m6A Regulator Information

General Information of the m6A Regulator (ID: REG00023)
Regulator Name YTH domain-containing protein 2 (YTHDC2)
Synonyms
3'-5' RNA helicase YTHDC2; hYTHDC2
    Click to Show/Hide
Gene Name YTHDC2
Sequence
MSRPSSVSPRQPAPGGGGGGGPSPCGPGGGGRAKGLKDIRIDEEVKIAVNIALERFRYGD
QREMEFPSSLTSTERAFIHRLSQSLGLVSKSKGKGANRYLTVKKKDGSETAHAMMTCNLT
HNTKHAVRSLIQRFPVTNKERTELLPKTERGNVFAVEAENREMSKTSGRLNNGIPQIPVK
RGESEFDSFRQSLPVFEKQEEIVKIIKENKVVLIVGETGSGKTTQIPQFLLDDCFKNGIP
CRIFCTQPRRLAAIAVAERVAAERRERIGQTIGYQIRLESRVSPKTLLTFCTNGVLLRTL
MAGDSTLSTVTHVIVDEVHERDRFSDFLLTKLRDLLQKHPTLKLILSSAALDVNLFIRYF
GSCPVIYIQGRPFEVKEMFLEDILRTTGYTNKEMLKYKKEKQQEEKQQTTLTEWYSAQEN
SFKPESQRQRTVLNVTDEYDLLDDGGDAVFSQLTEKDVNCLEPWLIKEMDACLSDIWLHK
DIDAFAQVFHLILTENVSVDYRHSETSATALMVAAGRGFASQVEQLISMGANVHSKASNG
WMALDWAKHFGQTEIVDLLESYSATLEFGNLDESSLVQTNGSDLSAEDRELLKAYHHSFD
DEKVDLDLIMHLLYNICHSCDAGAVLIFLPGYDEIVGLRDRILFDDKRFADSTHRYQVFM
LHSNMQTSDQKKVLKNPPAGVRKIILSTNIAETSITVNDVVFVIDSGKVKEKSFDALNFV
TMLKMVWISKASAIQRKGRAGRCRPGICFRLFSRLRFQNMLEFQTPELLRMPLQELCLHT
KLLAPVNCPIADFLMKAPEPPPALIVRNAVQMLKTIDAMDTWEDLTELGYHLADLPVEPH
LGKMVLCAVVLKCLDPILTIACTLAYRDPFVLPTQASQKRAAMLCRKRFTAGAFSDHMAL
LRAFQAWQKARSDGWERAFCEKNFLSQATMEIIIGMRTQLLGQLRASGFVRARGGGDIRD
VNTNSENWAVVKAALVAGMYPNLVHVDRENLVLTGPKEKKVRFHPASVLSQPQYKKIPPA
NGQAAAIKALPTDWLIYDEMTRAHRIANIRCCSAVTPVTILVFCGPARLASNALQEPSSF
RVDGIPNDSSDSEMEDKTTANLAALKLDEWLHFTLEPEAASLLLQLRQKWHSLFLRRMRA
PSKPWSQVDEATIRAIIAVLSTEEQSAGLQQPSGIGQRPRPMSSEELPLASSWRSNNSRK
SSADTEFSDECTTAERVLMKSPSPALHPPQKYKDRGILHPKRGTEDRSDQSSLKSTDSSS
YPSPCASPSPPSSGKGSKSPSPRPNMPVRYFIMKSSNLRNLEISQQKGIWSTTPSNERKL
NRAFWESSIVYLVFSVQGSGHFQGFSRMSSEIGREKSQDWGSAGLGGVFKVEWIRKESLP
FQFAHHLLNPWNDNKKVQISRDGQELEPLVGEQLLQLWERLPLGEKNTTD
    Click to Show/Hide
Family DEAD box helicase family; DEAH subfamily
Function
3'-5' RNA helicase that plays a key role in the male and female germline by promoting transition from mitotic to meiotic divisions in stem cells. Specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, a modification present at internal sites of mRNAs and some non-coding RNAs that plays a role in the efficiency of RNA processing and stability. Essential for ensuring a successful progression of the meiotic program in the germline by regulating the level of m6A-containing RNAs (By similarity). Acts by binding and promoting degradation of m6A-containing mRNAs: the 3'-5' RNA helicase activity is required for this process and RNA degradation may be mediated by XRN1 exoribonuclease. Required for both spermatogenesis and oogenesis (By similarity).
    Click to Show/Hide
Gene ID 64848
Uniprot ID
YTDC2_HUMAN
Regulator Type WRITER ERASER READER
Mechanism Diagram Click to View the Original Diagram
Target Genes Click to View Potential Target Genes of This Regulator
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
YTHDC2 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Browse Target Gene related Drug
40S ribosomal protein S6 (S6)
 Target Gene 
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
In-vitro Model
 HK1-IRR (HK1-IRR (HK1-ionizing radiation radioresistent cell line) was derived from HK1 after a prolonged exposure of irradiation.HK1, a generous gift from Prof. Ya Cao (Cancer Research Institute, Central South University), was established from a recurrent nasopharynx carcinoma of a Chinese 17-year-old male patient)
NPC/HK1 Nasopharyngeal carcinoma Homo sapiens CVCL_7084
CNE2-IRR (CNE2-IRR (CNE2-ionizing radiation radioresistent cell line) was derived from CNE2 after a prolonged exposure of irradiation)
CNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_6889
In-vivo Model 2 × 106 cells resuspended in 50 uL of Matrigel (Corning) were subcutaneously injected into 4-6 weeks old male nude mice. When tumor volumes reached 150-200 mm3, animals were divided into control group and radiotherapy group. In the radiotherapy group, tumors were treated with a single irradiation (4 Gy) when tumor volumes reached approximately 150-200 mm3. The tumor stopped growing in the next few days and then restarted growth.
Response Summary YTHDC2 promotes radiotherapy resistance of NPC cells by activating the IGF1R/ATK/40S ribosomal protein S6 (S6) signaling axis and serves as a potential therapeutic target in radiosensitization of NPC cells.
Acetyl-CoA carboxylase 1 (ACC1/ACACA)
 Target Gene 
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation Down regulation
Pathway Response RNA degradation hsa03018
Cell Process RNA stability
In-vivo Model All mice were housed at 21℃ ± 1℃ with a humidity of 55% ± 10% and a 12-hour light/dark cycle. The high-fat diets (HFDs), containing 60% kcal from fat, 20% kcal from carbohydrate, and 20% kcal from protein.
Response Summary In nonalcoholic fatty liver disease, Ythdc2 could bind to mRNA of lipogenic genes, including sterol regulatory element-binding protein 1c, fatty acid synthase, stearoyl-CoA desaturase 1, and Acetyl-CoA carboxylase 1 (ACC1/ACACA), to decrease their mRNA stability and inhibit gene expression.
Autophagy protein 5 (ATG5)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
In-vitro Model
 Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model Four-week-old BALB/C-nu nude male mice were used for animal studies, and all animals were maintained in the specific pathogen-free (SPF) conditions at our institution. Huh-7 and stable YTHDC2 knockdown Huh-7 cells (approximately 1 × 107) resuspended with 50 μl of PBS and 50 μl of stromal gel were injected subcutaneously into the axilla of BALB/c nude mice to establish the subcutaneous xenograft model. When the volume of xenograft tumors up to 100 mm3, the mice were randomly divided into six groups, with five mice in each group. Erastin and sorafenib were dissolved in 10 % DMSO and 90 % corn oil and injected intraperitoneally into the mice every other day. After 28 days, mice were deeply anesthetized by intraperitoneal injection of sodium thiopental before decapitation, followed by tumors extraction, and stored in a -80 °C refrigerator for subsequent experiments. There were no occurrences of mouse mortality throughout the entire experimental period.
Cyclin-dependent kinase inhibitor 1 (CDKN1A)
 Target Gene 
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Esophageal squamous cell carcinoma [ICD-11: 2B70.1]
Target Regulation Up regulation
Pathway Response p53 signaling pathway hsa04115
NF-kappa B signaling pathway hsa04064
JAK-STAT signaling pathway hsa04630
Cell Process Genetic variants
In-vitro Model
 KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
Response Summary Knockdown of YTHDC2 substantially promoted the proliferation rate of esophageal squamous cell carcinoma cells by affecting several cancer-related signaling pathways.
