m6A Regulator Information

General Information of the m6A Regulator (ID: REG00015)
Regulator Name Protein virilizer homolog (VIRMA)
Synonyms
KIAA1429; MSTP054
    Click to Show/Hide
Gene Name VIRMA
Sequence
MAVDSAMELLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSSLPDNRAYG
ETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSIIFRPNSKVNTDGLVLRGWYNCL
TLAIYGSVDRVISHDRDSPPPPPPPPPPPQPQPSLKRNPKHADGEKEDQFNGSPPRPQPR
GPRTPPGPPPPDDDEDDPVPLPVSGDKEEDAPHREDYFEPISPDRNSVPQEGQYSDEGEV
EEEQQEEGEEDEDDVDVEEEEDEDEDDRRTVDSIPEEEEEDEEEEGEEDEEGEGDDGYEQ
ISSDEDGIADLERETFKYPNFDVEYTAEDLASVPPMTYDPYDRELVPLLYFSCPYKTTFE
IEISRMKDQGPDKENSGAIEASVKLTELLDLYREDRGAKWVTALEEIPSLIIKGLSYLQL
KNTKQDSLGQLVDWTMQALNLQVALRQPIALNVRQLKAGTKLVSSLAECGAQGVTGLLQA
GVISGLFELLFADHVSSSLKLNAFKALDSVISMTEGMEAFLRGRQNEKSGYQKLLELILL
DQTVRVVTAGSAILQKCHFYEVLSEIKRLGDHLAEKTSSLPNHSEPDHDTDAGLERTNPE
YENEVEASMDMDLLESSNISEGEIERLINLLEEVFHLMETAPHTMIQQPVKSFPTMARIT
GPPERDDPYPVLFRYLHSHHFLELVTLLLSIPVTSAHPGVLQATKDVLKFLAQSQKGLLF
FMSEYEATNLLIRALCHFYDQDEEEGLQSDGVIDDAFALWLQDSTQTLQCITELFSHFQR
CTASEETDHSDLLGTLHNLYLITFNPVGRSAVGHVFSLEKNLQSLITLMEYYSKEALGDS
KSKKSVAYNYACILILVVVQSSSDVQMLEQHAASLLKLCKADENNAKLQELGKWLEPLKN
LRFEINCIPNLIEYVKQNIDNLMTPEGVGLTTALRVLCNVACPPPPVEGQQKDLKWNLAV
IQLFSAEGMDTFIRVLQKLNSILTQPWRLHVNMGTTLHRVTTISMARCTLTLLKTMLTEL
LRGGSFEFKDMRVPSALVTLHMLLCSIPLSGRLDSDEQKIQNDIIDILLTFTQGVNEKLT
ISEETLANNTWSLMLKEVLSSILKVPEGFFSGLILLSELLPLPLPMQTTQVIEPHDISVA
LNTRKLWSMHLHVQAKLLQEIVRSFSGTTCQPIQHMLRRICVQLCDLASPTALLIMRTVL
DLIVEDLQSTSEDKEKQYTSQTTRLLALLDALASHKACKLAILHLINGTIKGDERYAEIF
QDLLALVRSPGDSVIRQQCVEYVTSILQSLCDQDIALILPSSSEGSISELEQLSNSLPNK
ELMTSICDCLLATLANSESSYNCLLTCVRTMMFLAEHDYGLFHLKSSLRKNSSALHSLLK
RVVSTFSKDTGELASSFLEFMRQILNSDTIGCCGDDNGLMEVEGAHTSRTMSINAAELKQ
LLQSKEESPENLFLELEKLVLEHSKDDDNLDSLLDSVVGLKQMLESSGDPLPLSDQDVEP
VLSAPESLQNLFNNRTAYVLADVMDDQLKSMWFTPFQAEEIDTDLDLVKVDLIELSEKCC
SDFDLHSELERSFLSEPSSPGRTKTTKGFKLGKHKHETFITSSGKSEYIEPAKRAHVVPP
PRGRGRGGFGQGIRPHDIFRQRKQNTSRPPSMHVDDFVAAESKEVVPQDGIPPPKRPLKV
SQKISSRGGFSGNRGGRGAFHSQNRFFTPPASKGNYSRREGTRGSSWSAQNTPRGNYNES
RGGQSNFNRGPLPPLRPLSSTGYRPSPRDRASRGRGGLGPSWASANSGSGGSRGKFVSGG
SGRGRHVRSFTR
    Click to Show/Hide
Family vir family
Function
Associated component of the WMM complex, a complex that mediates N6-methyladenosine (m6A) methylation of RNAs, a modification that plays a role in the efficiency of mRNA splicing and RNA processing . Acts as a key regulator of m6A methylation by promoting m6A methylation of mRNAs in the 3'-UTR near the stop codon: recruits the catalytic core components METTL3 and METTL14, thereby guiding m6A methylation at specific sites. Required for mRNA polyadenylation via its role in selective m6A methylation: m6A methylation of mRNAs in the 3'-UTR near the stop codon correlating with alternative polyadenylation (APA).
    Click to Show/Hide
Gene ID 25962
Uniprot ID
VIR_HUMAN
Regulator Type WRITER ERASER READER
Mechanism Diagram Click to View the Original Diagram
Target Genes Click to View Potential Target Genes of This Regulator
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
VIRMA can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Browse Target Gene related Drug
Cyclin-dependent kinase 1 (CDK1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by VIRMA
Cell Line Human umbilical vein endothelial cells Homo sapiens
Treatment: siVIRMA HUVECs
Control: siControl HUVECs
 GSE167067
Regulation
logFC: -7.84E-01
p-value: 3.08E-02
More Results Click to View More RNA-seq Results
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Fluorouracil Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process Cell proliferation and metastasis
Response Summary KIAA1429 acts as an oncogenic factor in breast cancer by regulating CDK1 in an N6-methyladenosine-independent manner.5'-fluorouracil was found to be very effective in reducing the expression of KIAA1429 and Cyclin-dependent kinase 1 (CDK1) in breast cancer.
Death-associated protein kinase 3 (DAPK3)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by VIRMA
Cell Line Human umbilical vein endothelial cells Homo sapiens
Treatment: siVIRMA HUVECs
Control: siControl HUVECs
 GSE167067
Regulation
logFC: 5.95E-01
p-value: 2.81E-02
More Results Click to View More RNA-seq Results
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Down regulation
In-vitro Model
 PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Response Summary High expression of KIAA1429 was testified in patients with non-small cell lung cancer and predicted worse prognosis in patients. KIAA1429-guided m6A modifications promoted NSCLC progression via m6A-dependent degradation of Death-associated protein kinase 3 (DAPK3) mRNA.
Histone H2AX (H2AX)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by VIRMA
Cell Line Human umbilical vein endothelial cells Homo sapiens
Treatment: siVIRMA HUVECs
Control: siControl HUVECs
 GSE167067
Regulation
logFC: -1.09E+00
p-value: 1.68E-02
More Results Click to View More RNA-seq Results
Testicular cancer [ICD-11: 2C80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Germ cell tumour of testis [ICD-11: 2C80.2]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Down regulation
In-vitro Model
 2102EP Embryonal carcinoma Homo sapiens CVCL_C522
NCC-IT Testicular embryonal carcinoma Homo sapiens CVCL_1451
NT2 Malignant neoplasms Mus musculus CVCL_JA57
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary VIRMA has an oncogenic role in germ cell tumor confirming our previous tissue-based study and is further involved in response to cisplatin by interfering with DNA repair. Enhanced response to cisplatin after VIRMA knockdown was related to significant increase in DNA damage (with higher Histone H2AX (H2AX) and GADD45B levels) and downregulation of XLF and MRE11.
SMC protein 1A (SMC1A)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and VIRMA
Cell Line HeLa Homo sapiens
Regulation logFC: 1.58E+00 GSE102493
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Pathway Response Adherens junction hsa04520
Cell Process Epithelial-mesenchymal transition
Cell migration
Cell invasion
In-vitro Model
 ZR-75-1 Invasive breast carcinoma Homo sapiens CVCL_0588
SUM1315MO2 Invasive breast carcinoma of no special type Homo sapiens CVCL_5589
In-vivo Model For the mouse lung metastasis model, SUM-1315 cells (2 × 106/0.2 mL) expressing NC, shKIAA1429, SNAIL, or shKIAA1429+SNAIL were injected into the nude mice through the tail vein.
Response Summary KIAA1429 could significantly promote the migration and invasion of breast cancer cells. KIAA1429 could bind to the motif in the 3' UTR of SMC protein 1A (SMC1A) mRNA directly and enhance SMC1A mRNA stability. In conclusion, the study revealed a novel mechanism of the KIAA1429/SMC1A/SNAIL axis in the regulation of metastasis of breast cancer.
Transcription factor Jun (c-Jun/JUN)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and VIRMA
Cell Line HeLa Homo sapiens
Regulation logFC: 1.80E+00 GSE102493
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [5]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process Arrest cell cycle at the S phase
In-vitro Model
 MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
In-vivo Model Gastric cancer cell line MGC803 (shRNA-NC or shKIAA1429; 1 × 107) was injected subcutaneously into the armpit of BALB/c nude mice (5-week-old, male, n = 4 for each group). Tumor growth was monitored at 3-day intervals.
Response Summary KIAA1429 played a key role in promoting gastric cancer by regulating Transcription factor Jun (c-Jun/JUN) expression in an m6A independent manner.
