m6A Regulator Information

General Information of the m6A Regulator (ID: REG00020)
Regulator Name RNA-binding motif protein 15 (RBM15)
Synonyms
One-twenty two protein 1; RNA-binding protein 15; OTT; OTT1
    Click to Show/Hide
Gene Name RBM15
Sequence
MRTAGRDPVPRRSPRWRRAVPLCETSAGRRVTQLRGDDLRRPATMKGKERSPVKAKRSRG
GEDSTSRGERSKKLGGSGGSNGSSSGKTDSGGGSRRSLHLDKSSSRGGSREYDTGGGSSS
SRLHSYSSPSTKNSSGGGESRSSSRGGGGESRSSGAASSAPGGGDGAEYKTLKISELGSQ
LSDEAVEDGLFHEFKRFGDVSVKISHLSGSGSGDERVAFVNFRRPEDARAAKHARGRLVL
YDRPLKIEAVYVSRRRSRSPLDKDTYPPSASVVGASVGGHRHPPGGGGGQRSLSPGGAAL
GYRDYRLQQLALGRLPPPPPPPLPRDLERERDYPFYERVRPAYSLEPRVGAGAGAAPFRE
VDEISPEDDQRANRTLFLGNLDITVTESDLRRAFDRFGVITEVDIKRPSRGQTSTYGFLK
FENLDMSHRAKLAMSGKIIIRNPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGT
IRTIDYRKGDSWAYIQYESLDAAHAAWTHMRGFPLGGPDRRLRVDFADTEHRYQQQYLQP
LPLTHYELVTDAFGHRAPDPLRGARDRTPPLLYRDRDRDLYPDSDWVPPPPPVRERSTRT
AATSVPAYEPLDSLDRRRDGWSLDRDRGDRDLPSSRDQPRKRRLPEESGGRHLDRSPESD
RPRKRHCAPSPDRSPELSSSRDRYNSDNDRSSRLLLERPSPIRDRRGSLEKSQGDKRDRK
NSASAERDRKHRTTAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQKQDGGTAPVASA
SPKLCLAWQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGGKVAQLKITQRLRLDQP
KLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSAASDTATSTQRPLRNLVSYLKQKQA
AGVISLPVGGNKDKENTGVLHAFPPCEFSQQFLDSPAKALAKSEEDYLVMIIVRGFGFQI
GVRYENKKRENLALTLL
    Click to Show/Hide
Family RRM Spen family
Function
RNA-binding protein that acts as a key regulator of N6-methyladenosine (m6A) methylation of RNAs, thereby regulating different processes, such as hematopoietic cell homeostasis, alternative splicing of mRNAs and X chromosome inactivation mediated by Xist RNA. Associated component of the WMM complex, a complex that mediates N6-methyladenosine (m6A) methylation of RNAs, a modification that plays a role in the efficiency of mRNA splicing and RNA processing (By similarity). Plays a key role in m6A methylation, possibly by binding target RNAs and recruiting the WMM complex. Involved in random X inactivation mediated by Xist RNA: acts by binding Xist RNA and recruiting the WMM complex, which mediates m6A methylation, leading to target YTHDC1 reader on Xist RNA and promoting transcription repression activity of Xist. Required for the development of multiple tissues, such as the maintenance of the homeostasis of long-term hematopoietic stem cells and for megakaryocyte (MK) and B-cell differentiation (By similarity). Regulates megakaryocyte differentiation by regulating alternative splicing of genes important for megakaryocyte differentiation; probably regulates alternative splicing via m6A regulation. Required for placental vascular branching morphogenesis and embryonic development of the heart and spleen (By similarity). Acts as a regulator of thrombopoietin response in hematopoietic stem cells by regulating alternative splicing of MPL (By similarity). May also function as an mRNA export factor, stimulating export and expression of RTE-containing mRNAs which are present in many retrotransposons that require to be exported prior to splicing . High affinity binding of pre-mRNA to RBM15 may allow targeting of the mRNP to the export helicase DBP5 in a manner that is independent of splicing-mediated NXF1 deposition, resulting in export prior to splicing . May be implicated in HOX gene regulation.
    Click to Show/Hide
Gene ID 64783
Uniprot ID
RBM15_HUMAN
Regulator Type WRITER ERASER READER
Mechanism Diagram Click to View the Original Diagram
Target Genes Click to View Potential Target Genes of This Regulator
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
RBM15 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Browse Target Gene related Drug
Bax inhibitor 1 (TMBIM6)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by RBM15
Cell Line Human BJ Fibroblast Homo sapiens
Treatment: siRBM15 BJ fibroblast
Control: siControl BJ fibroblast
 GSE154148
Regulation
logFC: -3.57E+00
p-value: 2.49E-07
More Results Click to View More RNA-seq Results
Laryngeal cancer [ICD-11: 2C23]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Laryngeal cancer [ICD-11: 2C23]
Target Regulation Up regulation
Cell Process RNA stability
Cell apoptosis
In-vitro Model
 AMC-HN-8 Laryngeal squamous cell carcinoma Homo sapiens CVCL_5966
NHBEC (Normal human bronchial epithelial cell)
Tu 177 Laryngeal squamous cell carcinoma Homo sapiens CVCL_4913
Tu 212 Head and neck squamous cell carcinoma Homo sapiens CVCL_4915
In-vivo Model For tumor growth studies, whether in vivo RBM15 knockdown/overexpression experiments or in vivo rescue experiments, each group included six mice. Each mouse was injected with 100 uL of lentivirus-transfected tumor cells.
Response Summary RBM15-mediated m6A modification of Bax inhibitor 1 (TMBIM6) mRNA enhanced TMBIM6 stability through IGF2BP3-dependent. Laryngeal squamous cell cancer cells were transfected with shRBM15 lentivirus for 48h, and the qRT-PCR data indicated that the mRNA levels of CPNE5, TMBIM6, and ATAD3A decreased after RBM15 knockdown.