Cystine/glutamate transporter (SLC7A11)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [5]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Down regulation
In-vitro Model
 PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
NCI-H441 Lung papillary adenocarcinoma Homo sapiens CVCL_1561
NCI-H292 Lung mucoepidermoid carcinoma Homo sapiens CVCL_0455
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H1650 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1483
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
HEK293T Normal Homo sapiens CVCL_0063
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
Calu-1 Lung squamous cell carcinoma Homo sapiens CVCL_0608
BEAS-2B Normal Homo sapiens CVCL_0168
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Response Summary YTHDC2 destabilized Cystine/glutamate transporter (SLC7A11) mRNA in an m6A-dependent manner because YTHDC2 preferentially bound to m6A-modified SLC7A11 mRNA and thereafter promoted its decay. the promotion of cystine uptake via the suppression of YTHDC2 is critical for LUAD tumorigenesis.
Cytochrome P450 2C8 (CYP2C8)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Down regulation
Pathway Response Drug metabolism - cytochrome P450 hsa00982
Cell Process Drug-metabolizing
In-vitro Model
 HepaRG Hepatitis C infection Homo sapiens CVCL_9720
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Response Summary In the Hepatocellular carcinoma cells YTHDC2 promotes CYP2C8 mRNA degradation via recognizing the m6A in CYP2C8 mRNA, which is installed by METTL3/14 and removed by FTO.
G1/S-specific cyclin-D2 (CCND2)
 Target Gene 
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Esophageal squamous cell carcinoma [ICD-11: 2B70.1]
Target Regulation Up regulation
Pathway Response p53 signaling pathway hsa04115
NF-kappa B signaling pathway hsa04064
JAK-STAT signaling pathway hsa04630
Cell Process Genetic variants
In-vitro Model
 KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
Response Summary Knockdown of YTHDC2 substantially promoted the proliferation rate of esophageal squamous cell carcinoma cells by affecting several cancer-related signaling pathways.
G2/mitotic-specific cyclin-B2 (CCNB2)
 Target Gene 
Male infertility [ICD-11: GB04]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Male infertility [ICD-11: GB04]
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process Block the G2/M phase
In-vitro Model
 GC-1 spg Normal Mus musculus CVCL_8872
In-vivo Model Mice in the control group received an i.p. injections of 0.9% NaCl. Mice in the low, medium, and high Mn groups received i.p. injections of 12.5, 25, and 50 mg/kg MnCl2. The volume of administration was 5 mL/kg body weight. The injection was given daily for 2 weeks.
Response Summary Over-expression (OE) of YTHDC2 increased G2/mitotic-specific cyclin-B2 (CCNB2) levels, reduced cell cycle arrest, and improved reproductive toxicity after Mn exposure.
Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A)
 Target Gene 
Colon cancer [ICD-11: 2B90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Colon cancer [ICD-11: 2B90]
Target Regulation Up regulation
Pathway Response HIF-1 signaling pathway hsa04066
Cell Process Biological regulation
In-vitro Model
 COS (From the African green monkey cell line (CV-1).)
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model HCT116, Y2KD-116 and con-116 cells were resuspended at 1 × 106 cells per 50 ul of PBS. Cells were injected into the exteriorized spleen after abdominal incision.
Response Summary YTHDC2 contributes to colon tumor metastasis by promoting translation of Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A) and that YTHDC2 is potentially a diagnostic marker and target gene for treating colon cancer patients.
Insulin-like growth factor 1 receptor (IGF1R)
 Target Gene 
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
In-vitro Model
 HK1-IRR (HK1-IRR (HK1-ionizing radiation radioresistent cell line) was derived from HK1 after a prolonged exposure of irradiation.HK1, a generous gift from Prof. Ya Cao (Cancer Research Institute, Central South University), was established from a recurrent nasopharynx carcinoma of a Chinese 17-year-old male patient)
NPC/HK1 Nasopharyngeal carcinoma Homo sapiens CVCL_7084
CNE2-IRR (CNE2-IRR (CNE2-ionizing radiation radioresistent cell line) was derived from CNE2 after a prolonged exposure of irradiation)
CNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_6889
In-vivo Model 2 × 106 cells resuspended in 50 uL of Matrigel (Corning) were subcutaneously injected into 4-6 weeks old male nude mice. When tumor volumes reached 150-200 mm3, animals were divided into control group and radiotherapy group. In the radiotherapy group, tumors were treated with a single irradiation (4 Gy) when tumor volumes reached approximately 150-200 mm3. The tumor stopped growing in the next few days and then restarted growth.
Response Summary YTHDC2 promotes radiotherapy resistance of NPC cells by activating the Insulin-like growth factor 1 receptor (IGF1R)/ATK/S6 signaling axis and serves as a potential therapeutic target in radiosensitization of NPC cells.
Interleukin-6 (IL-6)
 Target Gene 
Kaposi's sarcoma [ICD-11: 2B57]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Kaposi's sarcoma [ICD-11: 2B57]
In-vitro Model
 iSLK.219 Clear cell renal cell carcinoma Homo sapiens CVCL_B6YV
HEK293T Normal Homo sapiens CVCL_0063
HEK293 Normal Homo sapiens CVCL_0045
Response Summary This modification recruits the m6A reader YTHDC2 and found that YTHDC2 is necessary for the escape of the IL-6 transcript. m6A modification is essential to confer SOX resistance to the Interleukin-6 (IL-6) mRNA. These results shed light on how the host cell has evolved to use RNA modifications to circumvent viral manipulation of RNA fate during KSHV infection Kaposi's sarcoma.
Mutated in multiple advanced cancers 1 (PTEN)
 Target Gene 
Skin cancer [ICD-11: 2C3Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease Skin cancer [ICD-11: 2C3Z]
Target Regulation Down regulation
In-vitro Model
 HaCaT Normal Homo sapiens CVCL_0038
HEK293T Normal Homo sapiens CVCL_0063
Nuclear factor erythroid 2-related factor 2 (NFE2L2)
 Target Gene 
Male reproductive disorders [ICD-11: VV5Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Male reproductive disorders [ICD-11: VV5Z]
Cell Process Oxidative stress
Cell apoptosis
In-vivo Model Exposed Sprague-Dawley rats to 0, 250, and 500 mg DEHP per kg body weight per day at the prepuberty stage from postnatal day 22 (PND 22) to PND 35 by oral gavage.
Response Summary DEHP worsened testicular histology, decreased testosterone concentrations, downregulated expression of spermatogenesis inducers, enhanced oxidative stress, inhibited the Nuclear factor erythroid 2-related factor 2 (NFE2L2)-mediated antioxidant pathway, and increased apoptosis in testes. DEHP is a common environmental endocrine disrupting chemical that induces male reproductive disorders. Additionally, DEHP increased global levels of m6A RNA modification and altered the expression of two important RNA methylation modulator genes, FTO and YTHDC2.
RAC-alpha serine/threonine-protein kinase (AKT1)
 Target Gene 
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
In-vitro Model
 HK1-IRR (HK1-IRR (HK1-ionizing radiation radioresistent cell line) was derived from HK1 after a prolonged exposure of irradiation.HK1, a generous gift from Prof. Ya Cao (Cancer Research Institute, Central South University), was established from a recurrent nasopharynx carcinoma of a Chinese 17-year-old male patient)
NPC/HK1 Nasopharyngeal carcinoma Homo sapiens CVCL_7084
CNE2-IRR (CNE2-IRR (CNE2-ionizing radiation radioresistent cell line) was derived from CNE2 after a prolonged exposure of irradiation)
CNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_6889
In-vivo Model 2 × 106 cells resuspended in 50 uL of Matrigel (Corning) were subcutaneously injected into 4-6 weeks old male nude mice. When tumor volumes reached 150-200 mm3, animals were divided into control group and radiotherapy group. In the radiotherapy group, tumors were treated with a single irradiation (4 Gy) when tumor volumes reached approximately 150-200 mm3. The tumor stopped growing in the next few days and then restarted growth.
Response Summary YTHDC2 promotes radiotherapy resistance of NPC cells by activating the IGF1R/RAC-alpha serine/threonine-protein kinase (AKT1)/S6 signaling axis and serves as a potential therapeutic target in radiosensitization of NPC cells.