Alpha-enolase (ENO1)
 Target Gene 
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Target Regulation Up regulation
In-vitro Model
 ES-2 Ovarian clear cell adenocarcinoma Homo sapiens CVCL_3509
HEY Ovarian serous adenocarcinoma Homo sapiens CVCL_0297
OVCAR-3 Ovarian serous adenocarcinoma Homo sapiens CVCL_0465
SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
A2780 Ovarian endometrioid adenocarcinoma Homo sapiens CVCL_0134
IOSE-80
 N.A. Homo sapiens CVCL_5546
Cyclin-dependent kinase 4 (CDK4)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Lung cancer [ICD-11: 2C25]
Cell Process Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
HBE (Human bronchial epithelial cell line)
LTEP-a2 Endocervical adenocarcinoma Homo sapiens CVCL_6929
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
Response Summary GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, CCND1, Cyclin-dependent kinase 4 (CDK4), EGR2, YBX1, and TLX, which were associated with lung cancers.
Cystine/glutamate transporter (SLC7A11)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 3 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Cycloleucine Investigative
 Drug Info 
In-vitro Model
 Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
SK-HEP-1 Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Ferrostatin-1 Investigative
 Drug Info 
In-vitro Model
 Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
SK-HEP-1 Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Liproxstatin-1 Investigative
 Drug Info 
In-vitro Model
 Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
SK-HEP-1 Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
DNA-binding protein inhibitor ID-2 (ID2)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
Pathway Response RNA degradation hsa03018
Cell Process Cell migration and invasion
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Hep-G2/2.2.15 Hepatoblastoma Homo sapiens CVCL_L855
L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Response Summary KIAA1429 facilitated migration and invasion of Hepatocellular carcinoma cells by inhibiting DNA-binding protein inhibitor ID-2 (ID2) via upregulating m6A modification of ID2 mRNA.
Double-strand break repair protein MRE11 (MRE11)
 Target Gene 
Testicular cancer [ICD-11: 2C80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Germ cell tumour of testis [ICD-11: 2C80.2]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 2102EP Embryonal carcinoma Homo sapiens CVCL_C522
NCC-IT Testicular embryonal carcinoma Homo sapiens CVCL_1451
NT2 Malignant neoplasms Mus musculus CVCL_JA57
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary VIRMA has an oncogenic role in germ cell tumor confirming our previous tissue-based study and is further involved in response to cisplatin by interfering with DNA repair. Enhanced response to cisplatin after VIRMA knockdown was related to significant increase in DNA damage (with higher Gamma-H2AX and GADD45B levels) and downregulation of XLF and Double-strand break repair protein MRE11 (MRE11).
E3 SUMO-protein ligase EGR2 (EGR2)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Lung cancer [ICD-11: 2C25]
Cell Process Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
HBE (Human bronchial epithelial cell line)
LTEP-a2 Endocervical adenocarcinoma Homo sapiens CVCL_6929
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
Response Summary GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, CCND1, CDK4, E3 SUMO-protein ligase EGR2 (EGR2), YBX1, and TLX, which were associated with lung cancers.
E3 ubiquitin-protein ligase Hakai (CBLL1)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Cell Process Cell apoptosis
Response Summary KIAA1429 had the highest mutation frequency. Higher E3 ubiquitin-protein ligase Hakai (CBLL1) expression was associated with a better prognosis in breast cancer than lower CBLL1 expression.
Forkhead box protein M1 (FOXM1)
 Target Gene 
Multiple myeloma [ICD-11: 2A83]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Multiple myeloma [ICD-11: 2A83.1]
In-vitro Model
 NCI-H929 Plasma cell myeloma Homo sapiens CVCL_1600
MM1.S Plasma cell myeloma Homo sapiens CVCL_8792
U266B1 Plasma cell myeloma Homo sapiens CVCL_0566
RPMI-8226 Plasma cell myeloma Homo sapiens CVCL_0014
CAG Plasma cell myeloma Homo sapiens CVCL_D569
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Responsed Drug Oxaliplatin Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 GES-1 Normal Homo sapiens CVCL_EQ22
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
G1/S-specific cyclin-D1 (CCND1)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Lung cancer [ICD-11: 2C25]
Cell Process Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
HBE (Human bronchial epithelial cell line)
LTEP-a2 Endocervical adenocarcinoma Homo sapiens CVCL_6929
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
Response Summary GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, G1/S-specific cyclin-D1 (CCND1), CDK4, EGR2, YBX1, and TLX, which were associated with lung cancers.
Glycogen synthase kinase-3 beta (GSK3Beta/GSK3B)
 Target Gene 
Structural developmental anomalies of large intestine [ICD-11: LB16]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [13]
Responsed Disease Structural developmental anomalies of large intestine [ICD-11: LB16.1]
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
SH-SY5Y Neuroblastoma Homo sapiens CVCL_0019
Hexokinase-2 (HK2)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [14]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Metabolic pathways hsa01100
Glycolysis / Gluconeogenesis hsa00010
Cell Process Glycolysis
In-vitro Model
 SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
HT29 Colon cancer Mus musculus CVCL_A8EZ
FHC Normal Homo sapiens CVCL_3688
Response Summary KIAA1429 has the potential to promote CRC carcinogenesis by targeting Hexokinase-2 (HK2) via m6A-independent manner, providing insight into the critical roles of m6A in CRC.
Homeobox protein Hox-A1 (HOXA1)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [15]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Gefitinib Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
NHBE (Normal bronchial epithelial cells)
In-vivo Model PC9-GR cells stably infected with KIAA1429-targeting shRNA and control were suspended in 100 uL of PBS with Matrigel matrix (BD Biosciences). Then, cells were injected into one of the flanks of BALB/c nude mice.
Response Summary m6A methyltransferase KIAA1429 was highly expressed in gefitinib-resistant NSCLC cells (PC9-GR), tissues, and closely related to unfavorable survival. KIAA1429 plays essential oncogenic roles in NSCLC gefitinib resistance, which provided a feasible therapeutic target for NSCLC.
Mucin-3A (MUC3A)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [16]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Up regulation
Cell Process Cell migration
celCl proliferation
Cell invasion
In-vitro Model
 NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
HBE (Human bronchial epithelial cell line)
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
PLA-801D Lung giant cell carcinoma Homo sapiens CVCL_7110
Response Summary KIAA1429 regulates Mucin-3A (MUC3A) expression through m6A modification to modulate LUAD cells to proliferate, migrate, invade, and induce cell cycle arrest.
NAD-dependent protein deacetylase sirtuin-1 (SIRT1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [17]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
NCM460 Normal Homo sapiens CVCL_0460
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
In-vivo Model 5.0 × 106 SW480 cells (infected with scr or KIAA1429 shRNA) that suspended in 50 ul PBS and mixed with an equal volume of matrigel were subcutaneously injected in a 6-weeks-old male NOD/SCID (The Jackson Laboratory, Stock No: 001303) mice flank. We started measuring tumor size at the indicated times one week after injection.
Response Summary KIAA1429 increased the expression of NAD-dependent protein deacetylase sirtuin-1 (SIRT1) via regulating its mRNA stability in an m6A-dependent manner. More importantly, in vivo experiment showed that depletion of KIAA1429 significantly inhibited colorectal tumor growth.
Negative growth regulatory protein MyD118 (GADD45B)
 Target Gene 
Testicular cancer [ICD-11: 2C80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Germ cell tumour of testis [ICD-11: 2C80.2]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Down regulation
In-vitro Model
 2102EP Embryonal carcinoma Homo sapiens CVCL_C522
NCC-IT Testicular embryonal carcinoma Homo sapiens CVCL_1451
NT2 Malignant neoplasms Mus musculus CVCL_JA57
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary VIRMA has an oncogenic role in germ cell tumor confirming our previous tissue-based study and is further involved in response to cisplatin by interfering with DNA repair. Enhanced response to cisplatin after VIRMA knockdown was related to significant increase in DNA damage (with higher Gamma-H2AX and Negative growth regulatory protein MyD118 (GADD45B) levels) and downregulation of XLF and MRE11.
Non-homologous end-joining factor 1 (NHEJ1/XLF)
 Target Gene 
Testicular cancer [ICD-11: 2C80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Germ cell tumour of testis [ICD-11: 2C80.2]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 2102EP Embryonal carcinoma Homo sapiens CVCL_C522
NCC-IT Testicular embryonal carcinoma Homo sapiens CVCL_1451
NT2 Malignant neoplasms Mus musculus CVCL_JA57
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary VIRMA has an oncogenic role in germ cell tumor confirming our previous tissue-based study and is further involved in response to cisplatin by interfering with DNA repair. Enhanced response to cisplatin after VIRMA knockdown was related to significant increase in DNA damage (with higher Gamma-H2AX and GADD45B levels) and downregulation of Non-homologous end-joining factor 1 (NHEJ1/XLF) and MRE11.
Nuclear receptor subfamily 2 group E member 1 (TLX/NR2E1)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Lung cancer [ICD-11: 2C25]
Cell Process Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
HBE (Human bronchial epithelial cell line)
LTEP-a2 Endocervical adenocarcinoma Homo sapiens CVCL_6929
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
Response Summary GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, CCND1, CDK4, EGR2, YBX1, and Nuclear receptor subfamily 2 group E member 1 (TLX/NR2E1), which were associated with lung cancers.
