m6A Regulator Information

General Information of the m6A Regulator (ID: REG00017)
Regulator Name Methyltransferase-like 16 (METTL16)
Synonyms
Methyltransferase 10 domain-containing protein; RNA N6-adenosine-methyltransferase METTL16; N6-adenosine-methyltransferase METTL16; U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase; METT10D
    Click to Show/Hide
Gene Name METTL16
Sequence
MALSKSMHARNRYKDKPPDFAYLASKYPDFKQHVQINLNGRVSLNFKDPEAVRALTCTLL
REDFGLSIDIPLERLIPTVPLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLL
GATLNGWYFLATEVDDMCFNYAKKNVEQNNLSDLIKVVKVPQKTLLMDALKEESEIIYDF
CMCNPPFFANQLEAKGVNSRNPRRPPPSSVNTGGITEIMAEGGELEFVKRIIHDSLQLKK
RLRWYSCMLGKKCSLAPLKEELRIQGVPKVTYTEFCQGRTMRWALAWSFYDDVTVPSPPS
KRRKLEKPRKPITFVVLASVMKELSLKASPLRSETAEGIVVVTTWIEKILTDLKVQHKRV
PCGKEEVSLFLTAIENSWIHLRRKKRERVRQLREVPRAPEDVIQALEEKKPTPKESGNSQ
ELARGPQERTPCGPALREGEAAAVEGPCPSQESLSQEENPEPTEDERSEEKGGVEVLESC
QGSSNGAQDQEASEQFGSPVAERGKRLPGVAGQYLFKCLINVKKEVDDALVEMHWVEGQN
RDLMNQLCTYIRNQIFRLVAVN
    Click to Show/Hide
Family methyltransferase superfamily; METTL16/RlmF family
Function
RNA N6-methyltransferase that methylates adenosine residues at the N(6) position of a subset of RNAs and is involved in S-adenosyl-L-methionine homeostasis by regulating expression of MAT2A transcripts . Able to N6-methylate a subset of mRNAs and U6 small nuclear RNAs (U6 snRNAs). In contrast to the METTL3-METTL14 heterodimer, only able to methylate a limited number of RNAs: requires both a 5'UACAGAGAA-3' nonamer sequence and a specific RNA structure. Plays a key role in S-adenosyl-L-methionine homeostasis by mediating N6-methylation of MAT2A mRNAs, altering splicing of MAT2A transcripts: in presence of S-adenosyl-L-methionine, binds the 3'-UTR region of MAT2A mRNA and specifically N6-methylates the first hairpin of MAT2A mRNA, preventing recognition of their 3'-splice site by U2AF1/U2AF35, thereby inhibiting splicing and protein production of S-adenosylmethionine synthase. In S-adenosyl-L-methionine-limiting conditions, binds the 3'-UTR region of MAT2A mRNA but stalls due to the lack of a methyl donor, preventing N6-methylation and promoting expression of MAT2A. In addition to mRNAs, also able to mediate N6-methylation of U6 small nuclear RNA (U6 snRNA): specifically N6-methylates adenine in position 43 of U6 snRNAs . Also able to bind various lncRNAs, such as 7SK snRNA (7SK RNA) or 7SL RNA. Specifically binds the 3'-end of the MALAT1 long non-coding RNA.
    Click to Show/Hide
Gene ID 79066
Uniprot ID
MET16_HUMAN
Regulator Type WRITER ERASER READER
Mechanism Diagram Click to View the Original Diagram
Target Genes Click to View Potential Target Genes of This Regulator
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
METTL16 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Browse Target Gene related Drug
Cellular tumor antigen p53 (TP53/p53)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Response Summary Deletion of METTL16 or ALKBH5 predicted poor OS and DFS of hepatocellular carcinoma (HCC) patients. And this study found significant associations between the genetic alterations and clinicopathological features as well as Cellular tumor antigen p53 (TP53/p53) alteration.
Cyclin-dependent kinase inhibitor 1 (CDKN1A)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
Target Regulation Up regulation
In-vitro Model
 AsPC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
In-vivo Model Six-week-old female BALB/c nude mice were obtained from Peking University Animal Center (Beijing, China). These mice were randomized into experimental (N = 8 per group) and control groups (N = 8 per group). PC cells were resuspended in PBS (approximately 2 × 106 cells/100 μL) and subcutaneously inoculated into the left armpit of each nude mouse. The tumor length and width of the mice were monitored weekly. All mice were sacrificed 5 weeks postinjection, and tumors were excised and weighed.
Extracellular sulfatase Sulf-2 (Sulf2)
 Target Gene 
Injury of blood vessels of thorax [ICD-11: NB30]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Injury of pulmonary blood vessels [ICD-11: NB30.4]
Target Regulation Down regulation
In-vitro Model
 Rattus norvegicus (Rat pulmonary microvascular endothelial cells (PMVECs) were isolated from lung tissues)
In-vivo Model The rats were randomly divided into a fresh air group and a COPD group and each group contained 10 rats. The COPD group was placed into a breathable cage and exposed to PM2.5 (1.46 mg/m3) from the motor vehicle exhaust for two 2-h exposure periods (from 9:00 a.m. to 11:00 a.m. and from 15:00 p.m. to 17:00 p.m.), 5 days per week, for 7 months. After each period of exposure, the animals were exposed to fresh air for 30 min to take a rest. Gasoline-powered motorcycle used as of source of the Particulate matter (PM) pollution was located next door to the rat exposure room, and the PM was directed towards the exposure room through a metal tube. Fresh air was sent to through an air pump. After exposed for 7 months, rats were performed lung function test using a Forced Pulmonary Maneuver System (Buxco Research Systems, