A → Histone modification
Disease	Abortion	Disease Info

m6A Target: FAM111A divergent transcript (FAM111A-DT)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03067		Crosstalk Info
Epigenetic Regulator	Lysine-specific demethylase 3B (KDM3B)
Regulated Target	Histone H3 lysine 9 dimethylation (H3K9me2)
Crosstalk relationship	m6A → Histone modification
Disease	Liver cancer	Disease Info
Crosstalk ID: M6ACROT03489		Crosstalk Info
Epigenetic Regulator	Histone acetyltransferase p300 (P300)
Regulated Target	Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship	Histone modification → m6A
Disease	Liver cancer	Disease Info

m6A Target: Endogenous Retrovirus-K (ERVK)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03093		Crosstalk Info
Epigenetic Regulator	Histone-lysine N-methyltransferase SETDB1 (SETDB1)
Regulated Target	Histone H3 lysine 9 trimethylation (H3K9me3)
Crosstalk relationship	m6A → Histone modification

m6A Target: LINE-1 retrotransposable element ORF1 protein (LINE1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03094		Crosstalk Info
Epigenetic Regulator	Histone-lysine N-methyltransferase SETDB1 (SETDB1)
Regulated Target	Histone H3 lysine 9 trimethylation (H3K9me3)
Crosstalk relationship	m6A → Histone modification

m6A Target: Annexin A1 (ANXA1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03121		Crosstalk Info
Epigenetic Regulator	Histone deacetylase 2 (HDAC2)
Crosstalk relationship	Histone modification → m6A
Disease	Clear cell renal cell carcinoma	Disease Info
Drug	Sunitinib	Drug Info

m6A Target: Nuclear paraspeckle assembly transcript 1 (NEAT1)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03136		Crosstalk Info
Epigenetic Regulator	Histone acetyltransferase p300 (P300)
Regulated Target	Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship	Histone modification → m6A
Disease	Liver cancer	Disease Info
Crosstalk ID: M6ACROT03137		Crosstalk Info
Epigenetic Regulator	Histone acetyltransferase p300 (P300)
Regulated Target	Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship	m6A → Histone modification
Disease	Liver cancer	Disease Info

m6A Target: Histone-lysine N-methyltransferase 2C (KMT2C)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03162		Crosstalk Info
Epigenetic Regulator	Histone-lysine N-methyltransferase 2C (KMT2C)
Regulated Target	Histone H3 lysine 4 monomethylation (H3K4me1)
Crosstalk relationship	m6A → Histone modification
Disease	B-cell acute lymphoblastic leukemia	Disease Info
Crosstalk ID: M6ACROT03163		Crosstalk Info
Epigenetic Regulator	Histone-lysine N-methyltransferase 2C (KMT2C)
Regulated Target	Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship	m6A → Histone modification
Disease	B-cell acute lymphoblastic leukemia	Disease Info

m6A Target: Polycomb protein EED (EED)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03178		Crosstalk Info
Epigenetic Regulator	Histone-lysine N-methyltransferase EZH2 (EZH2)
Regulated Target	Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship	m6A → Histone modification

m6A Target: ATP8B1 antisense RNA 1 (ATP8B1-AS1)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03192		Crosstalk Info
Epigenetic Regulator	Lysine-specific demethylase 3B (KDM3B)
Regulated Target	Histone H3 lysine 9 dimethylation (H3K9me2)
Crosstalk relationship	m6A → Histone modification
Disease	Liver cancer	Disease Info
Crosstalk ID: M6ACROT03488		Crosstalk Info
Epigenetic Regulator	Histone acetyltransferase p300 (P300)
Regulated Target	Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship	Histone modification → m6A
Disease	Liver cancer	Disease Info

m6A Target: long non-coding RNA epigenetically activating Wnt/beta-catenin signalling in HCC (LEAWBIH)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03214		Crosstalk Info
Epigenetic Regulator	Lysine-specific demethylase 3B (KDM3B)
Regulated Target	Histone H3 lysine 9 dimethylation (H3K9me2)
Crosstalk relationship	m6A → Histone modification
Disease	Liver cancer	Disease Info
Crosstalk ID: M6ACROT03487		Crosstalk Info
Epigenetic Regulator	Histone acetyltransferase p300 (P300)
Regulated Target	Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship	Histone modification → m6A
Disease	Liver cancer	Disease Info