Pre-mRNA-splicing regulator WTAP (WTAP)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Lung cancer [ICD-11: 2C25]
Cell Process Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
HBE (Human bronchial epithelial cell line)
LTEP-a2 Endocervical adenocarcinoma Homo sapiens CVCL_6929
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
Response Summary GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, Pre-mRNA-splicing regulator WTAP (WTAP), CCND1, CDK4, EGR2, YBX1, and TLX, which were associated with lung cancers.
Protein BTG2 (BTG2)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
SPC-A1 Endocervical adenocarcinoma Homo sapiens CVCL_6955
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
HBE (Human bronchial epithelial cell line)
In-vivo Model For the in vivo cell proliferation assay, A549 and SPCA1 cells were stably transfected with sh-Ctrl and sh-KIAA1429 using lentivirus (GeneChem, Shanghai, China). The cells were subcutaneously injected into either side of the posterior flanks of the mouse. The tumor volume was measured every few days (length×width2×0.5).
Response Summary Knockdown of KIAA1429 significantly decreased the m6A levels of Protein BTG2 (BTG2) mRNA, leading to enhanced YTHDF2-dependent BTG2 mRNA stability and promoted the expression of BTG2; thus, participating in the tumorigenesis of LUAD.
Trans-acting T-cell-specific transcription factor GATA-3 (GATA3)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Down regulation
Cell Process Cell proliferation and metastasis
In-vitro Model
 HCCLM3 Adult hepatocellular carcinoma Homo sapiens CVCL_6832
HEK293T Normal Homo sapiens CVCL_0063
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
SK-HEP-1 Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
SNU-182 Adult hepatocellular carcinoma Homo sapiens CVCL_0090
SNU-449 Adult hepatocellular carcinoma Homo sapiens CVCL_0454
Response Summary KIAA1429 induced m6A methylation on the 3' UTR of Trans-acting T-cell-specific transcription factor GATA-3 (GATA3) pre-mRNA, leading to the separation of the RNA-binding protein HuR and the degradation of GATA3 pre-mRNA. KIAA1429 was considerably upregulated in Hepatocellular carcinoma tissues.
Transcription factor AP-2-alpha (TFAP2A)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [20]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
In-vitro Model
 EO771 Malignant neoplasms of the mouse mammary gland Mus musculus CVCL_GR23
EMT6 Malignant neoplasms of the mouse mammary gland Mus musculus CVCL_1923
4T1.2 Malignant neoplasms of the mouse mammary gland Mus musculus CVCL_GR32
NMuMG
 N.A. Mus musculus CVCL_0075
Transcription factor E2F3 (E2F3)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Lung cancer [ICD-11: 2C25]
Cell Process Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
HBE (Human bronchial epithelial cell line)
LTEP-a2 Endocervical adenocarcinoma Homo sapiens CVCL_6929
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
Response Summary GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including Transcription factor E2F3 (E2F3), WTAP, CCND1, CDK4, EGR2, YBX1, and TLX, which were associated with lung cancers.
Wee1-like protein kinase (WEE1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [21]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
Response Summary KIAA1429 plays an oncogenic role in CRC cells by inhibiting the expression of Wee1-like protein kinase (WEE1) in an m6A-independent manner and is associated with poor survival in CRC patients.
Y-box-binding protein 1 (YBX1)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Lung cancer [ICD-11: 2C25]
Cell Process Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
HBE (Human bronchial epithelial cell line)
LTEP-a2 Endocervical adenocarcinoma Homo sapiens CVCL_6929
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
Response Summary GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, CCND1, CDK4, EGR2, Y-box-binding protein 1 (YBX1), and TLX, which were associated with lung cancers.
Zinc finger protein SNAI1 (SNAI1)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Pathway Response Adherens junction hsa04520
Cell Process Epithelial-mesenchymal transition
Cell migration
Cell invasion
In-vitro Model
 ZR-75-1 Invasive breast carcinoma Homo sapiens CVCL_0588
SUM1315MO2 Invasive breast carcinoma of no special type Homo sapiens CVCL_5589
In-vivo Model For the mouse lung metastasis model, SUM-1315 cells (2 × 106/0.2 mL) expressing NC, shKIAA1429, SNAIL, or shKIAA1429+SNAIL were injected into the nude mice through the tail vein.
Response Summary KIAA1429 could significantly promote the migration and invasion of breast cancer cells. KIAA1429 could bind to the motif in the 3' UTR of SMC1A mRNA directly and enhance SMC1A mRNA stability. In conclusion, the study revealed a novel mechanism of the KIAA1429/SMC1A/Zinc finger protein SNAI1 (SNAI1) axis in the regulation of metastasis of breast cancer.
Colon cancer associated transcript 1 (CCAT1)
 Target Gene 
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [22]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
Cell Process RNA stability
In-vitro Model
 22Rv1 Prostate carcinoma Homo sapiens CVCL_1045
DU145 Prostate carcinoma Homo sapiens CVCL_0105
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
VCaP Prostate carcinoma Homo sapiens CVCL_2235
Response Summary VIRMA downregulation attenuates the aggressive phenotype of prostate cancer by overall reduction of m6A-levels decreasing stability and abundance of oncogenic lncRNAs. VIRMA depletion and m6A reduction decreased the stability and abundance of Colon cancer associated transcript 1 (CCAT1) transcripts.
Colon cancer associated transcript 2 (CCAT2)
 Target Gene 
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [22]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
Cell Process RNA stability
In-vitro Model
 22Rv1 Prostate carcinoma Homo sapiens CVCL_1045
DU145 Prostate carcinoma Homo sapiens CVCL_0105
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
VCaP Prostate carcinoma Homo sapiens CVCL_2235
Response Summary VIRMA downregulation attenuates the aggressive phenotype of prostate cancer by overall reduction of m6A-levels decreasing stability and abundance of oncogenic lncRNAs. VIRMA depletion and m6A reduction decreased the stability and abundance of Colon cancer associated transcript 2 (CCAT2) transcripts.
Long intergenic non-protein coding RNA 958 (LINC00958)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [23]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Cell Process Glycolysis
In-vitro Model
 SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
GES-1 Normal Homo sapiens CVCL_EQ22
BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
In-vivo Model Ten four-week-old BALB/c nude mice were injected with LINC00958-overexpressing or vector-transfected cells. Briefly, 5 × 106 cells were subcutaneously injected in the flank of mice. Four weeks after injection, the mice were sacrificed and examined by weighting.
Response Summary Long intergenic non-protein coding RNA 958 (LINC00958) accelerated the aerobic glycolysis of GC cells. Mechanistically, KIAA1429 interacted with the m6A modification site and promoted the enrichment of LINC00958, and LINC00958 subsequently cooperated with GLUT1 mRNA to enhance its mRNA stability.
Nuclear paraspeckle assembly transcript 1 (NEAT1)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [24]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
In-vitro Model
 SK-BR-3 Breast adenocarcinoma Homo sapiens CVCL_0033
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MDA-MB-453 Breast adenocarcinoma Homo sapiens CVCL_0418
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
AU565 Breast adenocarcinoma Homo sapiens CVCL_1074
Hs 578T Invasive breast carcinoma Homo sapiens CVCL_0332
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model Mice were acclimatised at the Centenary Institute Animal Facility for a minimum of 7 days after initial arrival. Prior to tumour injection, mice were anaesthetised by ketamine/xylazine by intraperitoneal injection. Subsequently, the fur surrounding the 4th mammary fat pad on the right was removed using the hair removal cream. MDA-MB-231 cells (5 × 106) in 100 μL of 1:1 HBSS:Matrigel were then injected subcutaneously into the 4th right mammary fat pad using 27 g insulin needles. Mice were injected intraperitoneally with the reversal atipamezole to improve the recovery from anaesthesia. Mice were monitored twice weekly by assessing body condition, measuring body weights and tumour sizes. The frequency of monitoring was increased to daily when tumours reached > 500 mm3 in size. Mice were killed when tumours reached > 1000 mm3 in size and the relevant organs were harvested for analysis.
hsa-miR-143-3p
 Target Gene 
Aortic aneurysm or dissection [ICD-11: BD50]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [25]
Responsed Disease Aortic aneurysm or dissection [ICD-11: BD50]
Target Regulation Down regulation
Pathway Response RNA degradation hsa03018
Cell Process Cell apoptosis
In-vitro Model
 IM-HAEC Normal Homo sapiens CVCL_B5WL
In-vivo Model Osmotic mini-pumps containing AngII (1 ug/kg/min, Enzo Bioche) were implanted in 7-week-old male mice. To interfere with the expression of KIAA1429, ALKBH5, or DDX6 in vivo, adeno-associated virus 9 (AAV9) vectors carrying a variety of overexpression plasmids or interfering RNA were randomly injected through the tail vein to C57BL/6N mice.
Response Summary KIAA1429 is downregulated while ALKBH5 is upregulated in aortic tissues from aortic dissection patients. KIAA1429/ALKBH5-mediated m6A modifications can regulate the processing of hsa-miR-143-3p through interacting with the microprocessor protein DGCR8. KIAA1429 and ALKBH5 can oppositely regulate HASMC proliferation, HAEC apoptosis, and AD progression in AngII-infused mice via the miR-143-3p/DDX6 pathway.