Myeloid differentiation primary response protein MyD88 (MYD88)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by RBM15
Cell Line Human BJ Fibroblast Homo sapiens
Treatment: siRBM15 BJ fibroblast
Control: siControl BJ fibroblast
 GSE154148
Regulation
logFC: -3.36E+00
p-value: 3.10E-04
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
Cell Process Cell proliferative
Cell invasive
In-vitro Model
 HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
Response Summary RBM15 silencing inhibited the CRC growth and metastasis in vitro and in vivo. RBM15 mediated m6A methylation modification of Myeloid differentiation primary response protein MyD88 (MYD88) mRNA in colorectal cancer cells.
Ubiquitin-like modifier-activating enzyme 6 (UBA6)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by RBM15
Cell Line Human BJ Fibroblast Homo sapiens
Treatment: siRBM15 BJ fibroblast
Control: siControl BJ fibroblast
 GSE154148
Regulation
logFC: 1.63E+00
p-value: 2.87E-03
More Results Click to View More RNA-seq Results
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Target Regulation Up regulation
In-vitro Model
 SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
OVCAR-3 Ovarian serous adenocarcinoma Homo sapiens CVCL_0465
Response Summary IGF2BP1 was identified as the m6A reader protein of UBA6-AS1-RBM15-mediated m6A modification of Ubiquitin-like modifier-activating enzyme 6 (UBA6) mRNA, which enhanced the stability of UBA6 mRNA. UBA6-AS1 suppressed the proliferation, migration and invasion of OC cells via UBA6.
UBA6 divergent transcript (UBA6-DT/UBA6-AS1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by RBM15
Cell Line Human BJ Fibroblast Homo sapiens
Treatment: siRBM15 BJ fibroblast
Control: siControl BJ fibroblast
 GSE154148
Regulation
logFC: -3.20E+00
p-value: 2.22E-06
More Results Click to View More RNA-seq Results
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Target Regulation Up regulation
In-vitro Model
 SK-OV-3 Ovarian serous cystadenocarcinoma Homo sapiens CVCL_0532
OVCAR-3 Ovarian serous adenocarcinoma Homo sapiens CVCL_0465
Response Summary IGF2BP1 was identified as the m6A reader protein of UBA6 divergent transcript (UBA6-DT/UBA6-AS1)-RBM15-mediated m6A modification of UBA6 mRNA, which enhanced the stability of UBA6 mRNA. UBA6-AS1 suppressed the proliferation, migration and invasion of OC cells via UBA6.
Alpha-enolase (ENO1)
 Target Gene 
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
In-vitro Model
 T24 Bladder carcinoma Homo sapiens CVCL_0554
5637 Bladder carcinoma Homo sapiens CVCL_0126
UM-UC-3 Bladder carcinoma Homo sapiens CVCL_1783
RT-4 Bladder carcinoma Homo sapiens CVCL_0036
J82 Bladder carcinoma Homo sapiens CVCL_0359
SV-HUC-1 Normal Homo sapiens CVCL_3798
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model For the subcutaneous implantation model, 5 × 106 cells (n = 6 per group) were subcutaneously injected into the flank regions of 4-5 weeks female BALB/c nude mice. Tumor volume was calculated as 0.5 × W2 × L (where W and L represent a tumor's width and length, respectively). After xenografts were generated, DMSOand SB431542 (10 mg/kg, #301836-41-9, SANTA CRUZ BIOTECHNOLOGY), or ENOblock (#1177827-73-4, 9 mg/kg, MCE) were administered daily. All animal experiments were approved by The Affiliated Hospital of Qingdao University Committee on Animal Care.
ATP-dependent translocase ABCB1 (ABCB1)
 Target Gene 
Ovarian cancer [ICD-11: 2C73]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [5]
Responsed Disease Ovarian cancer [ICD-11: 2C73]
Responsed Drug Paclitaxel Approved
 Drug Info 
Pathway Response TGF-beta signaling pathway hsa04350
In-vitro Model
IOSE-80
 N.A. Homo sapiens CVCL_5546
OVCAR-3 Ovarian serous adenocarcinoma Homo sapiens CVCL_0465
In-vivo Model A total of 5×106 NC-shRNA- or RBM15-shRNA-infected A2780-PTX cells in 100 μl medium were subcutaneously injected into the right flank of mice (n=5/group). Mice without any intervention were used as blank controls (n=5). Body weight, tumor initiation and tumor progression were monitored every other day for 29 days (day of tumor formation=day 1).
ATPase family AAA domain-containing protein 3A (ATAD3A)
 Target Gene 
Laryngeal cancer [ICD-11: 2C23]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Laryngeal cancer [ICD-11: 2C23]
Target Regulation Up regulation
Cell Process RNA stability
Cell apoptosis
In-vitro Model
 AMC-HN-8 Laryngeal squamous cell carcinoma Homo sapiens CVCL_5966
NHBEC (Normal human bronchial epithelial cell)
Tu 177 Laryngeal squamous cell carcinoma Homo sapiens CVCL_4913
Tu 212 Head and neck squamous cell carcinoma Homo sapiens CVCL_4915
In-vivo Model For tumor growth studies, whether in vivo RBM15 knockdown/overexpression experiments or in vivo rescue experiments, each group included six mice. Each mouse was injected with 100 uL of lentivirus-transfected tumor cells.
Response Summary RBM15-mediated m6A modification of TMBIM6 mRNA enhanced TMBIM6 stability through IGF2BP3-dependent. Laryngeal squamous cell cancer cells were transfected with shRBM15 lentivirus for 48h, and the qRT-PCR data indicated that the mRNA levels of CPNE5, TMBIM6, and ATPase family AAA domain-containing protein 3A (ATAD3A) decreased after RBM15 knockdown.