m6A Target: Lnc668

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03226		Crosstalk Info
Epigenetic Regulator	Histone acetyltransferase p300 (P300)
Regulated Target	Histone H3 lysine 9 lactylation (H3K9la)
Crosstalk relationship	Histone modification → m6A
Disease	Pulmonary fibrosis	Disease Info

m6A Target: hsa_circ_0092493 (circ_ARL3)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03482		Crosstalk Info
Epigenetic Regulator	Histone acetyltransferase p300 (P300)
Regulated Target	Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship	Histone modification → m6A
Disease	Liver cancer	Disease Info

m6A Target: hsa_circ_0021427 (circ_HPS5)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03483		Crosstalk Info
Epigenetic Regulator	Histone acetyltransferase p300 (P300)
Regulated Target	Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship	Histone modification → m6A
Disease	Liver cancer	Disease Info

m6A Target: microRNA 370 (MIR370)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03484		Crosstalk Info
Epigenetic Regulator	Histone acetyltransferase p300 (P300)
Regulated Target	Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship	Histone modification → m6A
Disease	Liver cancer	Disease Info

m6A Target: High mobility group protein HMGI-C (HMGA2)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03485		Crosstalk Info
Epigenetic Regulator	Histone acetyltransferase p300 (P300)
Regulated Target	Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship	Histone modification → m6A
Disease	Liver cancer	Disease Info

m6A Target: hsa_circ_0058493 (Circ_RHBDD1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03486		Crosstalk Info
Epigenetic Regulator	Histone acetyltransferase p300 (P300)
Regulated Target	Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship	Histone modification → m6A
Disease	Liver cancer	Disease Info

m6A Target: long intergenic non-protein coding RNA 294 (LINC00294)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03490		Crosstalk Info
Epigenetic Regulator	Histone acetyltransferase p300 (P300)
Regulated Target	Histone H3 lysine 18 lactylation (H3K18la)
Crosstalk relationship	Histone modification → m6A
Disease	Liver cancer	Disease Info

m6A Target: Chromatin-associated RNAs (caRNAs)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05955		Crosstalk Info
Epigenetic Regulator	Polycomb Repressive Complex 2 (PRC2)
Regulated Target	Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship	m6A → Histone modification
Disease	Myeloid leukaemia	Disease Info

Non-coding RNA

m6A Target: Ubiquitin-like-conjugating enzyme ATG10 (ATG10)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05025		Crosstalk Info
Epigenetic Regulator	Colorectal neoplasia differentially expressed (CRNDE)
Regulated Target	YTH N6-methyladenosine RNA binding protein C1 (YTHDC1)
Crosstalk relationship	ncRNA → m6A
Disease	Acute ischemic stroke	Disease Info

m6A Target: Elongation factor Ts, mitochondrial (TSFM)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05106		Crosstalk Info
Epigenetic Regulator	piR-26441
Regulated Target	YTH N6-methyladenosine RNA binding protein C1 (YTHDC1)
Crosstalk relationship	ncRNA → m6A
Disease	Ovarian cancer	Disease Info

m6A Target: Angiopoietin-related protein 4 (ANGPTL4)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05124		Crosstalk Info
Epigenetic Regulator	MIR22 host gene (MIR22HG)
Regulated Target	YTH N6-methyladenosine RNA binding protein C1 (YTHDC1)
Crosstalk relationship	ncRNA → m6A

m6A Target: Paired box protein Pax-8 (PAX8)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05170		Crosstalk Info
Epigenetic Regulator	hsa-miR-493-5p
Regulated Target	Methyltransferase-like protein 3 (METTL3)
Crosstalk relationship	ncRNA → m6A
Disease	Thyroid Cancer	Disease Info
Drug	Sodium iodide I 131	Drug Info

m6A Target: PncRNA-D

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05422		Crosstalk Info
Epigenetic Regulator	PncRNA-D
Regulated Target	G1/S-specific cyclin-D1 (CCND1)
Crosstalk relationship	m6A → ncRNA
Disease	Liposarcoma	Disease Info

m6A Target: X inactive specific transcript (XIST)