Carbohydrate sulfotransferase 11 (CHST11)
 Target Gene 
Diffuse large B-cell lymphomas [ICD-11: 2A81]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [26]
Responsed Disease Diffuse large B-cell lymphomas [ICD-11: 2A81]
Target Regulation Down regulation
In-vitro Model
 OCI-Ly1 Diffuse large B-cell lymphoma Homo sapiens CVCL_1879
OCI-Ly8 Diffuse large B-cell lymphoma germinal center B-cell type Homo sapiens CVCL_8803
OCI-Ly3 Diffuse large B-cell lymphoma activated B-cell type Homo sapiens CVCL_8800
VAL Diffuse large B-cell lymphoma Homo sapiens CVCL_1819
U-2932 Diffuse large B-cell lymphoma Homo sapiens CVCL_1896
In-vivo Model A total of 1 × 107 KIAA1429 stable knockdown OCI-LY1 cells or CHST11 stable knockdown OCI-LY1 cells were injected subcutaneously into the right armpit of mice. Two investigators who were blinded to the mice allocation observed the general condition of mice and tumor growth every 2 days, measuring tumor size with a vernier caliper upon the tumor size was higher than the skin surface and recording it.
CCN family member 2 (CTGF)
 Target Gene 
Chronic kidney disease [ICD-11: GB61]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [27]
Responsed Disease Chronic kidney disease [ICD-11: GB61]
Target Regulation Up regulation
In-vitro Model
SV40 MES 13
 N.A. Mus musculus CVCL_5368
NRK-52E Normal Rattus norvegicus CVCL_0468
Circ_DLC1
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [28]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Down regulation
Pathway Response RNA degradation hsa03018
Cell Process RNA stability
In-vitro Model
 SNU-449 Adult hepatocellular carcinoma Homo sapiens CVCL_0454
SK-HEP-1 Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
In-vivo Model 5 × 105 cells were injected subcutaneously into the right axilla of mice. Tumor volume was measured by a caliper weekly and calculated as length × width2 × 0.52. For the liver orthotopic-implanted models, each liver of mice was injected with 1 × 106 cells.
Response Summary Circ_DLC1, a downstream target of KIAA1429, is a promising prognostic marker for HCC patients, and the circDLC1-HuR-MMP1 axis serve as a potential therapeutic target for HCC treatment.
endogenous Bornavirus like nucleoprotein 3, pseudogene (EBLN3P)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [29]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 NCM460 Normal Homo sapiens CVCL_0460
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
Hyaluronan synthase 2 (HAS2)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [30]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
In-vitro Model
 MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MDA-MB-157 Breast carcinoma Homo sapiens CVCL_0618
MCF-10A Normal Homo sapiens CVCL_0598
Kinesin-like protein KIF15 (KIF15)
 Target Gene 
Triple-negative breast cancer [ICD-11: 2C6Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [31]
Responsed Disease Triple-negative breast cancer [ICD-11: 2C6Z]
Target Regulation Up regulation
long intergenic non-protein coding RNA 1106 (LINC01106)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [32]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
long intergenic non-protein coding RNA 667 (LINC00667)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [33]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
long intergenic non-protein coding RNA 839 (LINC00839)
 Target Gene 
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [34]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
In-vitro Model
NP69SV40T
 N.A. Homo sapiens CVCL_F755
N2Tert (The human immortalized nasopharyngeal epithelial cell lines)
HONE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_8706
SUNE1 Nasopharyngeal carcinoma Homo sapiens CVCL_6946
C666 Nasopharyngeal carcinoma Homo sapiens CVCL_M597
HNE-1 Nasopharyngeal carcinoma Homo sapiens CVCL_0308
5-8F Nasopharyngeal carcinoma Homo sapiens CVCL_C528
6-10B Nasopharyngeal carcinoma Homo sapiens CVCL_C529
S18 Nasopharyngeal carcinoma Homo sapiens CVCL_B0U9
S26 Nasopharyngeal carcinoma Homo sapiens CVCL_B0UB
CNE-1 Normal Homo sapiens CVCL_6888
CNE-2 Nasopharyngeal carcinoma Homo sapiens CVCL_6889
HK-1 Lung large cell carcinoma Homo sapiens CVCL_7047
In-vivo Model For xenograft growth model, 1 × 106 SUNE-1 cells stably expressing scrambled or sh-LINC00839 were inoculated subcutaneously into the axillas of nude mice. The tumor volumes were measured every 3 days. After 21 days, the mice were sacrificed. Simultaneously, the subcutaneous tumors were excised and weighed. For the lung metastatic colonization model, 1 × 106 SUNE-1 cells stably expressing scrambled or sh-LINC00839 were injected into the tail veins of nude mice. After 5 weeks, the mice were sacrificed, with their lung tissues dissected. All subcutaneous tumors and lung tissues were paraffin embedded and sectioned for subsequent analyses.
Microfibril-associated glycoprotein 4 (MFAP4)
 Target Gene 
Photoaging [ICD-11: EJ20]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [35]
Responsed Disease Photoaging [ICD-11: EJ20]
Target Regulation Up regulation
In-vivo Model A total of 30, six-week-old male C57/BL6 mice were purchased from Orient Bio Inc. (Beijing, China), and they were fed according to standard procedures. After one week of adaptive feeding, the mice were randomly divided into two groups, namely, the control group (n = 7) and the UVR group (n = 7). All mice were shaved once a week. The UVR mice were irradiated with a mixed source of UVA (315 nm ~ 400nm, 0.60 mW/cm2) and UVB (290nm ~ 315nm, 3.5 mW/cm2) ray every other day for 12 weeks. The initial irradiation time was 15 min for the first week base on the minimal erythema dose (MED), followed by a graduated increase until it reached 80 min. The total irradiated dose was approximately 151 J/cm2 for UVA and 23 J/cm2for UVB, respectively.
Phosphoglycerate kinase 1 (PGK1)
 Target Gene 
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [36]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Target Regulation Up regulation
In-vitro Model
 HOK Normal Hexagrammos otakii CVCL_YE19
SCC-9 Tongue squamous cell carcinoma Homo sapiens CVCL_1685
CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
POU6F2 antisense RNA 1 (POU6F2-AS1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [37]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 HCT 116 Colon carcinoma Homo sapiens CVCL_0291
NCM460 Normal Homo sapiens CVCL_0460
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
Ras-related protein Rab-27B (RAB27B)
 Target Gene 
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [38]
Responsed Disease Chronic myeloid leukaemia [ICD-11: 2B33.2]
Responsed Drug Rucaparib Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KCL-22 Chronic myelogenous leukemia Homo sapiens CVCL_2091
In-vivo Model K562 cells (1 × 106) were suspended in 100 μL of normal saline and the suspension was mixed with an equal volume of Matrigel. This mixture was subcutaneously injected into the right armpit of 4-week-old mice. Tumor size measurements were initiated on the day of inoculation. The tumor size was calculated using the formula: 0.5 × (long diameter) × (short diameter).2 When the tumor volume reached 100 mm3 (± 20%), rucaparib was given via intragastric administration at 50 mg/kg/d.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [38]
Responsed Disease Chronic myeloid leukaemia [ICD-11: 2B33.2]
Responsed Drug Imatinib Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KCL-22 Chronic myelogenous leukemia Homo sapiens CVCL_2091
In-vivo Model K562 cells (1 × 106) were suspended in 100 μL of normal saline and the suspension was mixed with an equal volume of Matrigel. This mixture was subcutaneously injected into the right armpit of 4-week-old mice. Tumor size measurements were initiated on the day of inoculation. The tumor size was calculated using the formula: 0.5 × (long diameter) × (short diameter).2 When the tumor volume reached 100 mm3 (± 20%), rucaparib was given via intragastric administration at 50 mg/kg/d.
Rho-associated protein kinase 2 (ROCK2)
 Target Gene 
Atherosclerosis [ICD-11: BD40]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [39]
Responsed Disease Atherosclerosis [ICD-11: BD40.Z]
Target Regulation Up regulation
Serine protease hepsin (HPN)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [40]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
In-vitro Model
 Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
HLF Adult hepatocellular carcinoma Homo sapiens CVCL_2947
SNU-423 Adult hepatocellular carcinoma Homo sapiens CVCL_0366
Li-7 Adult hepatocellular carcinoma Homo sapiens CVCL_3840
L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
Serine/threonine-protein kinase 10 (STK10)
 Target Gene 
Injuries of spine or trunk [ICD-11: ND51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [41]
Responsed Disease Spinal cord injury [ICD-11: ND51.2]
Target Regulation Down regulation
In-vitro Model
 PC12 Rat adrenal gland pheochromocytoma Rattus norvegicus CVCL_0481
Transcription factor E2F7 (E2F7)
 Target Gene 
Nasopharyngeal carcinoma [ICD-11: 2B6B]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [42]
Responsed Disease Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation Up regulation
In-vivo Model For the tumor growth model, 1 × 106 SUNE-1 cells stably expressing scrambled or sh-VIRMA were injected subcutaneously into the axilla of mice, and the tumor size was measured every 4 days. After 32 days, the mice were sacrificed, and the tumors were retrieved. For the tumor inguinal lymph node metastasis model, 1 × 106 scrambled or sh-VIRMA SUNE-1 cells were injected into the footpads of mice. After 6 weeks, the mice were euthanized. The footpad tumors and inguinal lymph nodes were excised. Tumors and lymph nodes were subjected to subsequent in situ hybridization and immunohistochemistry analysis.