C-X-C motif chemokine 11 (CXCL11)
 Target Gene 
Renal cell carcinoma [ICD-11: 2C90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Renal cell carcinoma of kidney [ICD-11: 2C90.0]
Target Regulation Up regulation
Pathway Response mRNA surveillance pathway hsa03015
RNA degradation hsa03018
Cell Process RNA stability
In-vitro Model
 THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
HK-2 [Human kidney] Normal Homo sapiens CVCL_0302
Caki-2 Papillary renal cell carcinoma Homo sapiens CVCL_0235
Caki-1 Clear cell renal cell carcinoma Homo sapiens CVCL_0234
786-O Renal cell carcinoma Homo sapiens CVCL_1051
In-vivo Model A total of 5 × 106 786O cells were subcutaneously injected into the left flanks of the mice.
Response Summary RBM15 enhanced the stability of C-X-C motif chemokine 11 (CXCL11) mRNA in an m6A-dependent manner. These findings highlight the function of RBM15 in ccRCC and reveal a novel identified EP300/CBP-RBM15-CXCL11 signaling axis, which promotes ccRCC progression and provides new insight into ccRCC therapy.
Copine-5 (CPNE5)
 Target Gene 
Laryngeal cancer [ICD-11: 2C23]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Laryngeal cancer [ICD-11: 2C23]
Target Regulation Up regulation
Cell Process RNA stability
Cell apoptosis
In-vitro Model
 AMC-HN-8 Laryngeal squamous cell carcinoma Homo sapiens CVCL_5966
NHBEC (Normal human bronchial epithelial cell)
Tu 177 Laryngeal squamous cell carcinoma Homo sapiens CVCL_4913
Tu 212 Head and neck squamous cell carcinoma Homo sapiens CVCL_4915
In-vivo Model For tumor growth studies, whether in vivo RBM15 knockdown/overexpression experiments or in vivo rescue experiments, each group included six mice. Each mouse was injected with 100 uL of lentivirus-transfected tumor cells.
Response Summary RBM15-mediated m6A modification of TMBIM6 mRNA enhanced TMBIM6 stability through IGF2BP3-dependent. Laryngeal squamous cell cancer cells were transfected with shRBM15 lentivirus for 48h, and the qRT-PCR data indicated that the mRNA levels of Copine-5 (CPNE5), TMBIM6, and ATAD3A decreased after RBM15 knockdown.
Hexokinase-2 (HK2)
 Target Gene 
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Target Regulation Up regulation
Mammalian target of rapamycin complex 1 (mTORC1)
 Target Gene 
Liver disease [ICD-11: DB9Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Liver disease [ICD-11: DB9Z]
Responsed Drug Rapamycin Approved
 Drug Info 
Target Regulation Down regulation
Pathway Response mTOR signaling pathway hsa04150
Cell Process Cell proliferation and apoptosis
In-vivo Model Zebrafish (Danio rerio) AB strain-derived Tg(lfabp:Dendra2-NTR)cq1 was used as WT, and rbm15cq96 mutant was generated by ENU treatment.
Response Summary Mammalian target of rapamycin complex 1 (mTORC1) pathway is highly activated in rbm15-deficient hepatocytes. Rapamycin treatment partially restored normal hepatic gene expression as well as the nuclear location of the transcription factor Hnf4a. Taken together, these results reveal an unexpected role of Rbm15 in liver maturation.
Myc proto-oncogene protein (MYC)
 Target Gene 
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Up regulation
In-vitro Model
 C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
Ca Ski Cervical squamous cell carcinoma Homo sapiens CVCL_1100
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
In-vivo Model (1) Lenti-NC and Lenti-vector were injected into caudal vein in group A; (2) Lenti-NC and Lenti-RBM15 OE were injected into caudal vein in group B; (3) Lenti-E6 shRNA and Lenti-vector were injected into caudal vein in group C; (4) Lenti-E6 shRNA and Lenti-RBM15 OE were injected into caudal vein in group D. The dosage of each lentivirus tail vein injection is 108 TU/animal.
Yes tyrosine kinase (YES/YES1)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Pathway Response MAPK signaling pathway hsa04010
In-vitro Model
 HCC-LM3 (HCC-LM3 were obtained from Guangzhou Cellcook Biotech Co., Ltd.)
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
B76.1/Huh7 Adult hepatocellular carcinoma Homo sapiens CVCL_U443
In-vivo Model 5 × 106 Huh7 and HCC-LM3 cells resuspended in 100ul PBS were subcutaneously injected to the left flank of the mice (randomly selected, five mice per group for Huh7 cells in the first time and ten mice per group for HCC-LM3 cells in the second time. No blinding was performed).
Response Summary RBM15-mediated m6A modification contributed to a post-transcriptional activation of Yes tyrosine kinase (YES/YES1) in an IGF2BP1-dependent manner. RBM15-mediated m6A modification facilitate the progression of HCC via the IGF2BP1-YES1-MAPK axis.
Chromatin-associated RNAs (caRNAs)
 Target Gene 
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Myeloid leukaemia [ICD-11: 2B33.1]
Target Regulation Down regulation
Cell Process Cell survival
Cell proliferation
Cell differentiation
Cell invasion
Apoptosis
Claudin-4 (CLDN4)
 Target Gene 
Gestational diabetes mellitus [ICD-11: JA63]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Gestational diabetes mellitus [ICD-11: JA63]
In-vitro Model
 L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
In-vivo Model GDM group and control group. GDM group was fed with high-fat diet (Research Diets D12451) for 1 week to mating and throughout pregnancy, while control group was fed with normal diet (Research Diet 1022). Then the two groups were mated with age-matched male mice. The presence of a vaginal plug was considered gestational day (GD) 0.5. Oral glucose tolerance test (OGTT) and insulin tolerance test (ITT) were performed at GD0.5, GD11.5, and GD16.5. Six mice of each group were killed at GD18.5 to collect the liver tissue of the fetus. The remaining mice were left to delivery. All female offspring were selected for this study. Fetus weaning was done and then was separately fed with a standard diet for 12 weeks. OGTT and ITT were performed at 12 weeks. Then F1 generation was killed to collect serum and liver tissue.