Stearoyl-CoA desaturase (SCD)
 Target Gene 
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation Down regulation
Pathway Response RNA degradation hsa03018
Cell Process RNA stability
In-vivo Model All mice were housed at 21℃ ± 1℃ with a humidity of 55% ± 10% and a 12-hour light/dark cycle. The high-fat diets (HFDs), containing 60% kcal from fat, 20% kcal from carbohydrate, and 20% kcal from protein.
Response Summary In nonalcoholic fatty liver disease, Ythdc2 could bind to mRNA of lipogenic genes, including sterol regulatory element-binding protein 1c, fatty acid synthase, Stearoyl-CoA desaturase (SCD), and acetyl-CoA carboxylase 1, to decrease their mRNA stability and inhibit gene expression.
Papillary Thyroid Cancer [ICD-11: XH1ND9]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Papillary Thyroid Cancer [ICD-11: XH1ND9]
Responsed Drug Simvastatin Approved
 Drug Info 
Target Regulation Down regulation
In-vitro Model
 B-CPAP Thyroid gland carcinoma Homo sapiens CVCL_0153
TPC-1 Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
K1 Thyroid gland papillary carcinoma Homo sapiens CVCL_2537
In-vivo Model These mice were provided with unrestricted access to both water and food, following a 12-h light and 12-h dark cycle. Subcutaneous injections of stably transfected K1 cells (2 × 106 cells per mouse) were administered in the armpits of the mice. Once the tumors became palpable, their volume was measured every three days and calculated using the formula: length × width2 × 0.5. The tumor weight was detected after the mice were sacrificed.
Sterol regulatory element-binding protein 1 (SREBF1)
 Target Gene 
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation Down regulation
Pathway Response RNA degradation hsa03018
Cell Process RNA stability
In-vivo Model All mice were housed at 21℃ ± 1℃ with a humidity of 55% ± 10% and a 12-hour light/dark cycle. The high-fat diets (HFDs), containing 60% kcal from fat, 20% kcal from carbohydrate, and 20% kcal from protein.
Response Summary In nonalcoholic fatty liver disease, Ythdc2 could bind to mRNA of lipogenic genes, including Sterol regulatory element-binding protein 1 (SREBF1), fatty acid synthase, stearoyl-CoA desaturase 1, and acetyl-CoA carboxylase 1, to decrease their mRNA stability and inhibit gene expression.
Transcriptional coactivator YAP1 (YAP1)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [13]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
In-vitro Model
 HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
In-vivo Model They were subcutaneously and caudal vein injected with YTHDC2 knockout AGS cells, respectively. After 7 weeks, the mice were sacrificed and tumor size and lung metastasis nodules were recorded.
Response Summary High YTHDC2 was strongly positively correlated with high Transcriptional coactivator YAP1 (YAP1) in clinical GC tissues, YTHDC2 is a novel oncogene in GC, which provides the theoretical basis for the strategy of targeting YTHDC2 for GC patients.
Transforming growth factor beta-2 proprotein (TGFB2)
 Target Gene 
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Esophageal squamous cell carcinoma [ICD-11: 2B70.1]
Target Regulation Up regulation
Pathway Response p53 signaling pathway hsa04115
NF-kappa B signaling pathway hsa04064
JAK-STAT signaling pathway hsa04630
Cell Process Genetic variants
In-vitro Model
 KYSE-150 Esophageal squamous cell carcinoma Homo sapiens CVCL_1348
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
Response Summary Knockdown of YTHDC2 substantially promoted the proliferation rate of esophageal squamous cell carcinoma cells by affecting several cancer-related signaling pathways.
Tumor necrosis factor receptor superfamily member 6 (FAS)
 Target Gene 
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation Down regulation
Pathway Response RNA degradation hsa03018
Cell Process RNA stability
In-vivo Model All mice were housed at 21℃ ± 1℃ with a humidity of 55% ± 10% and a 12-hour light/dark cycle. The high-fat diets (HFDs), containing 60% kcal from fat, 20% kcal from carbohydrate, and 20% kcal from protein.
Response Summary In nonalcoholic fatty liver disease, Ythdc2 could bind to mRNA of lipogenic genes, including sterol regulatory element-binding protein 1c, Tumor necrosis factor receptor superfamily member 6 (FAS), stearoyl-CoA desaturase 1, and acetyl-CoA carboxylase 1, to decrease their mRNA stability and inhibit gene expression.
Ubiquitin carboxyl-terminal hydrolase CYLD (CYLD)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [14]
Responsed Disease Lung cancer [ICD-11: 2C25]
Target Regulation Up regulation
Pathway Response NF-kappa B signaling pathway hsa04064
In-vitro Model
 NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
BEAS-2B Normal Homo sapiens CVCL_0168
In-vivo Model Approximately 5×106 normal H1299 cells or stable YTHDC2-overexpressing H1299 cells were implanted subcutaneously into the right flank of the animals (n=8 mice per group). Animals were euthanized by cervical dislocation ~30 days after implantation, and tumors were collected and photographed.
Response Summary Smoking-related downregulation of YTHDC2 was associated with enhanced proliferation and migration in lung cancer cells, YTHDC2 functions as a tumor suppressor through the Ubiquitin carboxyl-terminal hydrolase CYLD (CYLD)/NF-Kappa-B signaling pathway, which is mediated by m6A modification.
Adipogenesis regulatory factor (ADIRF)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [15]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Down regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
H157 Buccal mucosa squamous cell carcinoma Homo sapiens CVCL_2458
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
BEAS-2B Normal Homo sapiens CVCL_0168
CALML3 antisense RNA 1 (CALML3-AS1)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [16]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Target Regulation Down regulation
Cell division cycle-associated protein 4 (CDCA4)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [17]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Up regulation
In-vitro Model
 BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H157 Lung squamous cell carcinoma Homo sapiens CVCL_0463
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
Calu-3 Lung adenocarcinoma Homo sapiens CVCL_0609
In-vivo Model For the action of CDCA4, mice were set into Control, sh-NC, sh-CDCA4 groups, 6 mice/group. For the action of ALKBH5 in CDCA4, mice were set into oe-NC, oe-CDCA4, oe-CDCA4 + sh-NC, oe-CDCA4 + sh-ALKBH5 groups, 6 mice/group. In brief, 1 × 106/100 μL LLC cells were injected subcutaneously into the right flank of mice to establish a tumor model. LLC cells stably transfected with oe-NC, oe-CDCA4, oe-CDCA4 + sh-NC and oe-CDCA4 + sh-ALKBH5 were injected into each group of mice .
Circ_YTHDC2
 Target Gene 
Hematological disorders [ICD-11: 3C0Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Hematological disorders [ICD-11: 3C0Z]
Target Regulation Up regulation
In-vitro Model
 A7r5 Normal Rattus norvegicus CVCL_0137
Response Summary YTHDC2/Circ_YTHDC2/TET2 pathway is an important target of metformin in preventing the progression of VSMCs dysfunction under high glucose.
DNA-binding protein inhibitor ID-3 (ID3)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 A549/DDP Lung adenocarcinoma Homo sapiens CVCL_C0W4
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
Responsed Drug 3-deazidenosine Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 A549/DDP Lung adenocarcinoma Homo sapiens CVCL_C0W4
Histone-lysine N-methyltransferase ASH1L (ASH1L)
 Target Gene 
Uveitis [ICD-11: 9A96]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [20]
Responsed Disease Uveitis [ICD-11: 9A96]
Target Regulation Up regulation
Large ribosomal subunit protein bL12m (MRPL12)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [21]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Down regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1573 Lung adenocarcinoma Homo sapiens CVCL_1478
LIM domain kinase 1 (LIMK1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [22]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Fluorouracil Approved
 Drug Info 
Target Regulation Down regulation
In-vitro Model
 LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
Caco-2 Colon adenocarcinoma Homo sapiens CVCL_0025
RKO Colon carcinoma Homo sapiens CVCL_0504
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
NCM460 Normal Homo sapiens CVCL_0460
FHC Normal Homo sapiens CVCL_3688
In-vivo Model A total of 5 × 106 SW480 cells/100 μL of PBS were subcutaneously injected into the back of mice to establish a xenograft model, and tumor growth was measured with a vernier caliper every 3 days. 72 h after tumor inoculation, mice were injected intraperitoneally with 5-FU (6 mg/kg; Sigma, German) twice weekly for 21 days (6 doses in total).