Transcription factor SOX-8 (SOX8)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [43]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 FHC Normal Homo sapiens CVCL_3688
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
RKO Colon carcinoma Homo sapiens CVCL_0504
In-vivo Model SW620 cells were seeded in 6-well plates and infected with USP29-knockdown lentivirus (sh-USP29) or the negative control (sh-NC), respectively, and cells were treated with 4 μg/mL of puromycin (Invitrogen) for two weeks to screen stable knockout cells. Afterward, each mouse was subcutaneously injected via the axilla with stable infected SW620 cells (N = 5 × 106 cells).
Unspecific Target Gene
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [44]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Responsed Drug Gemcitabine Approved
 Drug Info 
Pathway Response Adipocytokine signaling pathway hsa04920
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
HDE-CT cell line (A normal human pancreatic cell line)
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response Summary Lasso regression identified a six-m6A-regulator-signature prognostic model (KIAA1429, HNRNPC, METTL3, YTHDF1, IGF2BP2, and IGF2BP3). Gene set enrichment analysis revealed m6A regulators (KIAA1429, HNRNPC, and IGF2BP2) were related to multiple biological behaviors in pancreatic cancer, including adipocytokine signaling, the well vs. poorly differentiated tumor pathway, tumor metastasis pathway, epithelial mesenchymal transition pathway, gemcitabine resistance pathway, and stemness pathway.
Liver cancer [ICD-11: 2C12]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [45]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Sorafenib Approved
 Drug Info 
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Sora Canine transitional cell carcinoma Canis lupus familiaris CVCL_WH26
EA.hy 926 Normal Homo sapiens CVCL_3901
In-vivo Model Six-week-old BALB/c-nu mice (n = 10) were purchased from Hunan STA Laboratory Animal Co., Ltd. Nude mice were adaptively fed in a specific pathogen free (SPF) environment for 7 days. The study protocol was ethically approved by the Kunming Yan'an Hospital Experimental Animal Ethics Committee (Kunming, China; approval no. 2020004). Mice were randomly divided into a control group (HepG2) and an experimental group (HepG2/Sora) with 5 mice in each group. A cell suspension (4 × 106 cells per mouse) was injected into the right lateral thighs of mice after light anesthesia using 37.5 mg/kg pelltobarbitalum natricum (cat.no. P-010; Sigma-Aldrich LLC.). The drug treatment was carried out when the tumor size was approximately 100 mm3. Sorafenib was prepared with 0.4% DMSO+PBS solution and administered to mice by intraperitoneal injection at a dose of 100 mg/kg after light anesthesia using 37.5 mg/kg pelltobarbitalum natricum. Sorafenib was administered once a day for 5 consecutive days. The physical state of the nude mice was observed and recorded every day. Mice in poor condition were terminated in time and euthanized immediately. All the mice were sacrificed using intraperitoneal injection of 200 mg/kg pelltobarbitalum natricum 5 days after sorafenib administration. Before euthanasia, the mice were given oral administration of ibuprofen (40 mg/kg; cat.no.14883; Sigma-Aldrich LLC.) with water to relieve pain. The tumors were removed surgically and photographed using a camera.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [46]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Teniposide Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Nucleotide excision repair hsa03420
mTOR signaling pathway hsa04150
Cell Process DNA repair
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model To establish a tumour model, C57BL/6 mice were intraperitoneal injected with 25 mg/kg diethylnitrosamine at 2 weeks of age.
Response Summary The m6A model includes LRPPRC, YTHDF2, KIAA14219, and RBM15B, classified A-hepatocellular carcinoma patients into high/low-risk subtypes. The expression of Immunosuppressive cytokines DNMT1/EZH2 was up-regulated in A-hepatocellular carcinoma patients, and teniposide can be a potential therapeutic drug for A-hepatocellular carcinoma.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [47]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Responsed Drug Gefitinib Approved
 Drug Info 
In-vitro Model
 NCI-H1573 Lung adenocarcinoma Homo sapiens CVCL_1478
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Testicular cancer [ICD-11: 2C80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [48]
Responsed Disease Testicular cancer [ICD-11: 2C80]
Target Regulation Up regulation
Cell Process Transcription
Response Summary Abundance of m6A and expression of VIRMA/YTHDF3 were different among Testicular Germ Cell Tumors subtypes, with higher levels in SEs, suggesting a contribution to SE phenotype maintenance.
Cyclin-dependent kinase 1 (CDK1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by VIRMA
Cell Line Human umbilical vein endothelial cells Homo sapiens
Treatment: siVIRMA HUVECs
Control: siControl HUVECs
 GSE167067
Regulation
logFC: -7.84E-01
p-value: 3.08E-02
More Results Click to View More RNA-seq Results
Fluorouracil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [1]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process Cell proliferation and metastasis
Response Summary KIAA1429 acts as an oncogenic factor in breast cancer by regulating CDK1 in an N6-methyladenosine-independent manner.5'-fluorouracil was found to be very effective in reducing the expression of KIAA1429 and Cyclin-dependent kinase 1 (CDK1) in breast cancer.
Histone H2AX (H2AX)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by VIRMA
Cell Line Human umbilical vein endothelial cells Homo sapiens
Treatment: siVIRMA HUVECs
Control: siControl HUVECs
 GSE167067
Regulation
logFC: -1.09E+00
p-value: 1.68E-02
More Results Click to View More RNA-seq Results
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [3]
Responsed Disease Germ cell tumour of testis ICD-11: 2C80.2
 Disease Info 
Target Regulation Down regulation
In-vitro Model 2102EP Embryonal carcinoma Homo sapiens CVCL_C522
NCC-IT Testicular embryonal carcinoma Homo sapiens CVCL_1451
NT2 Malignant neoplasms Mus musculus CVCL_JA57
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary VIRMA has an oncogenic role in germ cell tumor confirming our previous tissue-based study and is further involved in response to cisplatin by interfering with DNA repair. Enhanced response to cisplatin after VIRMA knockdown was related to significant increase in DNA damage (with higher Histone H2AX (H2AX) and GADD45B levels) and downregulation of XLF and MRE11.
Cystine/glutamate transporter (SLC7A11)
 Target Gene 
Cycloleucine [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [8]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
In-vitro Model Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
SK-HEP-1 Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
Ferrostatin-1 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [8]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
In-vitro Model Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
SK-HEP-1 Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
Liproxstatin-1 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [8]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
In-vitro Model Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
SK-HEP-1 Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
Double-strand break repair protein MRE11 (MRE11)
 Target Gene 
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [3]
Responsed Disease Germ cell tumour of testis ICD-11: 2C80.2
 Disease Info 
Target Regulation Up regulation
In-vitro Model 2102EP Embryonal carcinoma Homo sapiens CVCL_C522
NCC-IT Testicular embryonal carcinoma Homo sapiens CVCL_1451
NT2 Malignant neoplasms Mus musculus CVCL_JA57
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary VIRMA has an oncogenic role in germ cell tumor confirming our previous tissue-based study and is further involved in response to cisplatin by interfering with DNA repair. Enhanced response to cisplatin after VIRMA knockdown was related to significant increase in DNA damage (with higher Gamma-H2AX and GADD45B levels) and downregulation of XLF and Double-strand break repair protein MRE11 (MRE11).
Forkhead box protein M1 (FOXM1)
 Target Gene 
Oxaliplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [12]
Responsed Disease Gastric cancer ICD-11: 2B72
 Disease Info 
Target Regulation Up regulation
In-vitro Model GES-1 Normal Homo sapiens CVCL_EQ22
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
Homeobox protein Hox-A1 (HOXA1)
 Target Gene 
Gefitinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [15]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
In-vitro Model Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
NHBE (Normal bronchial epithelial cells)
In-vivo Model PC9-GR cells stably infected with KIAA1429-targeting shRNA and control were suspended in 100 uL of PBS with Matrigel matrix (BD Biosciences). Then, cells were injected into one of the flanks of BALB/c nude mice.
Response Summary m6A methyltransferase KIAA1429 was highly expressed in gefitinib-resistant NSCLC cells (PC9-GR), tissues, and closely related to unfavorable survival. KIAA1429 plays essential oncogenic roles in NSCLC gefitinib resistance, which provided a feasible therapeutic target for NSCLC.
Negative growth regulatory protein MyD118 (GADD45B)
 Target Gene 
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [3]
Responsed Disease Germ cell tumour of testis ICD-11: 2C80.2
 Disease Info 
Target Regulation Down regulation
In-vitro Model 2102EP Embryonal carcinoma Homo sapiens CVCL_C522
NCC-IT Testicular embryonal carcinoma Homo sapiens CVCL_1451
NT2 Malignant neoplasms Mus musculus CVCL_JA57
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary VIRMA has an oncogenic role in germ cell tumor confirming our previous tissue-based study and is further involved in response to cisplatin by interfering with DNA repair. Enhanced response to cisplatin after VIRMA knockdown was related to significant increase in DNA damage (with higher Gamma-H2AX and Negative growth regulatory protein MyD118 (GADD45B) levels) and downregulation of XLF and MRE11.
Non-homologous end-joining factor 1 (NHEJ1/XLF)
 Target Gene 
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [3]
Responsed Disease Germ cell tumour of testis ICD-11: 2C80.2
 Disease Info 
Target Regulation Up regulation
In-vitro Model 2102EP Embryonal carcinoma Homo sapiens CVCL_C522
NCC-IT Testicular embryonal carcinoma Homo sapiens CVCL_1451
NT2 Malignant neoplasms Mus musculus CVCL_JA57
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary VIRMA has an oncogenic role in germ cell tumor confirming our previous tissue-based study and is further involved in response to cisplatin by interfering with DNA repair. Enhanced response to cisplatin after VIRMA knockdown was related to significant increase in DNA damage (with higher Gamma-H2AX and GADD45B levels) and downregulation of Non-homologous end-joining factor 1 (NHEJ1/XLF) and MRE11.