Target Gene

In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05456		Crosstalk Info
Epigenetic Regulator	X inactive specific transcript (XIST)
Regulated Target	Glypican-4 (GPC4)
Crosstalk relationship	m6A → ncRNA
Crosstalk ID: M6ACROT06024		Crosstalk Info
Epigenetic Regulator	X inactive specific transcript (XIST)
Regulated Target	Transcriptional regulator ATRX (ATRX)
Crosstalk relationship	m6A → ncRNA

m6A Target: hsa_circ_0092493 (circ_ARL3)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05462		Crosstalk Info
Epigenetic Regulator	hsa_circ_0092493 (Circ_ARL3)
Regulated Target	microRNA 1305 (MIR1305)
Crosstalk relationship	m6A → ncRNA
Disease	Liver cancer	Disease Info

m6A Target: hsa_circ_0021427 (circ_HPS5)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05533		Crosstalk Info
Epigenetic Regulator	hsa_circ_0021427 (Circ_HPS5)
Regulated Target	hsa-miR-370-3p
Crosstalk relationship	m6A → ncRNA
Disease	Liver cancer	Disease Info

m6A Target: microRNA 370 (MIR370)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05535		Crosstalk Info
Epigenetic Regulator	MicroRNA 370 (MIR370)
Regulated Target	High mobility group protein HMGI-C (HMGA2)
Crosstalk relationship	m6A → ncRNA
Disease	Liver cancer	Disease Info

m6A Target: hsa_circ_0058493 (Circ_RHBDD1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05548		Crosstalk Info
Epigenetic Regulator	hsa_circ_0058493 (Circ_RHBDD1)
Crosstalk relationship	m6A → ncRNA
Disease	Liver cancer	Disease Info

m6A Target: S-mu-GLT (SugLT)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05553		Crosstalk Info
Epigenetic Regulator	S-mu-GLT (SugLT)
Crosstalk relationship	m6A → ncRNA
Drug	Tamoxifen*	Drug Info

m6A Target: Circ_IGF2BP3

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05577		Crosstalk Info
Epigenetic Regulator	Circ_IGF2BP3
Regulated Target	hsa-miR-3173-5p
Crosstalk relationship	m6A → ncRNA
Disease	Non-small cell lung cancer	Disease Info

m6A Target: hsa-miR-30d

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05634		Crosstalk Info
Epigenetic Regulator	hsa-miR-30d
Regulated Target	Runt-related transcription factor 1 (RUNX1)
Crosstalk relationship	m6A → ncRNA
Disease	Pancreatic ductal adenocarcinoma	Disease Info

m6A Target: Circ_MPP1

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05643		Crosstalk Info
Epigenetic Regulator	Circ_MPP1
Crosstalk relationship	m6A → ncRNA
Disease	Disorders of newborn related to slow fetal growth or fetal malnutrition	Disease Info

m6A Target: Pvt1 oncogene (PVT1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05647		Crosstalk Info
Epigenetic Regulator	Pvt1 oncogene (PVT1)
Regulated Target	Interleukin-33 (IL33)
Crosstalk relationship	m6A → ncRNA
Disease	Chronic respiratory disease originating in the perinatal period	Disease Info

m6A Target: ATP8B1 antisense RNA 1 (ATP8B1-AS1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05663		Crosstalk Info
Epigenetic Regulator	ATP8B1 antisense RNA 1 (ATP8B1-AS1)
Regulated Target	Myc proto-oncogene protein (MYC)
Crosstalk relationship	m6A → ncRNA
Disease	Liver cancer	Disease Info

m6A Target: RNA, U1 small nuclear 8, pseudogene (RNU1-8P)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05673		Crosstalk Info
Epigenetic Regulator	RNA, U1 small nuclear 8, pseudogene (RNU1-8P)
Crosstalk relationship	m6A → ncRNA
Disease	Intrahepatic cholangiocarcinoma	Disease Info

m6A Target: Circ_EPHB4

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05709		Crosstalk Info
Epigenetic Regulator	Circ_EPHB4
Regulated Target	Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship	m6A → ncRNA
Disease	Brain cancer	Disease Info

m6A Target: FAM111A divergent transcript (FAM111A-DT)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05711		Crosstalk Info
Epigenetic Regulator	FAM111A divergent transcript (FAM111A-DT)
Regulated Target	YTH N6-methyladenosine RNA binding protein C1 (YTHDC1)
Crosstalk relationship	m6A → ncRNA
Disease	Liver cancer	Disease Info