Lysine-specific demethylase 5B (KDM5B)
 Target Gene 
Chronic kidney disease [ICD-11: GB61]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [23]
Responsed Disease Diabetic nephropathy [ICD-11: GB61.Z]
Target Regulation Up regulation
In-vitro Model
RSC96
 N.A. Rattus norvegicus CVCL_4694
In-vivo Model Male type 2 diabetic mice (db/db) [18-week-old] were purchased from SLAC (Shanghai, China) (n = 8). Corresponding 18-week-old heterozygotes mice (db/m) were used as controls. All mice were killed, and sciatic nerves were collected and stored at - 80 °C.
NUTM2B antisense RNA 1 (NUTM2B-AS1)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [24]
Responsed Disease Liver cancer [ICD-11: 2C12]
Target Regulation Up regulation
pri-miR-17
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [25]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Fluorouracil Approved
 Drug Info 
Target Regulation Down regulation
In-vitro Model
 HCT 116 Colon carcinoma Homo sapiens CVCL_0291
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
Caco-2 Colon adenocarcinoma Homo sapiens CVCL_0025
HT29 Colon cancer Mus musculus CVCL_A8EZ
RKO Colon carcinoma Homo sapiens CVCL_0504
FHC Normal Homo sapiens CVCL_3688
NCM460 Normal Homo sapiens CVCL_0460
Protein MROH8 (MROH8)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [26]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
In-vitro Model
 AsPC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
Capan-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0237
Capan-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0026
CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
HEK293T Normal Homo sapiens CVCL_0063
HPDE6c7 Normal Homo sapiens CVCL_0P38
Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta (PDE6B)
 Target Gene 
Inherited retinal dystrophies [ICD-11: 9B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [28]
Responsed Disease Inherited retinal dystrophies [ICD-11: 9B70]
Target Regulation Up regulation
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
Serine/threonine-protein phosphatase with EF-hands 2 (PPEF2)
 Target Gene 
Inherited retinal dystrophies [ICD-11: 9B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [28]
Responsed Disease Inherited retinal dystrophies [ICD-11: 9B70]
Target Regulation Up regulation
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
SOX
 Target Gene 
Kaposi's sarcoma [ICD-11: 2B57]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Kaposi's sarcoma [ICD-11: 2B57]
In-vitro Model
 iSLK.219 Clear cell renal cell carcinoma Homo sapiens CVCL_B6YV
HEK293T Normal Homo sapiens CVCL_0063
HEK293 Normal Homo sapiens CVCL_0045
Response Summary This modification recruits the m6A reader YTHDC2 and found that YTHDC2 is necessary for the escape of the IL-6 transcript. m6A modification is essential to confer SOX (SOX) resistance to the IL-6 mRNA. These results shed light on how the host cell has evolved to use RNA modifications to circumvent viral manipulation of RNA fate during KSHV infection Kaposi's sarcoma.
Unspecific Target Gene
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [29]
Responsed Disease Head and neck squamous carcinoma [ICD-11: 2B6E]
Pathway Response Ubiquitin mediated proteolysis hsa04120
Cell Process Ubiquitin-mediated proteolysis
Cell apoptosis
Response Summary In head and neck squamous cell carcinoma patients, a majority of highly expressed m6A regulatory genes is associated with poor OS, in particular ALKBH5, whereas YTHDC2 was associated with better prognosis.
Rectum cancer [ICD-11: 2B92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [30]
Responsed Disease Rectum cancer [ICD-11: 2B92]
Target Regulation Down regulation
Pathway Response Nucleotide excision repair hsa03420
Cell Process DNA repair
Epithelial-mesenchymal transition
Response Summary The m6A RNA methylation regulators, specifically YTHDC2 and METTL14, were significantly down-regulated and were potential prognostic biomarkers in rectal cancer.
Coronary artery disease [ICD-11: BA8Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [31]
Responsed Disease Coronary artery disease [ICD-11: BA8Z]
Diseases of the musculoskeletal system [ICD-11: FC0Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [32]
Responsed Disease Diseases of the musculoskeletal system [ICD-11: FC0Z]
Pathway Response Ribosome biogenesis in eukaryotes hsa03008), mRNA surveillance pathway
Cell Process Adipogenic differentiation
Response Summary YTHDC2 knockdown can promote the osteogenic differentiation of hBMSCs and inhibit the adipogenic differentiation. YTHDC2 knockdown cause changes in ribosome function.
Menopausal disorder [ICD-11: GA30]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [33]
Responsed Disease Premature ovarian failure [ICD-11: GA30.6]
Pathway Response Oocyte meiosis hsa04114
Cell Process Meiosis
In-vitro Model
 HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Response Summary YTHDC2 is a key regulator of meiosis in humans and pathogenic variants within this gene are associated with POI.
Male infertility [ICD-11: GB04]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [34]
Responsed Disease Male infertility [ICD-11: GB04]
Responsed Drug Ethyl ester form of meclofenamic acid Approved
 Drug Info 
Cell Process Cell cycle
Cell proliferation
In-vitro Model
 GC-1 spg Normal Mus musculus CVCL_8872
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model Mouse GC-1 spg cells were treated with the ester form of meclofenamic acid (MA2) to inhibit the demethylase activity of FTO.
Response Summary METTL3, METTL14, ALKBH5 and YTHDC2 are involved in the regulation of spermatogenesis and oogenesis. MA2 affected CDKs expression through the m6A-dependent mRNA degradation pathway, and thus repressed spermatogonial proliferation. Additionally, mutation of the predicted m6A sites in the Cdk2-3'UTR could mitigated the degradation of CDK2 mRNA after MA2 treatment.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [35]
Responsed Disease Male infertility [ICD-11: GB04]
Cell Process RNA stability
RNA degradation (hsa03018)
In-vitro Model
 HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
In-vivo Model Mixture of Cas9 mRNA (20 ng/uL) and two sgRNAs (5 ng/uL each) were injected into the cytoplasm and male pronucleus of the zygote, obtained by CBF1 mating.
Response Summary Ythdc2 knockout mice are infertile; males have significantly smaller testes and females have significantly smaller ovaries compared to those of littermates.
Stearoyl-CoA desaturase (SCD)
 Target Gene 
Simvastatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [12]
Responsed Disease Papillary Thyroid Cancer ICD-11: XH1ND9
 Disease Info 
Target Regulation Down regulation
In-vitro Model B-CPAP Thyroid gland carcinoma Homo sapiens CVCL_0153
TPC-1 Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
K1 Thyroid gland papillary carcinoma Homo sapiens CVCL_2537
In-vivo Model These mice were provided with unrestricted access to both water and food, following a 12-h light and 12-h dark cycle. Subcutaneous injections of stably transfected K1 cells (2 × 106 cells per mouse) were administered in the armpits of the mice. Once the tumors became palpable, their volume was measured every three days and calculated using the formula: length × width2 × 0.5. The tumor weight was detected after the mice were sacrificed.