Decorin (DCN)
 Target Gene 
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [13]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Up regulation
In-vitro Model
CC
 N.A. Homo sapiens CVCL_E520
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Ca Ski Cervical squamous cell carcinoma Homo sapiens CVCL_1100
E3 ubiquitin-protein ligase RNF5 (RNF5)
 Target Gene 
Non-alcoholic fatty liver disease [ICD-11: DB92]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [14]
Responsed Disease Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation Up regulation
Glucose-6-phosphate isomerase (GPI)
 Target Gene 
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Target Regulation Up regulation
Keratin, type I cytoskeletal 17 (KRT17)
 Target Gene 
Psoriasis [ICD-11: EA90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [15]
Responsed Disease Psoriasis [ICD-11: EA90]
Target Regulation Up regulation
Phosphoglycerate kinase 1 (PGK1)
 Target Gene 
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Target Regulation Up regulation
Semaphorin-3F (SEMA3F)
 Target Gene 
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [16]
Responsed Disease Prostate cancer [ICD-11: 2C82]
In-vitro Model
 RWPE-1 Normal Homo sapiens CVCL_3791
DU145 Prostate carcinoma Homo sapiens CVCL_0105
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
22Rv1 Prostate carcinoma Homo sapiens CVCL_1045
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
LNCaP C4-2B Prostate carcinoma Homo sapiens CVCL_4784
VCaP Prostate carcinoma Homo sapiens CVCL_2235
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model All the animal studies and protocols followed the institutional guidelines of the First Affiliated Hospital, School of Medicine, Zhejiang University.
Transcription factor E2F2 (E2F2)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [17]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
In-vitro Model
 SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
Tripartite motif-containing protein 72 (TRIM72)
 Target Gene 
Preeclampsia [ICD-11: JA23]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Preeclampsia [ICD-11: JA23]
Target Regulation Down regulation
Ubiquitin thioesterase OTUB2 (OTUB2)
 Target Gene 
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Up regulation
In-vitro Model
 Ect1/E6E7 Normal Homo sapiens CVCL_3679
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
MS751 Human papillomavirus-related cervical squamous cell carcinoma Homo sapiens CVCL_4996
C-33 A Cervical squamous cell carcinoma Homo sapiens CVCL_1094
ME-180 Human papillomavirus-related cervical squamous cell carcinoma Homo sapiens CVCL_1401
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
Unspecific Target Gene
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [20]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Response Summary The prediction model was established based on the expression of m6A RNA methylation regulators FTO (fat mass and obesity-associated) and RBM15 (RNA binding motif protein 15). The two-methylase combination model was an independent prognostic factor of GC.
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [21]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Pathway Response Cell cycle hsa04110
Cell Process Cell proliferation
In-vitro Model
 SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
Response Summary Pan-cancer analysis of RBM15 suggested it is served as a prognostic biomarker and immunotherapeutic target for PAAD.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [23]
Responsed Disease Lung cancer [ICD-11: 2C25]
Myasthenia gravis [ICD-11: 8C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [24]
Responsed Disease Myasthenia gravis [ICD-11: 8C60]
Pathway Response Wnt signaling pathway hsa04310
COVID-19 [ICD-11: RA01]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [25]
Responsed Disease COVID-19 [ICD-11: RA01]
Cell Process Programmed cell death
Inflammatory response
In-vitro Model
 THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
HuT 78 T lymphocytic leukemia Homo sapiens CVCL_0337
Response Summary Knockdown of RBM15 remarkably suppressed the expression levels of multitarget genes related to programmed cell death and inflammatory response. These findings indicate that RBM15 can serve as a target for the treatment of COVID-19.
ATP-dependent translocase ABCB1 (ABCB1)
 Target Gene 
Paclitaxel [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [5]
Responsed Disease Ovarian cancer ICD-11: 2C73
 Disease Info 
Pathway Response TGF-beta signaling pathway hsa04350
In-vitro Model
IOSE-80
 N.A. Homo sapiens CVCL_5546
OVCAR-3 Ovarian serous adenocarcinoma Homo sapiens CVCL_0465
In-vivo Model A total of 5×106 NC-shRNA- or RBM15-shRNA-infected A2780-PTX cells in 100 μl medium were subcutaneously injected into the right flank of mice (n=5/group). Mice without any intervention were used as blank controls (n=5). Body weight, tumor initiation and tumor progression were monitored every other day for 29 days (day of tumor formation=day 1).
Mammalian target of rapamycin complex 1 (mTORC1)
 Target Gene 
Rapamycin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [8]
Responsed Disease Liver disease ICD-11: DB9Z
 Disease Info 
Target Regulation Down regulation
Pathway Response mTOR signaling pathway hsa04150
Cell Process Cell proliferation and apoptosis
In-vivo Model Zebrafish (Danio rerio) AB strain-derived Tg(lfabp:Dendra2-NTR)cq1 was used as WT, and rbm15cq96 mutant was generated by ENU treatment.
Response Summary Mammalian target of rapamycin complex 1 (mTORC1) pathway is highly activated in rbm15-deficient hepatocytes. Rapamycin treatment partially restored normal hepatic gene expression as well as the nuclear location of the transcription factor Hnf4a. Taken together, these results reveal an unexpected role of Rbm15 in liver maturation.