Ras-related protein Rab-27B (RAB27B)
 Target Gene 
Rucaparib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [38]
Responsed Disease Chronic myeloid leukaemia ICD-11: 2B33.2
 Disease Info 
Target Regulation Up regulation
In-vitro Model K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KCL-22 Chronic myelogenous leukemia Homo sapiens CVCL_2091
In-vivo Model K562 cells (1 × 106) were suspended in 100 μL of normal saline and the suspension was mixed with an equal volume of Matrigel. This mixture was subcutaneously injected into the right armpit of 4-week-old mice. Tumor size measurements were initiated on the day of inoculation. The tumor size was calculated using the formula: 0.5 × (long diameter) × (short diameter).2 When the tumor volume reached 100 mm3 (± 20%), rucaparib was given via intragastric administration at 50 mg/kg/d.
Imatinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [38]
Responsed Disease Chronic myeloid leukaemia ICD-11: 2B33.2
 Disease Info 
Target Regulation Up regulation
In-vitro Model K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KCL-22 Chronic myelogenous leukemia Homo sapiens CVCL_2091
In-vivo Model K562 cells (1 × 106) were suspended in 100 μL of normal saline and the suspension was mixed with an equal volume of Matrigel. This mixture was subcutaneously injected into the right armpit of 4-week-old mice. Tumor size measurements were initiated on the day of inoculation. The tumor size was calculated using the formula: 0.5 × (long diameter) × (short diameter).2 When the tumor volume reached 100 mm3 (± 20%), rucaparib was given via intragastric administration at 50 mg/kg/d.
Unspecific Target Gene
Gemcitabine [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [44]
Responsed Disease Pancreatic cancer ICD-11: 2C10
 Disease Info 
Pathway Response Adipocytokine signaling pathway hsa04920
Cell Process Epithelial-mesenchymal transition
In-vitro Model BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
HDE-CT cell line (A normal human pancreatic cell line)
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response Summary Lasso regression identified a six-m6A-regulator-signature prognostic model (KIAA1429, HNRNPC, METTL3, YTHDF1, IGF2BP2, and IGF2BP3). Gene set enrichment analysis revealed m6A regulators (KIAA1429, HNRNPC, and IGF2BP2) were related to multiple biological behaviors in pancreatic cancer, including adipocytokine signaling, the well vs. poorly differentiated tumor pathway, tumor metastasis pathway, epithelial mesenchymal transition pathway, gemcitabine resistance pathway, and stemness pathway.
Sorafenib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [45]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
In-vitro Model Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Sora Canine transitional cell carcinoma Canis lupus familiaris CVCL_WH26
EA.hy 926 Normal Homo sapiens CVCL_3901
In-vivo Model Six-week-old BALB/c-nu mice (n = 10) were purchased from Hunan STA Laboratory Animal Co., Ltd. Nude mice were adaptively fed in a specific pathogen free (SPF) environment for 7 days. The study protocol was ethically approved by the Kunming Yan'an Hospital Experimental Animal Ethics Committee (Kunming, China; approval no. 2020004). Mice were randomly divided into a control group (HepG2) and an experimental group (HepG2/Sora) with 5 mice in each group. A cell suspension (4 × 106 cells per mouse) was injected into the right lateral thighs of mice after light anesthesia using 37.5 mg/kg pelltobarbitalum natricum (cat.no. P-010; Sigma-Aldrich LLC.). The drug treatment was carried out when the tumor size was approximately 100 mm3. Sorafenib was prepared with 0.4% DMSO+PBS solution and administered to mice by intraperitoneal injection at a dose of 100 mg/kg after light anesthesia using 37.5 mg/kg pelltobarbitalum natricum. Sorafenib was administered once a day for 5 consecutive days. The physical state of the nude mice was observed and recorded every day. Mice in poor condition were terminated in time and euthanized immediately. All the mice were sacrificed using intraperitoneal injection of 200 mg/kg pelltobarbitalum natricum 5 days after sorafenib administration. Before euthanasia, the mice were given oral administration of ibuprofen (40 mg/kg; cat.no.14883; Sigma-Aldrich LLC.) with water to relieve pain. The tumors were removed surgically and photographed using a camera.
Teniposide [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [46]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
Target Regulation Up regulation
Pathway Response Nucleotide excision repair hsa03420
mTOR signaling pathway hsa04150
Cell Process DNA repair
In-vitro Model Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model To establish a tumour model, C57BL/6 mice were intraperitoneal injected with 25 mg/kg diethylnitrosamine at 2 weeks of age.
Response Summary The m6A model includes LRPPRC, YTHDF2, KIAA14219, and RBM15B, classified A-hepatocellular carcinoma patients into high/low-risk subtypes. The expression of Immunosuppressive cytokines DNMT1/EZH2 was up-regulated in A-hepatocellular carcinoma patients, and teniposide can be a potential therapeutic drug for A-hepatocellular carcinoma.
Gefitinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [47]
Responsed Disease Lung adenocarcinoma ICD-11: 2C25.0
 Disease Info 
In-vitro Model NCI-H1573 Lung adenocarcinoma Homo sapiens CVCL_1478
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Click to View Potential Drug Response of This Regulator
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
RNA modification
m6A Target: DNA-binding protein inhibitor ID-2 (ID2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00532
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 19a (MIR19A)
Crosstalk relationship A-to-I → m6A
m6A Target: pri-miR-143
 Target Gene 
In total 5 item(s) under this m6A target
Crosstalk ID: M6ACROT00567
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Signal transducer and activator of transcription 3 (STAT3)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00570
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target Signal transducer and activator of transcription 3 (STAT3)
Crosstalk relationship m6A → m6Am
Crosstalk ID: M6ACROT00573
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00576
 Crosstalk Info 
Epigenetic Regulator H/ACA ribonucleoprotein complex subunit DKC1 (DKC1)
Regulated Target Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A)
Crosstalk relationship m6A → Pseudouridine
Crosstalk ID: M6ACROT00579
 Crosstalk Info 
Epigenetic Regulator RNA cytosine C(5)-methyltransferase NSUN2 (NSUN2)
Regulated Target H19 imprinted maternally expressed transcript (H19)
Crosstalk relationship m5C → m6A
Non-coding RNA
m6A Target: Trans-acting T-cell-specific transcription factor GATA-3 (GATA3)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05057
 Crosstalk Info 
Epigenetic Regulator GATA3 antisense RNA 1 (GATA3-AS1)
Regulated Target Protein virilizer homolog (VIRMA)
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
 Disease Info 
m6A Target: long intergenic non-protein coding RNA 667 (LINC00667)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05093
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 667 (LINC00667)
Regulated Target hsa-miR-556-5p
Crosstalk relationship ncRNA → m6A
Disease Breast cancer
 Disease Info 
Crosstalk ID: M6ACROT05094
 Crosstalk Info 
Epigenetic Regulator hsa-miR-556-5p
Regulated Target Protein virilizer homolog (VIRMA)
Crosstalk relationship ncRNA → m6A
Disease Breast cancer
 Disease Info 
m6A Target: endogenous Bornavirus like nucleoprotein 3, pseudogene (EBLN3P)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05100
 Crosstalk Info 
Epigenetic Regulator hsa-miR-153-3p
Regulated Target Protein virilizer homolog (VIRMA)
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
 Disease Info 
Crosstalk ID: M6ACROT05101
 Crosstalk Info 
Epigenetic Regulator Endogenous Bornavirus like nucleoprotein 3, pseudogene (EBLN3P)
Regulated Target hsa-miR-153-3p
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
 Disease Info 
m6A Target: CCN family member 2 (CTGF)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05187
 Crosstalk Info 
Epigenetic Regulator AI662270
Regulated Target Protein virilizer homolog (VIRMA)