DNA-binding protein inhibitor ID-3 (ID3)
 Target Gene 
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [19]
Responsed Disease Non-small cell lung cancer ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
In-vitro Model A549/DDP Lung adenocarcinoma Homo sapiens CVCL_C0W4
3-deazidenosine [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [19]
Responsed Disease Non-small cell lung cancer ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
In-vitro Model A549/DDP Lung adenocarcinoma Homo sapiens CVCL_C0W4
LIM domain kinase 1 (LIMK1)
 Target Gene 
Fluorouracil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [22]
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Target Regulation Down regulation
In-vitro Model LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
Caco-2 Colon adenocarcinoma Homo sapiens CVCL_0025
RKO Colon carcinoma Homo sapiens CVCL_0504
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
NCM460 Normal Homo sapiens CVCL_0460
FHC Normal Homo sapiens CVCL_3688
In-vivo Model A total of 5 × 106 SW480 cells/100 μL of PBS were subcutaneously injected into the back of mice to establish a xenograft model, and tumor growth was measured with a vernier caliper every 3 days. 72 h after tumor inoculation, mice were injected intraperitoneally with 5-FU (6 mg/kg; Sigma, German) twice weekly for 21 days (6 doses in total).
pri-miR-17
 Target Gene 
Fluorouracil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [25]
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Target Regulation Down regulation
In-vitro Model HCT 116 Colon carcinoma Homo sapiens CVCL_0291
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
Caco-2 Colon adenocarcinoma Homo sapiens CVCL_0025
HT29 Colon cancer Mus musculus CVCL_A8EZ
RKO Colon carcinoma Homo sapiens CVCL_0504
FHC Normal Homo sapiens CVCL_3688
NCM460 Normal Homo sapiens CVCL_0460
RNA component of 7SK nuclear ribonucleoprotein (RN7SK)
 Target Gene 
Etoposide [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [27]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
BEL-7404 Endocervical adenocarcinoma Homo sapiens CVCL_6568
BEL-7402 Endocervical adenocarcinoma Homo sapiens CVCL_5492
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model For the generation of PDX mouse models, fresh LUSC specimens (2-3 mm3), which were from Shanghai Chest Hospital, were implanted into 4- to 6-week-old athymic nude mice (Jiesijie, Shanghai, China). After successful tumor growth was confirmed, the tumor tissues were passaged and implanted into the next generation of mice. The third to fifth generations of PDX-bearing mice were used for drug administration. When tumors reached approximately 200 mm3, mice were injected daily with DMSO (no. ST038, Beyotime Biotechnology, Shanghai, China) with or without MIT (no. S2485, 5 mg/kg, Selleck, Houston, TX) or HYD (no. S1896, 20 mg/kg, Selleck) (n = 5 mice/group). Tumor growth was monitored, and sizes were calculated by 0.5 × L × W2 (L indicating length and W indicating width). The mice were euthanized at day 28 after implantation. All animal experiments were approved by the institutional ethics committee of Shanghai Chest Hospital (approval number KS(Y)21382).
Hydroxyurea [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [27]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
BEL-7404 Endocervical adenocarcinoma Homo sapiens CVCL_6568
BEL-7402 Endocervical adenocarcinoma Homo sapiens CVCL_5492
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model For the generation of PDX mouse models, fresh LUSC specimens (2-3 mm3), which were from Shanghai Chest Hospital, were implanted into 4- to 6-week-old athymic nude mice (Jiesijie, Shanghai, China). After successful tumor growth was confirmed, the tumor tissues were passaged and implanted into the next generation of mice. The third to fifth generations of PDX-bearing mice were used for drug administration. When tumors reached approximately 200 mm3, mice were injected daily with DMSO (no. ST038, Beyotime Biotechnology, Shanghai, China) with or without MIT (no. S2485, 5 mg/kg, Selleck, Houston, TX) or HYD (no. S1896, 20 mg/kg, Selleck) (n = 5 mice/group). Tumor growth was monitored, and sizes were calculated by 0.5 × L × W2 (L indicating length and W indicating width). The mice were euthanized at day 28 after implantation. All animal experiments were approved by the institutional ethics committee of Shanghai Chest Hospital (approval number KS(Y)21382).
Mitoxantrone [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [27]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
BEL-7404 Endocervical adenocarcinoma Homo sapiens CVCL_6568
BEL-7402 Endocervical adenocarcinoma Homo sapiens CVCL_5492
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model For the generation of PDX mouse models, fresh LUSC specimens (2-3 mm3), which were from Shanghai Chest Hospital, were implanted into 4- to 6-week-old athymic nude mice (Jiesijie, Shanghai, China). After successful tumor growth was confirmed, the tumor tissues were passaged and implanted into the next generation of mice. The third to fifth generations of PDX-bearing mice were used for drug administration. When tumors reached approximately 200 mm3, mice were injected daily with DMSO (no. ST038, Beyotime Biotechnology, Shanghai, China) with or without MIT (no. S2485, 5 mg/kg, Selleck, Houston, TX) or HYD (no. S1896, 20 mg/kg, Selleck) (n = 5 mice/group). Tumor growth was monitored, and sizes were calculated by 0.5 × L × W2 (L indicating length and W indicating width). The mice were euthanized at day 28 after implantation. All animal experiments were approved by the institutional ethics committee of Shanghai Chest Hospital (approval number KS(Y)21382).
Oxaliplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [27]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
BEL-7404 Endocervical adenocarcinoma Homo sapiens CVCL_6568
BEL-7402 Endocervical adenocarcinoma Homo sapiens CVCL_5492
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model For the generation of PDX mouse models, fresh LUSC specimens (2-3 mm3), which were from Shanghai Chest Hospital, were implanted into 4- to 6-week-old athymic nude mice (Jiesijie, Shanghai, China). After successful tumor growth was confirmed, the tumor tissues were passaged and implanted into the next generation of mice. The third to fifth generations of PDX-bearing mice were used for drug administration. When tumors reached approximately 200 mm3, mice were injected daily with DMSO (no. ST038, Beyotime Biotechnology, Shanghai, China) with or without MIT (no. S2485, 5 mg/kg, Selleck, Houston, TX) or HYD (no. S1896, 20 mg/kg, Selleck) (n = 5 mice/group). Tumor growth was monitored, and sizes were calculated by 0.5 × L × W2 (L indicating length and W indicating width). The mice were euthanized at day 28 after implantation. All animal experiments were approved by the institutional ethics committee of Shanghai Chest Hospital (approval number KS(Y)21382).
Raltitrexed [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [27]
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
BEL-7404 Endocervical adenocarcinoma Homo sapiens CVCL_6568
BEL-7402 Endocervical adenocarcinoma Homo sapiens CVCL_5492
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model For the generation of PDX mouse models, fresh LUSC specimens (2-3 mm3), which were from Shanghai Chest Hospital, were implanted into 4- to 6-week-old athymic nude mice (Jiesijie, Shanghai, China). After successful tumor growth was confirmed, the tumor tissues were passaged and implanted into the next generation of mice. The third to fifth generations of PDX-bearing mice were used for drug administration. When tumors reached approximately 200 mm3, mice were injected daily with DMSO (no. ST038, Beyotime Biotechnology, Shanghai, China) with or without MIT (no. S2485, 5 mg/kg, Selleck, Houston, TX) or HYD (no. S1896, 20 mg/kg, Selleck) (n = 5 mice/group). Tumor growth was monitored, and sizes were calculated by 0.5 × L × W2 (L indicating length and W indicating width). The mice were euthanized at day 28 after implantation. All animal experiments were approved by the institutional ethics committee of Shanghai Chest Hospital (approval number KS(Y)21382).
Unspecific Target Gene
Ethyl ester form of meclofenamic acid [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [34]
Responsed Disease Male infertility ICD-11: GB04
 Disease Info 
Cell Process Cell cycle
Cell proliferation
In-vitro Model GC-1 spg Normal Mus musculus CVCL_8872
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model Mouse GC-1 spg cells were treated with the ester form of meclofenamic acid (MA2) to inhibit the demethylase activity of FTO.
Response Summary METTL3, METTL14, ALKBH5 and YTHDC2 are involved in the regulation of spermatogenesis and oogenesis. MA2 affected CDKs expression through the m6A-dependent mRNA degradation pathway, and thus repressed spermatogonial proliferation. Additionally, mutation of the predicted m6A sites in the Cdk2-3'UTR could mitigated the degradation of CDK2 mRNA after MA2 treatment.