m6A Target: Circ_TET2

Target Gene

In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05719		Crosstalk Info
Epigenetic Regulator	Circ_TET2
Regulated Target	Heterogeneous nuclear ribonucleoprotein C (HNRNPC)
Crosstalk relationship	m6A → ncRNA
Disease	Chronic lymphocytic leukemia	Disease Info
Drug	CP028	Drug Info
Crosstalk ID: M6ACROT05720		Crosstalk Info
Epigenetic Regulator	Circ_TET2
Regulated Target	Heterogeneous nuclear ribonucleoprotein C (HNRNPC)
Crosstalk relationship	m6A → ncRNA
Disease	Chronic lymphocytic leukemia	Disease Info
Drug	dactolisib	Drug Info
Crosstalk ID: M6ACROT05721		Crosstalk Info
Epigenetic Regulator	Circ_TET2
Regulated Target	Heterogeneous nuclear ribonucleoprotein C (HNRNPC)
Crosstalk relationship	m6A → ncRNA
Disease	Chronic lymphocytic leukemia	Disease Info
Drug	perhexiline	Drug Info

m6A Target: Nuclear paraspeckle assembly transcript 1 (NEAT1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05730		Crosstalk Info
Epigenetic Regulator	Nuclear paraspeckle assembly transcript 1 (NEAT1)
Regulated Target	Krueppel-like factor 4 (KLF4)
Crosstalk relationship	m6A → ncRNA
Disease	Coronary atherosclerosis	Disease Info

m6A Target: miR-181a

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05754		Crosstalk Info
Epigenetic Regulator	miR-181a
Regulated Target	Secreted frizzled related protein 1 (SFRP1)
Crosstalk relationship	m6A → ncRNA
Disease	Osteoporosis	Disease Info

m6A Target: miR-181c

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05755		Crosstalk Info
Epigenetic Regulator	miR-181c
Regulated Target	Secreted frizzled related protein 1 (SFRP1)
Crosstalk relationship	m6A → ncRNA
Disease	Osteoporosis	Disease Info

m6A Target: Long intergenic non-protein coding RNA 294 (LINC00294)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05757		Crosstalk Info
Epigenetic Regulator	Long intergenic non-protein coding RNA 294 (LINC00294)
Regulated Target	YTH N6-methyladenosine RNA binding protein C1 (YTHDC1)
Crosstalk relationship	m6A → ncRNA
Disease	Liver cancer	Disease Info

m6A Target: Long intergenic non-protein coding RNA 641 (LINC00641)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05767		Crosstalk Info
Epigenetic Regulator	Long intergenic non-protein coding RNA 641 (LINC00641)
Regulated Target	ELAV-like protein 1 (HuR/ELAVL1)
Crosstalk relationship	m6A → ncRNA
Disease	Lung cancer	Disease Info

m6A Target: Maternally expressed 3 (MEG3)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05831		Crosstalk Info
Epigenetic Regulator	Maternally expressed 3 (MEG3)
Regulated Target	Histone-lysine N-methyltransferase EZH2 (EZH2)
Crosstalk relationship	m6A → ncRNA
Disease	Abortion	Disease Info

m6A Target: Lnc668

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05871		Crosstalk Info
Epigenetic Regulator	Lnc668
Regulated Target	Phosphatidylinositol-binding clathrin assembly protein (PICALM)
Crosstalk relationship	m6A → ncRNA
Disease	Pulmonary fibrosis	Disease Info

m6A Target: Retinoic Acid Receptor Alpha-Retinoic Acid Receptor Alpha (PML-RARalpha)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05881		Crosstalk Info
Epigenetic Regulator	Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Regulated Target	YTH N6-methyladenosine RNA binding protein C1 (YTHDC1)
Crosstalk relationship	ncRNA → m6A
Disease	Glioblastoma	Disease Info

m6A Target: Hexokinase-2 (HK2)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05900		Crosstalk Info
Epigenetic Regulator	Long intergenic non-protein coding RNA 294 (LINC00294)
Regulated Target	YTH N6-methyladenosine RNA binding protein C1 (YTHDC1)
Crosstalk relationship	ncRNA → m6A
Disease	Liver cancer	Disease Info

m6A Target: Glucose transporter type 1 (GLUT1)

Target Gene

In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05901		Crosstalk Info
Epigenetic Regulator	Long intergenic non-protein coding RNA 294 (LINC00294)
Regulated Target	YTH N6-methyladenosine RNA binding protein C1 (YTHDC1)
Crosstalk relationship	ncRNA → m6A
Disease	Liver cancer	Disease Info