Crosstalk relationship ncRNA → m6A
Disease Chronic kidney disease
 Disease Info 
m6A Target: Colon cancer associated transcript 1 (CCAT1)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05427
 Crosstalk Info 
Epigenetic Regulator Colon cancer associated transcript 1 (CCAT1)
Regulated Target Myc proto-oncogene protein (MYC)
Crosstalk relationship m6A → ncRNA
Disease Prostate cancer
 Disease Info 
Drug Actinomycin D
 Drug Info 
Crosstalk ID: M6ACROT05964
 Crosstalk Info 
Epigenetic Regulator Colon cancer associated transcript 1 (CCAT1)
Regulated Target MicroRNA let-7a-1 (Let-7A)
Crosstalk relationship m6A → ncRNA
Disease Prostate cancer
 Disease Info 
Drug Actinomycin D
 Drug Info 
Crosstalk ID: M6ACROT05965
 Crosstalk Info 
Epigenetic Regulator MicroRNA let-7a-1 (Let-7A)
Regulated Target Myc proto-oncogene protein (MYC)
Crosstalk relationship m6A → ncRNA
Disease Prostate cancer
 Disease Info 
Drug Actinomycin D
 Drug Info 
m6A Target: Colon cancer associated transcript 2 (CCAT2)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05428
 Crosstalk Info 
Epigenetic Regulator Colon cancer associated transcript 2 (CCAT2)
Regulated Target Myc proto-oncogene protein (MYC)
Crosstalk relationship m6A → ncRNA
Disease Prostate cancer
 Disease Info 
Drug Actinomycin D
 Drug Info 
Crosstalk ID: M6ACROT05966
 Crosstalk Info 
Epigenetic Regulator Colon cancer associated transcript 2 (CCAT2)
Regulated Target MicroRNA 145 (MIR145)
Crosstalk relationship m6A → ncRNA
Disease Prostate cancer
 Disease Info 
Drug Actinomycin D
 Drug Info 
Crosstalk ID: M6ACROT05967
 Crosstalk Info 
Epigenetic Regulator MicroRNA 145 (MIR145)
Regulated Target Myc proto-oncogene protein (MYC)
Crosstalk relationship m6A → ncRNA
Disease Prostate cancer
 Disease Info 
Drug Actinomycin D
 Drug Info 
m6A Target: hsa-miR-143-3p
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05512
 Crosstalk Info 
Epigenetic Regulator pri-miR-143
Regulated Target DEAD-box helicase 6 (DDX6)
Crosstalk relationship m6A → ncRNA
Disease Aortic aneurysm or dissection
 Disease Info 
m6A Target: Circ_DLC1
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05575
 Crosstalk Info 
Epigenetic Regulator Circ_DLC1
Regulated Target ELAV-like protein 1 (HuR/ELAVL1)
Crosstalk relationship m6A → ncRNA
Disease Liver cancer
 Disease Info 
m6A Target: Long intergenic non-protein coding RNA 958 (LINC00958)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05614
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 958 (LINC00958)
Regulated Target Solute carrier family 2 member 1 (SLC2A1)
Crosstalk relationship m6A → ncRNA
Disease Gastric cancer
 Disease Info 
m6A Target: POU6F2 antisense RNA 1 (POU6F2-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05670
 Crosstalk Info 
Epigenetic Regulator POU6F2 antisense RNA 1 (POU6F2-AS1)
Crosstalk relationship m6A → ncRNA
Disease Colorectal cancer
 Disease Info 
m6A Target: Nuclear paraspeckle assembly transcript 1 (NEAT1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05679
 Crosstalk Info 
Epigenetic Regulator Nuclear paraspeckle assembly transcript 1 (NEAT1)
Crosstalk relationship m6A → ncRNA
Disease Breast cancer
 Disease Info 
m6A Target: Long intergenic non-protein coding RNA 839 (LINC00839)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05740
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 839 (LINC00839)
Regulated Target TATA-box binding protein associated factor 15 (TAF15)
Crosstalk relationship m6A → ncRNA
Disease Nasopharyngeal carcinoma
 Disease Info 
m6A Target: Long intergenic non-protein coding RNA 1106 (LINC01106)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05826
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 1106 (LINC01106)
Crosstalk relationship m6A → ncRNA
Disease Lung cancer
 Disease Info 
Xenobiotics Compound(s) Regulating the m6A Methylation Regulator
Compound Name 5-FU Approved
Synonyms
5-Fluorouracil; 51-21-8; fluorouracil; 5-FU; Fluoroplex; Adrucil; Efudex; Carac; Fluracil; Fluoroblastin; 5-fluoropyrimidine-2,4(1H,3H)-dione; Kecimeton; Timazin; Carzonal; Efudix; Arumel; Fluril; Queroplex; Fluracilum; Ulup; 5-Fluoracil; Phthoruracil; Fluro Uracil; 5-Fluoro-2,4(1H,3H)-pyrimidinedione; Ftoruracil; Fluorouracilum; Efurix; Fluri; 5 Fluorouracil; Effluderm (free base); 5-fluoro-1H-pyrimidine-2,4-dione; Fluorouracilo; Fluroblastin; Phtoruracil; 2,4-Dihydroxy-5-fluoropyrimidine; 2,4(1H,3H)-Pyrimidinedione, 5-fluoro-; Adrucil; Effluderm; Fluorouracile; Fluoruracil; Fluracedyl; Flurodex; Neofluor; Onkofluor; Ribofluor; Tetratogen; URF; Allergan Brand of Fluorouracil; Biosyn Brand of Fluorouracil; CSP Brand of Fluorouracil; Cinco FU; Dakota Brand of Fluorouracil; Dermatech Brand of Fluorouracil; Dermik Brandof Fluorouracil; Ferrer Brand of Fluorouracil; Fluoro Uracile ICN; Fluorouracil GRY; Fluorouracil Mononitrate; Fluorouracil Monopotassium Salt; Fluorouracil Monosodium Salt; Fluorouracil Potassium Salt; Fluorouracil Teva Brand; Fluorouracile Dakota; Fluorouracile [DCIT]; Fluorouracilo Ferrer Far; Gry Brand of Fluorouracil; Haemato Brand of Fluorouracil; Haemato fu; Hexal Brand of Fluorouracil; ICN Brand of Fluorouracil; Inhibits thymilidate synthetase; Medac Brand of Fluorouracil; Neocorp Brand of Fluorouracil; Onkoworks Brand of Fluorouracil; Ribosepharm Brand of Fluorouracil; Riemser Brand of Fluorouracil; Roche Brand of Fluorouracil; Teva Brand of Fluorouracil; F 6627; F0151; IN1335; U 8953; Adrucil (TN); Carac (TN); Dakota, Fluorouracile; Efudex (TN); Fluoro-Uracile ICN; Fluoro-uracile; Fluoro-uracilo; Fluoroplex (TN); Fluorouracil-GRY; Fluorouracilo [INN-Spanish]; Fluorouracilum [INN-Latin]; Haemato-fu; Ro 2-9757; U-8953; Ro-2-9757; Fluorouracil (JP15/USP/INN); Fluorouracil [USAN:INN:BAN:JAN]; 1-fluoro-1h-pyrimidine-2,4-dione; 2,4-Dioxo-5-fluoropryimidine; 2,4-Dioxo-5-fluoropyrimidine; 5 FU Lederle; 5 FU medac; 5 Fluorouracil biosyn; 5 HU Hexal; 5-FU (TN); 5-FU Lederle; 5-FU medac; 5-Faracil; 5-Fluor-2,4(1H,3H)-pyrimidindion; 5-Fluor-2,4(1H,3H)-pyrimidindion [Czech]; 5-Fluor-2,4-dihydroxypyrimidin; 5-Fluor-2,4-dihydroxypyrimidin [Czech]; 5-Fluor-2,4-pyrimidindiol; 5-Fluor-2,4-pyrimidindiol [Czech]; 5-Fluoracil [German]; 5-Fluoracyl; 5-Fluoro-2,4-pyrimidinedione; 5-Fluoropyrimidin-2,4-diol; 5-Fluoropyrimidine-2,4-dione; 5-Fluorouracil-biosyn; 5-Fluoruracil; 5-Fluoruracil [German]; 5-Ftouracyl; 5-HU Hexal; 5-fluoro uracil; 5FU
    Click to Show/Hide
External link
CID: 3385
TTD: D05LEO
DrugBank: DB00544
Description
KIAA1429 acts as an oncogenic factor inbreast cancer by regulating CDK1 in an N6-methyladenosine-independent manner.5'-fluorouracil was found to be very effective in reducing the expression of KIAA1429 andCDK1 in breast cancer.
 [1]
Compound Name . Investigative
References
Ref 1 KIAA1429 acts as an oncogenic factor in breast cancer by regulating CDK1 in an N6-methyladenosine-independent manner. Oncogene. 2019 Aug;38(33):6123-6141. doi: 10.1038/s41388-019-0861-z. Epub 2019 Jul 8.
Ref 2 VIRMA contributes to non-small cell lung cancer progression via N(6)-methyladenosine-dependent DAPK3 post-transcriptional modification. Cancer Lett. 2021 Dec 1;522:142-154. doi: 10.1016/j.canlet.2021.08.027. Epub 2021 Sep 11.
Ref 3 The component of the m(6)A writer complex VIRMA is implicated in aggressive tumor phenotype, DNA damage response and cisplatin resistance in germ cell tumors. J Exp Clin Cancer Res. 2021 Aug 25;40(1):268. doi: 10.1186/s13046-021-02072-9.
Ref 4 SMC1A regulated by KIAA1429 in m6A-independent manner promotes EMT progress in breast cancer. Mol Ther Nucleic Acids. 2021 Aug 19;27:133-146. doi: 10.1016/j.omtn.2021.08.009. eCollection 2022 Mar 8.
Ref 5 KIAA1429 regulates cell proliferation by targeting c-Jun messenger RNA directly in gastric cancer. J Cell Physiol. 2020 Oct;235(10):7420-7432. doi: 10.1002/jcp.29645. Epub 2020 Feb 13.
Ref 6 Metabolite Profiling and Reaction Phenotyping for the in Vitro Assessment of the Bioactivation of Bromfenac ?. Chem Res Toxicol. 2020 Jan 21;33(1):249-257. doi: 10.1021/acs.chemrestox.9b00268. Epub 2019 Dec 23.
Ref 7 Identification of pathology-specific regulators of m(6)A RNA modification to optimize lung cancer management in the context of predictive, preventive, and personalized medicine. EPMA J. 2020 Jul 29;11(3):485-504. doi: 10.1007/s13167-020-00220-3. eCollection 2020 Sep.