Click to View Potential Drug Response of This Regulator
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
DNA modification
m6A Target: Semaphorin-3F (SEMA3F)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02015
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Semaphorin-3F (SEMA3F)
Crosstalk relationship m6A → DNA modification
Disease Prostate cancer
 Disease Info 
Drug Docetaxel
 Drug Info 
Histone modification
m6A Target: C-X-C motif chemokine 11 (CXCL11)
 Target Gene 
In total 4 item(s) under this m6A target
Crosstalk ID: M6ACROT03173
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Renal cell carcinoma of kidney
 Disease Info 
Drug SETDB1-TTD-IN-1
 Drug Info 
Crosstalk ID: M6ACROT03174
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 9 acetylation (H3K9Ac)
Crosstalk relationship Histone modification → m6A
Disease Renal cell carcinoma of kidney
 Disease Info 
Drug SETDB1-TTD-IN-1
 Drug Info 
Crosstalk ID: M6ACROT03175
 Crosstalk Info 
Epigenetic Regulator CREB-binding protein (CREBBP)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Renal cell carcinoma of kidney
 Disease Info 
Drug SETDB1-TTD-IN-1
 Drug Info 
Crosstalk ID: M6ACROT03176
 Crosstalk Info 
Epigenetic Regulator CREB-binding protein (CREBBP)
Regulated Target Histone H3 lysine 9 acetylation (H3K9Ac)
Crosstalk relationship Histone modification → m6A
Disease Renal cell carcinoma of kidney
 Disease Info 
Drug SETDB1-TTD-IN-1
 Drug Info 
m6A Target: Tripartite motif-containing protein 72 (TRIM72)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03216
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase 2A (KMT2A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship Histone modification → m6A
Disease Preeclampsia
 Disease Info 
Drug Actinomycin D
 Drug Info 
m6A Target: Chromatin-associated RNAs (caRNAs)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05954
 Crosstalk Info 
Epigenetic Regulator Polycomb Repressive Complex 2 (PRC2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship m6A → Histone modification
Disease Myeloid leukaemia
 Disease Info 
Non-coding RNA
m6A Target: Tumor necrosis factor receptor superfamily member 6 (FAS)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05203
 Crosstalk Info 
Epigenetic Regulator FTO intronic transcript 1 (FTO-IT1)
Regulated Target RNA binding motif protein 15 (RBM15)
Crosstalk relationship ncRNA → m6A
m6A Target: Tumor protein p53-inducible nuclear protein 1 (TP53INP1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05204
 Crosstalk Info 
Epigenetic Regulator FTO intronic transcript 1 (FTO-IT1)
Regulated Target RNA binding motif protein 15 (RBM15)
Crosstalk relationship ncRNA → m6A
m6A Target: Sestrin-2 (SESN2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05205
 Crosstalk Info 
Epigenetic Regulator FTO intronic transcript 1 (FTO-IT1)
Regulated Target RNA binding motif protein 15 (RBM15)
Crosstalk relationship ncRNA → m6A
m6A Target: Ubiquitin-like modifier-activating enzyme 6 (UBA6)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05339
 Crosstalk Info 
Epigenetic Regulator UBA6 divergent transcript (UBA6-DT/UBA6-AS1)
Regulated Target RNA binding motif protein 15 (RBM15)
Crosstalk relationship ncRNA → m6A
Disease Ovarian cancer
 Disease Info 
m6A Target: Hexokinase-2 (HK2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05347
 Crosstalk Info 
Epigenetic Regulator Circ_CTNNB1
Regulated Target RNA binding motif protein 15 (RBM15)
Crosstalk relationship ncRNA → m6A
Disease Osteosarcoma
 Disease Info 
m6A Target: Glucose-6-phosphate isomerase (GPI)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05348
 Crosstalk Info 
Epigenetic Regulator Circ_CTNNB1
Regulated Target RNA binding motif protein 15 (RBM15)
Crosstalk relationship ncRNA → m6A
Disease Osteosarcoma
 Disease Info 
m6A Target: Phosphoglycerate kinase 1 (PGK1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05349
 Crosstalk Info 
Epigenetic Regulator Circ_CTNNB1
Regulated Target RNA binding motif protein 15 (RBM15)
Crosstalk relationship ncRNA → m6A
Disease Osteosarcoma
 Disease Info 
m6A Target: X inactive specific transcript (XIST)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05458
 Crosstalk Info 
Epigenetic Regulator X inactive specific transcript (XIST)
Regulated Target Glypican-4 (GPC4)
Crosstalk relationship m6A → ncRNA
Crosstalk ID: M6ACROT06026
 Crosstalk Info 
Epigenetic Regulator X inactive specific transcript (XIST)
Regulated Target Transcriptional regulator ATRX (ATRX)
Crosstalk relationship m6A → ncRNA
m6A Target: UBA6 divergent transcript (UBA6-DT/UBA6-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05591
 Crosstalk Info 
Epigenetic Regulator UBA6 divergent transcript (UBA6-DT/UBA6-AS1)
Regulated Target Ubiquitin-like modifier-activating enzyme 6 (UBA6)
Crosstalk relationship m6A → ncRNA
Disease Ovarian cancer
 Disease Info 
Xenobiotics Compound(s) Regulating the m6A Methylation Regulator
Compound Name Rapamycin Approved
Synonyms
Rapamune; Rapamycin (Sirolimus); AY-22989; Rapammune; sirolimusum; WY-090217; RAPA; Antibiotic AY 22989; AY 22989; UNII-W36ZG6FT64; CCRIS 9024; CHEBI:9168; SILA 9268A; W36ZG6FT64; HSDB 7284; C51H79NO13; NSC 226080; DE-109; NCGC00021305-05; DSSTox_CID_3582; DSSTox_RID_77091; DSSTox_GSID_23582; Cypher; Supralimus; Wy 090217; Perceiva; RAP; RPM; Rapamycin from Streptomyces hygroscopicus; SIIA 9268A; LCP-Siro; MS-R001; Rapamune (TN); Rapamycin (TN); Sirolimus (RAPAMUNE); Rapamycin C-7, analog 4; Sirolimus (USAN/INN); Sirolimus [USAN:BAN:INN]; Sirolimus, Rapamune,Rapamycin; Heptadecahydro-9,27-dihydroxy-3-[(1R)-2-[(1S,3R,4R)-4-hydroxy; 23,27-Epoxy-3H-pyrido(2,1-c)(1,4)oxaazacyclohentriacontine; 23,27-Epoxy-3H-pyrido[2,1-c][1,4]oxaazacyclohentriacontine; 23,27-epoxy-3H-pyrido[2,1-c][1,4]oxaazacyclohentriacontine-1,5,11,28,29; 3H-pyrido(2,1-c)(1,4)oxaazacyclohentriacontine-1,5,11,28,29(4H,6H,31H)-pentone; Sirolimus (MTOR inhibitor)
    Click to Show/Hide
External link
CID: 5284616
TTD: D03LJR
DrugBank: DB00877
Description
mTOR complex 1 (mTORC1) pathway is highly activated in rbm15-deficient hepatocytes. Rapamycin treatment partially restored normal hepatic gene expression as well as the nuclear location of the transcription factor Hnf4a. Taken together, these results reveal an unexpected role of Rbm15 inliver maturation.