Xenobiotics Compound(s) Regulating the m6A Methylation Regulator

Compound Name	Tamoxifen	Approved
Synonyms	tamoxifen; 10540-29-1; trans-Tamoxifen; Crisafeno; Soltamox; Tamoxifene; Diemon; Tamoxifenum; Tamoxifeno; Tamizam; Istubol; Tamoxen; Citofen; Oncomox; Valodex; Retaxim; Tamoxifene [INN-French]; Tamoxifenum [INN-Latin]; Tamoxifeno [INN-Spanish]; Tamoxifen (Z); Tamoxifen and its salts; Tamoxifen [INN:BAN]; ICI-46474; ICI 47699; TRANS FORM OF TAMOXIFEN; CCRIS 3275; UNII-094ZI81Y45; HSDB 6782; CHEMBL83; EINECS 234-118-0; 1-p-beta-Dimethylaminoethoxyphenyl-trans-1,2-diphenylbut-1-ene; Citofen; Nourytam; Novaldex; Tamone; Tamoxifeno;Tamoxifenum; Tomaxithen; Gen-Tamoxifen; Istubal (TN); Nolvadex (TN); Nolvadex-D; Novo-Tamoxifen; Pms-Tamoxifen; Tamoplex (TN); Tamoxifen (INN); Tamoxifen (TN); Trans-Tamoxifen; Valodex (TN); TAMOXIFEN (TAMOXIFEN CITRATE (54965-24-1)); Trans-2-[4-(1,2-Diphenyl-1-butenyl)phenoxy]-N,N-dimethylethylamine; (Z)-1-(p-Dimethylaminoethoxyphenyl)-1,2-diphenyl-1-butene; (Z)-2-(4-(1,2-Diphenyl-1-butenyl)phenoxy)-N,N-dimethylethanamine; (Z)-2-(4-(1,2-diphenylbut-1-enyl)phenoxy)-N,N-dimethylethanamine; (Z)-2-(para-(1,2-Diphenyl-1-butenyl)phenoxy)-N,N-dimethylamine (IUPAC); (Z)-2-[4-(1,2)-DIPHENYL-1-BUTENYL)-PHENOXY]-N,N-DIMETHYLETHANAMINE; (Z)-2-[p-(1,2-Diphenyl-1-butenyl)phenoxy]-N,N-dimethylethylamine; 1-p-beta-Dimethylamino-ethoxyphenyl-trans-1,2-diphenylbut-1-ene; 1-para-beta-Dimethylaminoethoxyphenyl-trans-1,2-diphenylbut-1-ene; 2-[4-[(Z)-1,2-diphenylbut-1-enyl]phenoxy]-N,N-dimethylethanamine; 2-{4-[(1Z)-1,2-diphenylbut-1-en-1-yl]phenoxy}-N,N-dimethylethanamine; Tamoxifen (Hormonal therapy); [3H]tamoxifen Click to Show/Hide
External link	CID: 2733526 TTD: D07KSG DrugBank: DB00675
Description	Direct suppression of m6A modification ofS-mu-GLT or of m6A reader YTHDC1 reduces CSR. METTL3 enzyme-catalyzed N6-methyladenosine (m6A) RNA modification drives recognition and 3' end processing of S-mu-GLT by the RNA exosome, promotingclass switch recombination and suppressing chromosomal translocations. Tamoxifen affects the role of METTL3 in B cell development.	[46]
Compound Name	Beta-Elemene	Investigative
Synonyms	BETA-ELEMENE; 515-13-9; beta-Elemen; (-)-beta-Elemene; Levo-beta-elemene; b-elemene; Levo-b-elemene; UNII-2QG8CX6LXD; (1S,2S,4R)-1-methyl-2,4-di(prop-1-en-2-yl)-1-vinylcyclohexane; 2,4-Diisopropenyl-1-methyl-1-vinylcyclohexane; (-)-b-Elemene; CHEBI:62855; 2QG8CX6LXD; (1S,2S,4R)-2,4-diisopropenyl-1-methyl-1-vinylcyclohexane; (1S,2S,4R)-(-)-1-methyl-1-vinyl-2,4-diisopropenylcyclohexane; (1S,2S,4R)-1-ethenyl-1-methyl-2,4-bis(prop-1-en-2-yl)cyclohexane; Cyclohexane, 1-ethenyl-1-methyl-2,4-bis(1-methylethenyl)-, (1S,2S,4R)-; 33880-83-0; (1S,2S,4R)-1-ethenyl-1-methyl-2,4-di(prop-1-en-2-yl)cyclohexane; beta-Elemene, (-)-; b-Elemen; E- .beta.-Elemene; Epitope ID:153551; Levo-b-elemene(-)-b-Elemene; CHEMBL448502; DTXSID60881211; SDP-111; 8064AH; s6957; ZINC14096289; AKOS028108977; (-)-beta-Elemene, analytical standard; Cyclohexane, 1-ethenyl-1-methyl-2,4-bis(1-methylethenyl)-, (1S-(1-alpha,2-beta,4-beta))-; Cyclohexane, 1-ethenyl-1-methyl-2,4-bis(1-methylethenyl)-, [1S-(1alpha,2beta,4beta)]-; AS-82909; HY-107324; CS-0028143; C17094; E79113; 880E830; Q27132237; 1-ethenyl-1-methyl-2,4-bis(1-methylethenyl)-cyclohexane; Cyclohexane, 2,4-diisopropenyl-1-methyl-1-vinyl-, (1S,2S,4R)- Click to Show/Hide
External link	CID: 6918391
Description	Indicated that Beta-elemene administration led to the augment of YTHDC1 level was upregulated	[52]