Click to View Potential Drug Response of This Regulator
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
DNA modification
m6A Target: ANKRD13C divergent transcript (ANKRD13C-DT)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02006
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Long Terminal Repeat 7 (LTR7)
Crosstalk relationship m6A → DNA modification
m6A Target: Circ_YTHDC2
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT02027
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET2 (TET2)
Regulated Target Myocardin (MYOCD)
Crosstalk relationship m6A → DNA modification
Disease Hematological disorders
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02028
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET2 (TET2)
Regulated Target Serum response factor (SRF)
Crosstalk relationship m6A → DNA modification
Disease Hematological disorders
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02029
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET2 (TET2)
Regulated Target Krueppel-like factor 4 (KLF4)
Crosstalk relationship m6A → DNA modification
Disease Hematological disorders
 Disease Info 
Drug Metformin
 Drug Info 
Crosstalk ID: M6ACROT02097
 Crosstalk Info 
Epigenetic Regulator Methylcytosine dioxygenase TET2 (TET2)
Crosstalk relationship m6A → DNA modification
Disease Hematological disorders
 Disease Info 
m6A Target: Stearoyl-CoA desaturase (SCD)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02051
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Methyltransferase 16, RNA N6-adenosine (METTL16)
Crosstalk relationship DNA modification → m6A
Disease Papillary Thyroid Cancer
 Disease Info 
Drug Simvastatin
 Drug Info 
Histone modification
m6A Target: Mutated in multiple advanced cancers 1 (PTEN)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03043
 Crosstalk Info 
Epigenetic Regulator Polycomb Repressive Complex 2 (PRC2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship m6A → Histone modification
Disease Skin cancer
 Disease Info 
m6A Target: Histone-lysine N-methyltransferase ASH1L (ASH1L)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03205
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase ASH1L (ASH1L)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship m6A → Histone modification
Disease Uveitis
 Disease Info 
Crosstalk ID: M6ACROT05852
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase ASH1L (ASH1L)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship m6A → Histone modification
Disease Uveitis
 Disease Info 
m6A Target: NUTM2B antisense RNA 1 (NUTM2B-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03250
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase 2A (KMT2A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship m6A → Histone modification
Disease Liver cancer
 Disease Info 
m6A Target: Lysine-specific demethylase 5B (KDM5B)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03255
 Crosstalk Info 
Epigenetic Regulator Lysine-specific demethylase 5B (KDM5B)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship m6A → Histone modification
Disease Diabetic nephropathy
 Disease Info 
m6A Target: seRNA
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05868
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase 2A (KMT2A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship m6A → Histone modification
Disease Pancreatic ductal adenocarcinoma
 Disease Info 
Non-coding RNA
m6A Target: Dual specificity mitogen-activated protein kinase kinase 7 (MAP2K7)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05063
 Crosstalk Info 
Epigenetic Regulator Lnc-AK311120
Regulated Target YTH N6-methyladenosine RNA binding protein C2 (YTHDC2)
Crosstalk relationship ncRNA → m6A
m6A Target: Circ_YTHDC2
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05527
 Crosstalk Info 
Epigenetic Regulator Circ_YTHDC2
Regulated Target Tet methylcytosine dioxygenase 2 (TET2)
Crosstalk relationship m6A → ncRNA
Disease Hematological disorders
 Disease Info 
m6A Target: RNA component of 7SK nuclear ribonucleoprotein (RN7SK)
 Target Gene 
In total 5 item(s) under this m6A target
Crosstalk ID: M6ACROT05661
 Crosstalk Info 
Epigenetic Regulator RNA component of 7SK nuclear ribonucleoprotein (RN7SK)
Regulated Target Cullin 1 (CUL1)
Crosstalk relationship m6A → ncRNA
Drug mitoxantrone (MIT)
 Drug Info 
Crosstalk ID: M6ACROT06031
 Crosstalk Info 
Epigenetic Regulator RNA component of 7SK nuclear ribonucleoprotein (RN7SK)
Regulated Target Cullin 1 (CUL1)
Crosstalk relationship m6A → ncRNA
Drug hydroxyurea (HYD)
 Drug Info 
Crosstalk ID: M6ACROT06034
 Crosstalk Info 
Epigenetic Regulator RNA component of 7SK nuclear ribonucleoprotein (RN7SK)
Regulated Target Cullin 1 (CUL1)
Crosstalk relationship m6A → ncRNA
Drug raltitrexed (RAL)
 Drug Info 
Crosstalk ID: M6ACROT06037
 Crosstalk Info 
Epigenetic Regulator RNA component of 7SK nuclear ribonucleoprotein (RN7SK)
Regulated Target Cullin 1 (CUL1)
Crosstalk relationship m6A → ncRNA
Drug oxaliplatin (OXA)
 Drug Info 
Crosstalk ID: M6ACROT06040
 Crosstalk Info 
Epigenetic Regulator RNA component of 7SK nuclear ribonucleoprotein (RN7SK)
Regulated Target Cullin 1 (CUL1)
Crosstalk relationship m6A → ncRNA
Drug etoposide (ETO)
 Drug Info 
m6A Target: CALML3 antisense RNA 1 (CALML3-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05759
 Crosstalk Info 
Epigenetic Regulator CALML3 antisense RNA 1 (CALML3-AS1)
Regulated Target Histone-lysine N-methyltransferase EZH2 (EZH2)
Crosstalk relationship m6A → ncRNA
Disease Non-small cell lung cancer
 Disease Info 
Xenobiotics Compound(s) Regulating the m6A Methylation Regulator
Compound Name DEHP Investigative
Synonyms
DEHP; 117-81-7; BIS(2-ETHYLHEXYL)PHTHALATE; Di(2-ethylhexyl)phthalate; Di(2-ethylhexyl) phthalate; Diethylhexyl phthalate; 2-Ethylhexyl phthalate; Di-sec-octyl phthalate; Octyl phthalate; Fleximel; Octoil; Ethylhexyl phthalate; Palatinol AH; Celluflex DOP; Vestinol AH; Bisoflex DOP; Kodaflex DOP; Staflex DOP; Truflex DOP; Flexol DOP; Vinicizer 80; Bisoflex 81; Eviplast 80; Eviplast 81; Hercoflex 260; RC plasticizer DOP; Compound 889; Witcizer 312; Platinol dop; Di-2-ethylhexyl phthalate; Nuoplaz dop; Platinol ah; Hatcol dop; Reomol dop; Pittsburgh PX-138; Sansocizer DOP; Ergoplast FDO; Monocizer DOP; Plasthall DOP; Flexol plasticizer DOP; Mollan O; Jayflex DOP; Sicol 150; Ergoplast FDO-S; Di(2-ethylhexyl)orthophthalate; Good-rite gp 264; Reomol D 79P; Bis(2-ethylhexyl) benzene-1,2-dicarboxylate; Di(ethylhexyl) phthalate; Bis(ethylhexyl) phthalate; Rcra waste number U028; Px-138; Phthalic acid dioctyl ester; NCI-C52733; Di(2-ethylhexyl) o-phthalate; Phthalic acid di(2-ethylhexyl) ester; 1,2-Benzenedicarboxylic acid, bis(2-ethylhexyl) ester; DOP; Bis(2-ethylhexyl) 