 [8]
Compound Name Tretinoin Investigative
Synonyms
Retinoic acid; tretinoin; 302-79-4; all-trans-Retinoic acid; Vitamin A acid; trans-Retinoic acid; ATRA; Airol; Retin-A; Vesanoid; Aberel; Eudyna; Renova; All-trans Retinoic Acid; all-trans-Vitamin A acid; Dermairol; Aknoten; Aknefug; Cordes vas; Epi-aberel; TRETINON; Tretin M; Atralin; all-trans-Vitamin A1 acid; all-trans-Tretinoin; Retionic acid; All Trans Retinoic Acid; Vitamin A1 acid, all-trans-; Retin-A Micro; Retin A; beta-Retinoic acid; all-(E)-Retinoic acid; Vitamin A acid, all-trans-; Retinoate; (2E,4E,6E,8E)-3,7-dimethyl-9-(2,6,6-trimethylcyclohex-1-en-1-yl)nona-2,4,6,8-tetraenoic acid; Retinoic acid, all-trans-; Alltrans-retinoic acid; Retacnyl; Vesnaroid; NSC-122758; Ro 1-5488; Tretinoin, all-trans-; all trans-Retinoic acid; Stieva-A; Tretinoine; Solage; all-trans-beta-Retinoic acid; Effederm; .beta.-Retinoic acid; Tretinoin/All-Trans Retinoic Acid; Aberela [Norway]; Avitoin [Norway]; Effederm [France]; UNII-5688UTC01R; A-Acido (Argentina); 3,7-Dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-2,4,6,8-nonatetraenoic acid; (all-E)-3,7-Dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-2,4,6,8-nonatetraenoic acid; MLS000028588; b-Retinoic acid; RETINOIC ACID, ALL TRANS; Tretinoine [INN-French]; Tretinoinum [INN-Latin]; AT-RA; Tretinoina [INN-Spanish]; Tretinoino [INN-Spanish]; CHEMBL38; (2E,4E,6E,8E)-3,7-Dimethyl-9-(2,6,6-trimethylcyclohex-1-enyl)nona-2,4,6,8-tetraenoic acid; 2,4,6,8-Nonatetraenoic acid, 3,7-dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-, (all-E)-; MFCD00001551; NSC122758; Atragen; Retinova; SMR000058245; (2E,4E,6E,8E)-3,7-dimethyl-9-(2,6,6-trimethylcyclohexen-1-yl)nona-2,4,6,8-tetraenoic acid; CHEBI:15367; 15-Apo-beta-caroten-15-oic acid; 5688UTC01R; Tretinoin (TN); beta-Ra; Acnavit [Denmark]; AGN 100335; REA; 9-cis-RA; Retin A (TN); NCGC00017280-10; Tretinoinum; Aberela; Acnavit; Avitoin; Betarretin; Tretinoina; Tretinoino; A-Vitaminsyre; all-trans-b-Retinoic acid; DSSTox_CID_1239; Cordes VAS [Germany]; A-Vitaminsyre [Denmark]; 3,7-Dimethyl-9-(2,6,6-trimethyl-1-cyclohexene-1-yl)-2,4,6,8-nonatetraenoic acid (ECL); DSSTox_RID_76031; DSSTox_GSID_21239; trans-Retinoate; beta-Retinoate; tretinoine (French) (EINECS); cis-Retinoic acid; Acide retinoique (French) (DSL); Refissa; Nexret; Vitamin a acid, trans-; Retisol-A; Acid A Vit (Belgium, Netherlands); 3,7-dimethyl-9-(2,6,6-trimethyl-1-cyclohexenyl)nona-2,4,6,8-tetraenoic acid; 3,7-dimethyl-9-(2,6,6-trimethylcyclohexen-1-yl)nona-2E,4E,6E,8E-tetraenoic acid; (11Z)-retinoic acid; (2E,4E,6E,8E)-3,7-Dimethyl-9-(2,6,6-trimethyl-cyclohex-1-en-1-yl)nona-2,4,6,8-tetraenoic acid; [3H]Retinoic acid; Renova (TN); CCRIS 3294; Avita (TN); HSDB 2169; SR-01000000239; EINECS 206-129-0; NSC 122758; BRN 2057223; Tretinoin (JAN/USP/INN); Kerlocal; Retinoic acid, cis-9,trans-13-; TNP00194; Oristar rna; BML2-E05; DTXSID7021239; 1cbr; [3H]tretinoin; [All-E]-3,7-dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-2,4,6,8-nonatetraenoic acid; Tretinoin [USAN:USP:INN:BAN]; CAS-302-79-4; Prestwick_424; all-(E)-Retinoate; Tretinoine (French); Retinoic acid, cis-; (5E)-Retinoic acid; [3H]Vitamin A acid; 1n4h; CPD000058245; Retinoic acid all trans; 6-s-trans-retinoic acid; Vitamin-A-sA currencyure; Opera_ID_1055; Prestwick2_000257; Prestwick3_000257; Spectrum5_001746; Spectrum5_001933; acide retinoique (French); Vesanoid (TN) (Roche); Tretinoin - Retinoic Acid; bmse000562; UPCMLD-DP097; R 2625; Renova (0.02% cream); SCHEMBL3145; (9Z,13Z)-Retinoic acid; 3,7-Dimethyl-9-(2,6,6-trimethylcyclohex-1-enyl)nona-2,4,6,8-all-trans-tetraenoic acid; Altreno (0.05% lotion); BIDD:PXR0081; Lopac0_001061; Avita (0.025% gel); BSPBio_000074; BSPBio_001500; MLS001076515; MLS002207234; MLS002222211; MLS002548861; MLS006010222; BIDD:GT0483; SPECTRUM1502016; 9-cis-retinoic acid (9cRA); [3H]RA; BPBio1_000082; cid_444795; GTPL2644; .beta.