References

Ref 1	A critical role of nuclear m6A reader YTHDC1 in leukemogenesis by regulating MCM complex-mediated DNA replication. Blood. 2021 Dec 30;138(26):2838-2852. doi: 10.1182/blood.2021011707.
Ref 2	A heat shock-responsive lncRNA Heat acts as a HSF1-directed transcriptional brake via m(6)A modification. Proc Natl Acad Sci U S A. 2021 Jun 22;118(25):e2102175118. doi: 10.1073/pnas.2102175118.
Ref 3	YTHDC1 mitigates ischemic stroke by promoting Akt phosphorylation through destabilizing PTEN mRNA. Cell Death Dis. 2020 Nov 13;11(11):977. doi: 10.1038/s41419-020-03186-2.
Ref 4	m(6)A reader YTHDC1 modulates autophagy by targeting SQSTM1 in diabetic skin. Autophagy. 2022 Jun;18(6):1318-1337. doi: 10.1080/15548627.2021.1974175. Epub 2021 Oct 17.
Ref 5	Kaposi's Sarcoma-Associated Herpesvirus Utilizes and Manipulates RNA N(6)-Adenosine Methylation To Promote Lytic Replication. J Virol. 2017 Jul 27;91(16):e00466-17. doi: 10.1128/JVI.00466-17. Print 2017 Aug 15.
Ref 6	N(6)-Methyladenosine Modulates Nonsense-Mediated mRNA Decay in Human Glioblastoma. Cancer Res. 2019 Nov 15;79(22):5785-5798. doi: 10.1158/0008-5472.CAN-18-2868. Epub 2019 Sep 17.
Ref 7	Depletion of m(6) A reader protein YTHDC1 induces dilated cardiomyopathy by abnormal splicing of Titin. J Cell Mol Med. 2021 Dec;25(23):10879-10891. doi: 10.1111/jcmm.16955. Epub 2021 Oct 30.
Ref 8	Nuclear export of chimeric mRNAs depends on an lncRNA-triggered autoregulatory loop in blood malignancies. Cell Death Dis. 2020 Jul 23;11(7):566. doi: 10.1038/s41419-020-02795-1.
Ref 9	EMP3 negatively modulates breast cancer cell DNA replication, DNA damage repair, and stem-like properties. Cell Death Dis. 2021 Sep 12;12(9):844. doi: 10.1038/s41419-021-04140-6.
Ref 10	m6A modification of circHPS5 and hepatocellular carcinoma progression through HMGA2 expression. Mol Ther Nucleic Acids. 2021 Sep 14;26:637-648. doi: 10.1016/j.omtn.2021.09.001. eCollection 2021 Dec 3.
Ref 11	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800032947)
Ref 12	The heparin-binding domain of heparin-binding EGF-like growth factor can target Pseudomonas exotoxin to kill cells exclusively through heparan sulfate proteoglycans. J Cell Sci. 1994 Sep;107 ( Pt 9):2599-608. doi: 10.1242/jcs.107.9.2599.
Ref 13	YTHDC1-mediated VPS25 regulates cell cycle by targeting JAK-STAT signaling in human glioma cells. Cancer Cell Int. 2021 Dec 4;21(1):645. doi: 10.1186/s12935-021-02304-0.
Ref 14	PharmGKB summary: very important pharmacogene information for PTGS2. Pharmacogenet Genomics. 2011 Sep;21(9):607-13. doi: 10.1097/FPC.0b013e3283415515.
Ref 15	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025396)
Ref 16	Clinical pipeline report, company report or official report of Debiopharm (2011).
Ref 17	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2019).
Ref 18	ARRY-380, a Potent, Small Molecule Inhibitor of ErbB2, Increases Survival in Intracranial ErbB2+ Xenograft Models in Mice
Ref 19	Efficacy and safety of olokizumab in patients with rheumatoid arthritis with an inadequate response to TNF inhibitor therapy: outcomes of a randomised Phase IIb study. Ann Rheum Dis. 2014 September; 73(9): 1607-1615.