1,2-benzenedicarboxylate; UNII-C42K0PH13C; Bis(2-ethylhexyl) o-phthalate; Phthalic acid, bis(2-ethylhexyl) ester; CHEBI:17747; 1,2-Benzenedicarboxylic acid bis(2-ethylhexyl) ester; Benzenedicarboxylic acid, bis(2-ethylhexyl) ester; Phthalic Acid Bis(2-ethylhexyl) Ester; Bis-(2-ethylhexyl)ester kyseliny ftalove; C42K0PH13C; 1,2-Benzenedicarboxylic acid, 1,2-bis(2-ethylhexyl) ester; DTXSID5020607; Etalon; Bis-(2-ethylhexyl)ester kyseliny ftalove [Czech]; Di-(2-ethylhexyl) phthalate; BIS-(2-ETHYLHEXYL) PHTHALATE; NCGC00091499-05; Sconamoll DOP; Diacizer DOP; Kodaflex DEHP; 15495-94-0; Etalon (plasticizer); Sansocizer R 8000; Caswell No. 392K; Dioctylphthalate; Behp; Di-2-ethylhexylphthalate; Diplast O; ESBO-D 82; Ergoplast FDO; Ergoplast FDO-S; Etalon; Phthalic acid, bis-2-ethylhexyl ester; DOF [Russian plasticizer]; SMR000777878; CCRIS 237; Ethyl hexyl phthalate; HSDB 339; Di(2-ethylhexyl) orthophthalate; Bis-(2-ethylhexyl)ester kyseliny ftalove (czech); EINECS 204-211-0; NSC 17069; Diethylhexylphthalate (Bis-(2-ethylhexyl) Phthalate); RCRA waste no. U028; Union carbide flexol 380; EPA Pesticide Chemical Code 295200; BRN 1890696; AI3-04273; DAF 68; Palatinol DOP; Polycizer DOP; Merrol DOP; Palatinol AH-L; Hatco DOP; Vinycizer 80; Di(2-ethylhexyl)phthalate (DEHP); N-Dioctyl phthalate; MFCD00009493; Corflex 400; Dioctyl phthalate, 99%; DSSTox_CID_607; 1, bis(ethylhexyl) ester; Epitope ID:140107; EC 204-211-0; WLN: 8OVR BVO8; Di(2-Ethylhexyl phthalate); DSSTox_RID_75688; DSSTox_GSID_20607; SCHEMBL20271; 14C -DEHP; 8033-53-2; MLS001333173; MLS001333174; MLS002454397; Dioctyl phthalate, >=99.5%; 1,2-Benzenedicarboxylic acid, bis-(1-ethylhexyl) ester; CHEMBL1242017; SCHEMBL21733281; HMS2233C15; HMS3374J09; AMY40790; HY-B1945; NSC17069; Tox21_400084; Bis(2-ethylhexyl)ester phthalic acid; NSC-17069; s3360; AKOS024318875; Bis(2-ethylhexyl) phthalate-[13C6]; Phthalic acid bis(2-ethylhexyl ester); MCULE-4692716107; NCGC00091499-01; NCGC00091499-02; NCGC00091499-04; NCGC00091499-06; NCGC00091499-07; CAS-117-81-7; I887; Bis(2-ethylhexyl) 1, 2-benzenedicarboxylate; CS-0014050; FT-0624576; FT-0663286; P0297; WLN: 4Y2 & 1OVR BVO1Y4 & 2; Bis(2-ethylhexyl) phthalate, Selectophore(TM); C03690; A937603; Q418492; 1,2-Benzenedicarboxylic acid bis-(1-ethylhexyl) ester; benzene-1,2-dicarboxylic acid bis(2-ethylhexyl) ester; BRD-A89471977-001-05-2; Bis(2-ethylhexyl) phthalate 100 microg/mL in Methanol; Bis(2-ethylhexyl) phthalate 5000 microg/mL in Methanol; F0001-0292; Bis(2-ethylhexyl) phthalate, SAJ first grade, >=98.0%; Bis(2-ethylhexyl) phthalate, PESTANAL(R), analytical standard; Phthalic acid, bis-2-ethylhexyl ester 10 microg/mL in Cyclohexane; Plastic additive 01, European Pharmacopoeia (EP) Reference Standard; Bis(2-ethylhexyl) phthalate, certified reference material, TraceCERT(R); Plastic additive 14, United States Pharmacopeia (USP) Reference Standard; 1,2-Benzenedicarboxylic acid, bis(2-ethylhexyl) ester, labeled with carbon-14; 50885-87-5; 82208-43-3
    Click to Show/Hide
External link
CID: 8343
Description
DEHP worsened testicular histology, decreased testosterone concentrations, downregulated expression of spermatogenesis inducers, enhanced oxidative stress, inhibited theNrf2-mediated antioxidant pathway, and increased apoptosis in testes. DEHP is a common environmental endocrine disrupting chemical that inducesmale reproductive disorders. Additionally, DEHP increased global levels of m6A RNA modification and altered the expression of two important RNA methylation modulator genes, FTO and YTHDC2.
[11]
Compound Name Trichostatin A Investigative
Synonyms
trichostatin A; 58880-19-6; Trichostatin; TSA; Trichostatin A (TSA); (2E,4E,6R)-7-[4-(Dimethylamino)phenyl]-N-hydroxy-4,6-dimethyl-7-oxohepta-2,4-dienamide; UNII-3X2S926L3Z; Antibiotic A-300; CHEBI:46024; C17H22N2O3; GNF-PF-1011; 3X2S926L3Z; 58880-19-6 (R-isomer); 2,4-Heptadienamide, 7-(4-(dimethylamino)phenyl)-N-hydroxy-4,6-dimethyl-7-oxo-; 7-(4-(Dimethylamino)phenyl)-N-hydroxy-4,6-dimethyl-7-oxo-2,4-heptadienamide; MFCD03848392; (R,2E,4E)-7-(4-(dimethylamino)phenyl)-N-hydroxy-4,6-dimethyl-7-oxohepta-2,4-dienamide; A-300-I; (2E,4E,6R)-7-(4-(dimethylamino)phenyl)-N-hydroxy-4,6-dimethyl-7-oxo-2,4-heptadienamide; [R-(E,E)]-7-[4-(Dimethylamino)phenyl]-N-hydroxy-4,6-dimethyl-7-oxo-2,4-heptadienamide; 2,4-Heptadienamide, 7-[4-(dimethylamino)phenyl]-N-hydroxy-4,6-dimethyl-7-oxo-, (2E,4E,6R)-; Trichostatin-A; Tricostatin A; 7-[4-(DIMETHYLAMINO)PHENYL]-N-HYDROXY-4,6-DIMETHYL-7-OXO-2,4-HEPTADIENAMIDE; 2,4-Heptadienamide, 7-(4-(dimethylamino)phenyl)-N-hydroxy-4,6-dimethyl-7-oxo-, (2E,4E,6R)-; TSN; Trichostatina; trichostatine a; Trichlostatin A; Trichostatin(s); (2E,4E,6R)-7-(4-dimethylaminophenyl)-4,6-dimethyl-7-oxo-hepta-2,4-dienehydroxamic acid; (2E,4E,6R)-7-(4-Dimethylaminophenyl)-N-hydroxy-4,6-dimethyl-7-oxo-hepta-2,4-dienamide; Trichostatin A,TSA; (R)-Trichostatin A; NCGC_TSA; 1c3r; 3f0r; Trichostatin-A - TSA; SCHEMBL19886; MLS006011095; SGCTO-002; SCHEMBL675951; GTPL7005; DTXSID6037063; CHEBI:93196; BCPP000035; HMS1362L09; HMS1792L09; HMS1990L09; HMS3403L09; HMS3649O20; BCP01776; EX-A1665; Trichostatin A, Ready Made Solution; BDBM50005711; LMPK01000055; s1045; Trichostatin A from Streptomyces sp.; AKOS015899840; ZINC100014731; CCG-208142; CCG-208681; CS-0499; DB04297; NSC 311042; NCGC00162453-01; NCGC00162453-02; NCGC00162453-03; NCGC00162453-04; NCGC00162453-05; NCGC00162453-15; 3C10; AS-74315; HY-15144; M984; SMR004702883; A8183; SW219664-1; T2477; A25618; M02571; 880T196; Q425894; SR-05000013796; Q-201864; SR-05000013796-3; BRD-K68202742-001-04-1; BRD-K68202742-001-05-8; Trichostatin A, >=98% (HPLC), from Streptomyces sp.; Trichostatin A, Streptomyces sp. - CAS 58880-19-6; UNII-30RHG284Z4 component RTKIYFITIVXBLE-QEQCGCAPSA-N; Trichostatin A??, Vetec(TM) reagent grade, from Streptomyces sp., >=98%; (2E,4E,6R)-7-(4-(Dimethylamino)phen yl)-N-hydroxy-4,6-dimethyl-7-oxo-2,4-heptadienamid e; (6R)-N-Hydroxy-4,6-dimethyl-7-oxo-7-[4-(dimethylamino)phenyl]-2,4-heptadienamide; 7-[4-(Dimethylamino)phenyl]-N-hydroxy-4,6R-dimethyl-7-oxo-2E,4E-heptadienamide; 2,4-Heptadienamide, 7-[4-(dimethylamino)phenyl]-N-hydroxy-4,6-dimethyl-7-oxo-, (2E,4E,6R)- (9CI); 2,4-Heptadienamide, 7-[4-(dimethylamino)phenyl]-N-hydroxy-4,6-dimethyl-7-oxo-, [R-(E,E)]-; 2,4-Heptadienamide,7-[4-(dimethylamino)phenyl]-N-hydroxy-4,6-dimethyl-7-oxo-, (2E,4E,6R)-
    Click to Show/Hide
External link
CID: 444732
Description
Treatment with the HDAC inhibitor, trichostatin A (TSA), reduces YTHDC2 expression in Huh7 and in TNF-Alpha-stimulated hepatocytes.
 [36]
References
Ref 1 m(6)A Reader YTHDC2 Promotes Radiotherapy Resistance of Nasopharyngeal Carcinoma via Activating IGF1R/AKT/S6 Signaling Axis. Front Oncol. 2020 Jul 31;10:1166. doi: 10.3389/fonc.2020.01166. eCollection 2020.