Ref 8 Pharmacokinetics, pharmacodynamics and safety of single, oral doses of GSK1278863, a novel HIF-prolyl hydroxylase inhibitor, in healthy Japanese and Caucasian subjects. Drug Metab Pharmacokinet. 2015 Dec;30(6):410-8. doi: 10.1016/j.dmpk.2015.08.004. Epub 2015 Aug 28.
Ref 9 KIAA1429 regulates the migration and invasion of hepatocellular carcinoma by altering m6A modification of ID2 mRNA. Onco Targets Ther. 2019 May 7;12:3421-3428. doi: 10.2147/OTT.S180954. eCollection 2019.
Ref 10 Expression and clinical prognostic value of m6A RNA methylation modification in breast cancer. Biomark Res. 2021 Apr 29;9(1):28. doi: 10.1186/s40364-021-00285-w.
Ref 11 A polarized localization of amino acid/carnitine transporter B(0,+) (ATB(0,+)) in the blood-brain barrier. Biochem Biophys Res Commun. 2008 Nov 14;376(2):267-70. doi: 10.1016/j.bbrc.2008.08.122. Epub 2008 Sep 2.
Ref 12 Peroxisome proliferator-activated receptors, metabolic syndrome and cardiovascular disease. Future Cardiol. 2010 September; 6(5): 657-691.
Ref 13 Modulation of the ATPase and transport activities of broad-acting multidrug resistance factor ABCC10 (MRP7). Cancer Res. 2012 Dec 15;72(24):6457-67. doi: 10.1158/0008-5472.CAN-12-1340. Epub 2012 Oct 19.
Ref 14 N(6)-methyladenosine methyltransferase KIAA1429 elevates colorectal cancer aerobic glycolysis via HK2-dependent manner. Bioengineered. 2022 May;13(5):11923-11932. doi: 10.1080/21655979.2022.2065952.
Ref 15 N(6)-methyladenosine (m(6)A) methyltransferase KIAA1429 accelerates the gefitinib resistance of non-small-cell lung cancer. Cell Death Discov. 2021 May 17;7(1):108. doi: 10.1038/s41420-021-00488-y.
Ref 16 KIAA1429 promotes the progression of lung adenocarcinoma by regulating the m6A level of MUC3A. Pathol Res Pract. 2021 Jan;217:153284. doi: 10.1016/j.prp.2020.153284. Epub 2020 Nov 12.
Ref 17 m(6)A methyltransferase KIAA1429 acts as an oncogenic factor in colorectal cancer by regulating SIRT1 in an m(6)A-dependent manner. Cell Death Discov. 2022 Feb 25;8(1):83. doi: 10.1038/s41420-022-00878-w.
Ref 18 Gene amplification-driven RNA methyltransferase KIAA1429 promotes tumorigenesis by regulating BTG2 via m6A-YTHDF2-dependent in lung adenocarcinoma. Cancer Commun (Lond). 2022 Jul;42(7):609-626. doi: 10.1002/cac2.12325. Epub 2022 Jun 21.
Ref 19 KIAA1429 contributes to liver cancer progression through N6-methyladenosine-dependent post-transcriptional modification of GATA3. Mol Cancer. 2019 Dec 19;18(1):186. doi: 10.1186/s12943-019-1106-z.
Ref 20 Methylenetetrahydrofolate reductase gene polymorphisms: genomic predictors of clinical response to fluoropyrimidine-based chemotherapy?. Cancer Chemother Pharmacol. 2006 Jun;57(6):835-40. doi: 10.1007/s00280-005-0089-1. Epub 2005 Sep 27.
Ref 21 KIAA1429 is a potential prognostic marker in colorectal cancer by promoting the proliferation via downregulating WEE1 expression in an m6A-independent manner. Oncogene. 2022 Jan;41(5):692-703. doi: 10.1038/s41388-021-02066-z. Epub 2021 Nov 24.
Ref 22 VIRMA-Dependent N6-Methyladenosine Modifications Regulate the Expression of Long Non-Coding RNAs CCAT1 and CCAT2 in Prostate Cancer. Cancers (Basel). 2020 Mar 25;12(4):771. doi: 10.3390/cancers12040771.
Ref 23 m(6) A transferase KIAA1429-stabilized LINC00958 accelerates gastric cancer aerobic glycolysis through targeting GLUT1. IUBMB Life. 2021 Nov;73(11):1325-1333. doi: 10.1002/iub.2545. Epub 2021 Aug 26.
Ref 24 Highly potent first examples of dual aromatase-steroid sulfatase inhibitors based on a biphenyl template. J Med Chem. 2010 Mar 11;53(5):2155-70. doi: 10.1021/jm901705h.
Ref 25 KIAA1429 and ALKBH5 Oppositely Influence Aortic Dissection Progression via Regulating the Maturation of Pri-miR-143-3p in an m6A-Dependent Manner. Front Cell Dev Biol. 2021 Aug 19;9:668377. doi: 10.3389/fcell.2021.668377. eCollection 2021.
Ref 26 FDA label of Lorlatinib. The 2020 official website of the U.S. Food and Drug Administration.
Ref 27 Clinical pipeline report, company report or official report of GlycoMimetics.
Ref 28 Circular RNA circDLC1 inhibits MMP1-mediated liver cancer progression via interaction with HuR. Theranostics. 2021 Jan 1;11(3):1396-1411. doi: 10.7150/thno.53227. eCollection 2021.
Ref 29 National Cancer Institute Drug Dictionary (drug id 596693).
Ref 30 Genetically based impairment in CYP2C8- and CYP2C9-dependent NSAID metabolism as a risk factor for gastrointestinal bleeding: is a combination of pharmacogenomics and metabolomics required to improve personalized medicine?. Expert Opin Drug Metab Toxicol. 2009 Jun;5(6):607-20. doi: 10.1517/17425250902970998.
Ref 31 Enhanced cyclophosphamide and ifosfamide activation in primary human hepatocyte cultures: response to cytochrome P-450 inducers and autoinduction by oxazaphosphorines. Cancer Res. 1997 May 15;57(10):1946-54.
Ref 32 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1811).
Ref 33 AMG 595, an Anti-EGFRvIII Antibody-Drug Conjugate, Induces Potent Antitumor Activity against EGFRvIII-Expressing Glioblastoma. Mol Cancer Ther. 2015 Jul;14(7):1614-24. doi: 10.1158/1535-7163.MCT-14-1078. Epub 2015 Apr 30.
Ref 34 Clinical pipeline report, company report or official report of AbbVie.
Ref 35 Effect of ABCG2 on cytotoxicity of platinum drugs: interference of EGFP. Toxicol In Vitro. 2008 Dec;22(8):1846-52.
Ref 36 Fibrates as therapy for osteoarthritis and rheumatoid arthritis A systematic review. Ther Adv Musculoskelet Dis. 2013 February; 5(1): 33-44.
Ref 37 PEGylated interferon beta-1a in the treatment of multiple sclerosis - an update. Biologics. 2013; 7: 131-138.
Ref 38 Selective COX-2 Inhibitors: A Review of Their Structure-Activity Relationships. Iran J Pharm Res. 2011 Autumn; 10(4): 655-683.
Ref 39 Case study: biosimilar anti TNFalpha (Adalimumab) analysis of Fc effector functions. BMC Proc. 2013; 7(Suppl 6): P30.
Ref 40 Acyltransferase inhibitors: a patent review (2010-present). Expert Opin Ther Pat. 2015 Feb;25(2):145-58. doi: 10.1517/13543776.2014.989833. Epub 2014 Dec 3.
Ref 41 Selective high affinity retinoic acid receptor alpha or beta-gamma ligands. Mol Pharmacol. 1991 Oct;40(4):556-62.
Ref 42 US patent application no. 6,271,030, Antisense inhibition of C/EBP beta expression.
Ref 43 Peroxidative free radical formation and O-demethylation of etoposide(VP-16) and teniposide(VM-26). Biochem Biophys Res Commun. 1986 Feb 26;135(1):215-20. doi: 10.1016/0006-291x(86)90965-4.
Ref 44 Gene Signature and Identification of Clinical Trait-Related m(6) A Regulators in Pancreatic Cancer. Front Genet. 2020 Jul 10;11:522. doi: 10.3389/fgene.2020.00522. eCollection 2020.
Ref 45 Efficacy of the fully human monoclonal antibody MOR102 (#5) against intercellular adhesion molecule 1 in the psoriasis-severe combined immunodeficient mouse model. Br J Dermatol. 2005 Oct;153(4):758-66. doi: 10.1111/j.1365-2133.2005.06657.x.
Ref 46 Identification and Characterization of Alcohol-related Hepatocellular Carcinoma Prognostic Subtypes based on an Integrative N6-methyladenosine methylation Model. Int J Biol Sci. 2021 Aug 14;17(13):3554-3572. doi: 10.7150/ijbs.62168. eCollection 2021.
Ref 47 Use of inhibitory monoclonal antibodies to assess the contribution of cytochromes P450 to human drug metabolism. Eur J Pharmacol. 2000 Apr 14;394(2-3):199-209. doi: 10.1016/s0014-2999(00)00079-0.
Ref 48 m(6)A RNA modification and its writer/reader VIRMA/YTHDF3 in testicular germ cell tumors: a role in seminoma phenotype maintenance. J Transl Med. 2019 Mar 12;17(1):79. doi: 10.1186/s12967-019-1837-z.