Ref 20	Evidence for irreversible inhibition of glycogen synthase kinase-3Beta by tideglusib. J Biol Chem. 2012 Jan 6;287(2):893-904. doi: 10.1074/jbc.M111.306472. Epub 2011 Nov 18.
Ref 21	YTHDC1-mediated augmentation of miR-30d in repressing pancreatic tumorigenesis via attenuation of RUNX1-induced transcriptional activation of Warburg effect. Cell Death Differ. 2021 Nov;28(11):3105-3124. doi: 10.1038/s41418-021-00804-0. Epub 2021 May 21.
Ref 22	Methyltransferase-Like 3-Mediated m6A Methylation of Hsa_circ_0058493 Accelerates Hepatocellular Carcinoma Progression by Binding to YTH Domain-Containing Protein 1. Front Cell Dev Biol. 2021 Nov 23;9:762588. doi: 10.3389/fcell.2021.762588. eCollection 2021.
Ref 23	N(6) -methyladenosine modification of circular RNA circ-ARL3 facilitates Hepatitis B virus-associated hepatocellular carcinoma via sponging miR-1305. IUBMB Life. 2021 Feb;73(2):408-417. doi: 10.1002/iub.2438. Epub 2020 Dec 28.
Ref 24	Development of a cancer vaccine: peptides, proteins, and DNA. Cancer Chemother Pharmacol. 2000;46 Suppl:S77-82. doi: 10.1007/s002800000179.
Ref 25	ERK Mutations Confer Resistance to Mitogen-Activated Protein Kinase Pathway Inhibitors
Ref 26	RBFOX2 recognizes N6-methyladenosine to suppress transcription and block myeloid leukaemia differentiation. Nat Cell Biol. 2023 Sep;25(9):1359-1368. doi: 10.1038/s41556-023-01213-w.
Ref 27	Clinical pipeline report, company report or official report of Genentech (2009).
Ref 28	N(6)-methyladenosine-modified circIGF2BP3 inhibits CD8(+) T-cell responses to facilitate tumor immune evasion by promoting the deubiquitination of PD-L1 in non-small cell lung cancer. Mol Cancer. 2021 Aug 20;20(1):105. doi: 10.1186/s12943-021-01398-4.
Ref 29	Clinical pipeline report, company report or official report of Affimed Therapeutics.
Ref 30	Wilms' tumor protein 1 (WT1) peptide vaccination in AML patients: predominant TCR CDR3Beta sequence associated with remission in one patient is detectable in other vaccinated patients. Cancer Immunol Immunother. 2012 Mar;61(3):313-22. doi: 10.1007/s00262-011-1099-y. Epub 2011 Sep 7.
Ref 31	ClinicalTrials.gov (NCT03638167) EGFR806-specific CAR T Cell Locoregional Immunotherapy for EGFR-positive Recurrent or Refractory Pediatric CNS Tumors
Ref 32	National Cancer Institute Drug Dictionary (drug id 590662).
Ref 33	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 728).
Ref 34	SAR405838: an optimized inhibitor of MDM2-p53 interaction that induces complete and durable tumor regression. Cancer Res. 2014 Oct 15;74(20):5855-65. doi: 10.1158/0008-5472.CAN-14-0799. Epub 2014 Aug 21.
Ref 35	Intravenous hydrophobic drug delivery: a porous particle formulation of paclitaxel (AI-850). Pharm Res. 2005 Mar;22(3):347-55. doi: 10.1007/s11095-004-1871-1.
Ref 36	MM-141, an IGF-IR- and ErbB3-directed bispecific antibody, overcomes network adaptations that limit activity of IGF-IR inhibitors. Mol Cancer Ther. 2014 Feb;13(2):410-25. doi: 10.1158/1535-7163.MCT-13-0255. Epub 2013 Nov 26.