Ref 2 N(6) -Methyladenosine Reader Protein YT521-B Homology Domain-Containing 2 Suppresses Liver Steatosis by Regulation of mRNA Stability of Lipogenic Genes. Hepatology. 2021 Jan;73(1):91-103. doi: 10.1002/hep.31220. Epub 2020 Oct 25.
Ref 3 A phase I dose escalation study with anti-CD44v6 bivatuzumab mertansine in patients with incurable squamous cell carcinoma of the head and neck or esophagus. Clin Cancer Res. 2006 Oct 15;12(20 Pt 1):6064-72. doi: 10.1158/1078-0432.CCR-06-0910.
Ref 4 Genetic variants in m6A modification genes are associated with esophageal squamous-cell carcinoma in the Chinese population. Carcinogenesis. 2020 Jul 10;41(6):761-768. doi: 10.1093/carcin/bgaa012.
Ref 5 The m(6)A reader YTHDC2 inhibits lung adenocarcinoma tumorigenesis by suppressing SLC7A11-dependent antioxidant function. Redox Biol. 2021 Jan;38:101801. doi: 10.1016/j.redox.2020.101801. Epub 2020 Nov 18.
Ref 6 Methylation of adenosine at the N(6) position post-transcriptionally regulates hepatic P450s expression. Biochem Pharmacol. 2020 Jan;171:113697. doi: 10.1016/j.bcp.2019.113697. Epub 2019 Nov 7.
Ref 7 Protective role of m(6)A binding protein YTHDC2 on CCNB2 in manganese-induced spermatogenesis dysfunction. Chem Biol Interact. 2022 Jan 5;351:109754. doi: 10.1016/j.cbi.2021.109754. Epub 2021 Nov 22.
Ref 8 RNA helicase YTHDC2 promotes cancer metastasis via the enhancement of the efficiency by which HIF-1Alpha mRNA is translated. Cancer Lett. 2016 Jun 28;376(1):34-42. doi: 10.1016/j.canlet.2016.02.022. Epub 2016 Mar 17.
Ref 9 The m(6)A reader YTHDC2 is essential for escape from KSHV SOX-induced RNA decay. Proc Natl Acad Sci U S A. 2022 Feb 22;119(8):e2116662119. doi: 10.1073/pnas.2116662119.
Ref 10 DOI: 10.1038/scibx.2012.669
Ref 11 Increased m6A RNA modification is related to the inhibition of the Nrf2-mediated antioxidant response in di-(2-ethylhexyl) phthalate-induced prepubertal testicular injury. Environ Pollut. 2020 Apr;259:113911. doi: 10.1016/j.envpol.2020.113911. Epub 2020 Jan 6.
Ref 12 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019
Ref 13 The N6-methyladenosine reader protein YTHDC2 promotes gastric cancer progression via enhancing YAP mRNA translation. Transl Oncol. 2022 Feb;16:101308. doi: 10.1016/j.tranon.2021.101308. Epub 2021 Dec 12.
Ref 14 Downregulation of m(6)A Reader YTHDC2 Promotes the Proliferation and Migration of Malignant Lung Cells via CYLD/NF-KappaB Pathway. Int J Biol Sci. 2021 Jun 22;17(10):2633-2651. doi: 10.7150/ijbs.58514. eCollection 2021.
Ref 15 Structure-activity studies of phenanthroindolizidine alkaloids as potential antitumor agents. Bioorg Med Chem Lett. 2007 Aug 1;17(15):4338-42. doi: 10.1016/j.bmcl.2007.05.021. Epub 2007 May 16.
Ref 16 Doxorubicin plus the IGF-1R antibody cixutumumab in soft tissue sarcoma: a phase I study using the TITE-CRM model. Ann Oncol. 2015 Jul;26(7):1459-64. doi: 10.1093/annonc/mdv171. Epub 2015 Apr 9.
Ref 17 Novel IKK inhibitors: beta-carbolines. Bioorg Med Chem Lett. 2003 Jul 21;13(14):2419-22. doi: 10.1016/s0960-894x(03)00408-6.
Ref 18 YTHDC2-Mediated circYTHDC2 N6-Methyladenosine Modification Promotes Vascular Smooth Muscle Cells Dysfunction Through Inhibiting Ten-Eleven Translocation 2. Front Cardiovasc Med. 2021 Oct 1;8:686293. doi: 10.3389/fcvm.2021.686293. eCollection 2021.
Ref 19 Epigenetics and beyond: targeting writers of protein lysine methylation to treat disease. Nat Rev Drug Discov. 2021 Apr;20(4):265-286. doi: 10.1038/s41573-020-00108-x. Epub 2021 Jan 19.
Ref 20 Phase I and biomarker study of OPB-51602, a novel signal transducer and activator of transcription (STAT) 3 inhibitor, in patients with refractory solid malignancies. Ann Oncol. 2015 May;26(5):998-1005. doi: 10.1093/annonc/mdv026. Epub 2015 Jan 21.
Ref 21 Company report (OncoMed Pharmaceuticals)
Ref 22 Riociguat (adempas): a novel agent for the treatment of pulmonary arterial hypertension and chronic thromboembolic pulmonary hypertension. P T. 2014 Nov;39(11):749-58.
Ref 23 Internalization and intracellular trafficking of a PTD-conjugated anti-fibrotic peptide, AZX100, in human dermal keloid fibroblasts. J Pharm Sci. 2010 Jul;99(7):3100-21. doi: 10.1002/jps.22087.
Ref 24 ClinicalTrials.gov (NCT02541370) Treatment of Relapsed and/or Chemotherapy Refractory Advanced Malignancies by CART133
Ref 25 Identification of the human P450 enzymes involved in lansoprazole metabolism. J Pharmacol Exp Ther. 1996 May;277(2):805-16.
Ref 26 Active efflux of the 5-HT(1A) receptor agonist flesinoxan via P-glycoprotein at the blood-brain barrier. Eur J Pharm Sci. 2001 Aug;14(1):81-6.
Ref 27 US patent application no. 6,187,586, Antisense modulation of AKT-3 expression.
Ref 28 Reductive metabolism of nabumetone by human liver microsomal and cytosolic fractions: exploratory prediction using inhibitors and substrates as marker probes. Eur J Drug Metab Pharmacokinet. 2015 Jun;40(2):127-35. doi: 10.1007/s13318-014-0190-0.
Ref 29 Analysis of Genetic Alteration Signatures and Prognostic Values of m6A Regulatory Genes in Head and Neck Squamous Cell Carcinoma. Front Oncol. 2020 May 29;10:718. doi: 10.3389/fonc.2020.00718. eCollection 2020.
Ref 30 Prognostic Implication of the m(6)A RNA Methylation Regulators in Rectal Cancer. Front Genet. 2021 Jun 3;12:604229. doi: 10.3389/fgene.2021.604229. eCollection 2021.
Ref 31 Molecular and cellular pharmacology of the novel noncamptothecin topoisomerase I inhibitor Genz-644282. Mol Cancer Ther. 2011 Aug;10(8):1490-9.
Ref 32 [Role of m (6)A Reader YTHDC2 in Differentiation of Human Bone Marrow Mesenchymal Stem Cells]. Sichuan Da Xue Xue Bao Yi Xue Ban. 2021 May;52(3):402-408. doi: 10.12182/20210560204.
Ref 33 Pathogenic variants in the human m6A reader YTHDC2 are associated with primary ovarian insufficiency. JCI Insight. 2022 Mar 8;7(5):e154671. doi: 10.1172/jci.insight.154671.
Ref 34 Meclofenamic acid represses spermatogonial proliferation through modulating m(6)A RNA modification. J Anim Sci Biotechnol. 2019 Jul 11;10:63. doi: 10.1186/s40104-019-0361-6. eCollection 2019.
Ref 35 Ythdc2 is an N(6)-methyladenosine binding protein that regulates mammalian spermatogenesis. Cell Res. 2017 Sep;27(9):1115-1127. doi: 10.1038/cr.2017.99. Epub 2017 Aug 15.
Ref 36 Transcriptional machinery of TNF-Alpha-inducible YTH domain containing 2 (YTHDC2) gene. Gene. 2014 Feb 1;535(1):24-32. doi: 10.1016/j.gene.2013.11.005. Epub 2013 Nov 21.