-all-trans-Retinoic acid; all-trans-retinoic acid (ATRA); SCHEMBL19091395; BDBM31883; HMS502N05; QCR-120; BCPP000036; BDBM323588; HMS1361K22; HMS1568D16; HMS1791K22; HMS1921D14; HMS1989K22; HMS2089D20; HMS2092N11; HMS2095D16; HMS2236N03; HMS3259E11; HMS3263E04; HMS3402K22; HMS3411B09; HMS3675B09; HMS3712D16; Pharmakon1600-01502016; Retinoic acid, all-trans- (8CI); 124510-04-9; 2,4,6,8-Nonatetraenoic acid, 3,7-dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-, (2E,4E,6Z,8E)-; 68070-35-9; ACT00012; BCP01405; US10188615, at-RA; Tox21_110812; Tox21_202330; Tox21_300305; Tox21_501061; All-trans Retinoic Acid (Tretinoin); CCG-39912; LMPR01090019; NSC759631; s1653; ZINC12358651; AKOS000280845; Tox21_110812_1; AC-6824; CS-1269; DB00755; GS-3578; LP01061; NC00481; NSC-759631; SDCCGSBI-0051031.P004; IDI1_000903; IDI1_033970; NCGC00017280-05; NCGC00017280-06; NCGC00017280-07; NCGC00017280-08; NCGC00017280-09; NCGC00017280-12; NCGC00017280-15; NCGC00017280-16; NCGC00017280-17; NCGC00017280-18; NCGC00017280-19; NCGC00017280-20; NCGC00017280-23; NCGC00017280-38; NCGC00021808-04; NCGC00021808-05; NCGC00021808-06; NCGC00021808-07; NCGC00021808-09; NCGC00021808-11; NCGC00021808-14; NCGC00021808-15; NCGC00254179-01; NCGC00259879-01; NCGC00261746-01; trans-Retinoic acid; ; ; Retinoid analogues; BP-20401; BR164493; HY-14649; Retinoic acid, >=98% (HPLC), powder; SBI-0051031.P003; EU-0101061; R0064; SW203749-4; 02T794; C00777; D00094; J10054; Q29417; AB00052318-15; AB00052318-16; AB00052318-17; AB00052318_18; AB00052318_19; A899883; L000833; Q-200610; SR-01000000239-3; SR-01000000239-4; SR-01000000239-6; SR-01000000239-7; BRD-K06926592-001-01-7; BRD-K71879491-001-15-0; BRD-K71879491-001-22-6; SR-01000000239-12; SR-01000000239-13; SR-01000000239-14; SR-01000000239-15; WLN: L6UTJ A1 B1U1Y1&U2U1Y1&U1VQ C1 C1; Tretinoin, European Pharmacopoeia (EP) Reference Standard; WLN: L6UTJ A1 B1U1Y1 & U2U1Y1 & U1VQ C1 C1; Tretinoin, United States Pharmacopeia (USP) Reference Standard; 3,6,6-trimethyl-1-cyclohexen-1-yl)-2,4,6,8-nonatetraenoic acid; Tretinoin, Pharmaceutical Secondary Standard; Certified Reference Material; (2E,4E)-3,7-Dimethyl-9-(2,6,6-trimethyl-1-cyclohexenyl)-2,4,6,8-nonatetraenoic acid; (4E,6E,8E)-9-(2,6,6-Trimethyl-1-cyclohexenyl)-3,7-dimethyl-2,4,6,8-nonatetraenoic acid; (all-E)-3,7-Dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-2,4,6,8-nonatetraenoate; 2,4,6,8-Nonatetranoic acid, 3,7-dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-; 2,6,8-Nonatetranoic acid, 3,7-dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-; 3,7-Dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-2,4,6,8-nonatetraenoate; 3,7-Dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-2E,4E,6E,8E,-nonatetraenoic acid; all-trans-3,7-Dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-2,4,6,8-nonatetraenoic Acid; 2,4, 6,8-Nonatetranoic acid, 3,7-dimethyl-9-(2,6, 6-trimethyl-1-cyclohexen-1-yl)-, (2E, 4E, 6E, 8E)-; 2,4,6,8-Nonatetraenoic acid, 3,7-dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)--, (all trans)-; 2,4,6,8-Nonatetranoic acid, 3,7-dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-, (all trans)-; 2,6,8-Nonatetraenoic acid, 3,7-dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-, (all-E)-; 3,7-Dimethyl-9-(2,6,6-trimethyl-1-cyclohexen-1-yl)-2,4,6,8-nonatetraenoic acid-, (all trans)-; 97950-17-9
    Click to Show/Hide
External link
CID: 444795
Description
To obtain and identify the differential proteome of apoptosis induced by realgar (tetra-arsenic tetra-sulfide, As(4)S(4)) in retinoid acid (RA) resistant human acute promyelocytic leukemia (APL) cell line NB4-R1 cells.up-regulated RBM15 after exposed for 48 h.
 [26]
References
Ref 1 RBM15 facilitates laryngeal squamous cell carcinoma progression by regulating TMBIM6 stability through IGF2BP3 dependent. J Exp Clin Cancer Res. 2021 Feb 26;40(1):80. doi: 10.1186/s13046-021-01871-4.