Ref 37	PPAR-gamma in ulcerative colitis: a novel target for intervention. Curr Drug Targets. 2013 Nov;14(12):1501-7. doi: 10.2174/13894501113149990162.
Ref 38	Company reprot (Spring Bank Pharmaceuticals) (drug: SB 9200)
Ref 39	Drug evaluation: TG-1042, an adenovirus-mediated IFNgamma gene delivery for the intratumoral therapy of primary cutaneous lymphomas. Curr Opin Investig Drugs. 2007 Jun;8(6):493-8.
Ref 40	Mecasermin rinfabate: insulin-like growth factor-I/insulin-like growth factor binding protein-3, mecaserimin rinfibate, rhIGF-I/rhIGFBP-3. Drugs R D. 2005;6(2):120-7. doi: 10.2165/00126839-200506020-00008.
Ref 41	Potent and selective PPAR-alpha agonist LY518674 upregulates both ApoA-I production and catabolism in human subjects with the metabolic syndrome. Arterioscler Thromb Vasc Biol. 2009 Jan;29(1):140-6. doi: 10.1161/ATVBAHA.108.171223. Epub 2008 Nov 6.
Ref 42	CN patent application no. 102459215, 3-(4-aminophenyl)-2-furancarboxylic acid derivative and pharmaceutically acceptable salt thereof.
Ref 43	Long noncoding RNA pncRNA-D reduces cyclin D1 gene expression and arrests cell cycle through RNA m(6)A modification. J Biol Chem. 2020 Apr 24;295(17):5626-5639. doi: 10.1074/jbc.RA119.011556. Epub 2020 Mar 12.
Ref 44	Overexpression of m6A-factors METTL3, ALKBH5, and YTHDC1 alters HPV16 mRNA splicing. Virus Genes. 2022 Apr;58(2):98-112. doi: 10.1007/s11262-022-01889-6. Epub 2022 Feb 21.
Ref 45	Clinical pipeline report, company report or official report of Allarity Therapeutics.
Ref 46	Mechanism of noncoding RNA-associated N(6)-methyladenosine recognition by an RNA processing complex during IgH DNA recombination. Mol Cell. 2021 Oct 7;81(19):3949-3964.e7. doi: 10.1016/j.molcel.2021.07.037. Epub 2021 Aug 26.
Ref 47	Phase I study of barasertib (AZD1152), a selective inhibitor of Aurora B kinase, in patients with advanced solid tumors. Invest New Drugs. 2013 Apr;31(2):370-80. doi: 10.1007/s10637-012-9825-7. Epub 2012 Jun 2.
Ref 48	RNA m6A Methylation Regulators Multi-Omics Analysis in Prostate Cancer. Front Genet. 2021 Nov 26;12:768041. doi: 10.3389/fgene.2021.768041. eCollection 2021.
Ref 49	Multidrug transporter ABCG2/breast cancer resistance protein secretes riboflavin (vitamin B2) into milk. Mol Cell Biol. 2007 Feb;27(4):1247-53. doi: 10.1128/MCB.01621-06. Epub 2006 Dec 4.
Ref 50	Estradiol induces export of sphingosine 1-phosphate from breast cancer cells via ABCC1 and ABCG2. J Biol Chem. 2010 Apr 2;285(14):10477-86. doi: 10.1074/jbc.M109.064162. Epub 2010 Jan 28.
Ref 51	m6A regulator-mediated RNA methylation modification patterns and immune microenvironment infiltration characterization in severe asthma. J Cell Mol Med. 2021 Nov;25(21):10236-10247. doi: 10.1111/jcmm.16961. Epub 2021 Oct 14.
Ref 52	Beta-Elemene Restrains PTEN mRNA Degradation to Restrain the Growth of Lung Cancer Cells via METTL3-Mediated N(6) Methyladenosine Modification. J Oncol. 2022 Jan 12;2022:3472745. doi: 10.1155/2022/3472745. eCollection 2022.

m6A Regulator Information

Cite M6AREG

Correspondence

Prof. Feng ZHU

Prof. Shuiping Liu

Visitor Map