Ref 2 Knockdown RBM15 Inhibits Colorectal Cancer Cell Proliferation and Metastasis Via N6-Methyladenosine (m6A) Modification of MyD88 mRNA. Cancer Biother Radiopharm. 2021 Nov 25. doi: 10.1089/cbr.2021.0226. Online ahead of print.
Ref 3 Long noncoding RNA UBA6-AS1 inhibits the malignancy of ovarian cancer cells via suppressing the decay of UBA6 mRNA. Bioengineered. 2022 Jan;13(1):178-189. doi: 10.1080/21655979.2021.2011640.
Ref 4 The SLC2 (GLUT) family of membrane transporters. Mol Aspects Med. 2013 Apr-Jun;34(2-3):121-38. doi: 10.1016/j.mam.2012.07.001.
Ref 5 FDA Label of Enasidenib. The 2020 official website of the U.S. Food and Drug Administration.
Ref 6 Epigenetic activation of RBM15 promotes clear cell renal cell carcinoma growth, metastasis and macrophage infiltration by regulating the m6A modification of CXCL11. Free Radic Biol Med. 2022 May 1;184:135-147. doi: 10.1016/j.freeradbiomed.2022.03.031. Epub 2022 Apr 2.
Ref 7 Targeting bromodomains: epigenetic readers of lysine acetylation. Nat Rev Drug Discov. 2014 May;13(5):337-56. doi: 10.1038/nrd4286. Epub 2014 Apr 22.
Ref 8 Loss of the RNA-binding protein Rbm15 disrupts liver maturation in zebrafish. J Biol Chem. 2020 Aug 14;295(33):11466-11472. doi: 10.1074/jbc.RA120.014080. Epub 2020 Jun 9.
Ref 9 Oxidation of xenobiotics by recombinant human cytochrome P450 1B1. Drug Metab Dispos. 1997 May;25(5):617-22.
Ref 10 RBM15 promotes hepatocellular carcinoma progression by regulating N6-methyladenosine modification of YES1 mRNA in an IGF2BP1-dependent manner. Cell Death Discov. 2021 Oct 27;7(1):315. doi: 10.1038/s41420-021-00703-w.
Ref 11 RBFOX2 recognizes N6-methyladenosine to suppress transcription and block myeloid leukaemia differentiation. Nat Cell Biol. 2023 Sep;25(9):1359-1368. doi: 10.1038/s41556-023-01213-w.
Ref 12 LY294002-geldanamycin heterodimers as selective inhibitors of the PI3K and PI3K-related family. Bioorg Med Chem Lett. 2001 Apr 9;11(7):909-13. doi: 10.1016/s0960-894x(01)00099-3.
Ref 13 Cellular phototoxicity evoked through the inhibition of human ABC transporter ABCG2 by cyclin-dependent kinase inhibitors in vitro. Pharm Res. 2009 Feb;26(2):449-58. doi: 10.1007/s11095-008-9738-5. Epub 2008 Oct 9.
Ref 14 Steady-state pharmacokinetics of a new antipsychotic agent perospirone and its active metabolite, and its relationship with prolactin response. Ther Drug Monit. 2004 Aug;26(4):361-5. doi: 10.1097/00007691-200408000-00004.
Ref 15 The role of gonadotropins in ovulation induction. Am J Obstet Gynecol. 1995 Feb;172(2 Pt 2):759-65. doi: 10.1016/0002-9378(95)90150-7.
Ref 16 Triple negative breast cancer--current status and prospective targeted treatment based on HER1 (EGFR), TOP2A and C-MYC gene assessment. Biomed Pap Med Fac Univ Palacky Olomouc Czech Repub. 2009 Mar;153(1):13-7. doi: 10.5507/bp.2009.002.
Ref 17 Interactions of human P-glycoprotein with simvastatin, simvastatin acid, and atorvastatin. Pharm Res. 2004 Sep;21(9):1686-91.
Ref 18 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023753)
Ref 19 Transcriptional regulation of type 11 17Beta-hydroxysteroid dehydrogenase expression in prostate cancer cells. Mol Cell Endocrinol. 2011 Jun 6;339(1-2):45-53. doi: 10.1016/j.mce.2011.03.015. Epub 2011 Apr 28.
Ref 20 To Develop and Validate the Combination of RNA Methylation Regulators for the Prognosis of Patients with Gastric Cancer. Onco Targets Ther. 2020 Oct 23;13:10785-10795. doi: 10.2147/OTT.S276239. eCollection 2020.
Ref 21 N6-Methyladenosine Methylation Regulator RBM15 is a Potential Prognostic Biomarker and Promotes Cell Proliferation in Pancreatic Adenocarcinoma. Front Mol Biosci. 2022 Feb 9;9:842833. doi: 10.3389/fmolb.2022.842833. eCollection 2022.
Ref 22 Absence of both MDR1 (ABCB1) and breast cancer resistance protein (ABCG2) transporters significantly alters rivaroxaban disposition and central nervous system entry. Basic Clin Pharmacol Toxicol. 2013 Mar;112(3):164-70. doi: 10.1111/bcpt.12005. Epub 2012 Oct 11.
Ref 23 ClinicalTrials.gov (NCT04509596) DZD1516 in Combination With Trastuzumab and Capecitabine, or in Combination With T-DM1, in Patients With Metastatic HER2 Positive Breast Cancer. U.S. National Institutes of Health.
Ref 24 Comparative nonclinical assessments of the proposed biosimilar PF-05280014 and trastuzumab (Herceptin(?)). BioDrugs. 2014 Oct;28(5):451-9. doi: 10.1007/s40259-014-0103-4.
Ref 25 RBM15-mediated N6-methyladenosine modification affects COVID-19 severity by regulating the expression of multitarget genes. Cell Death Dis. 2021 Jul 23;12(8):732. doi: 10.1038/s41419-021-04012-z.
Ref 26 [Proteomic study of retinoid acid resistant NB4R1 cells apoptosis induced by realgar]. Zhonghua Xue Ye Xue Za Zhi. 2010 Nov;31(11):752-7.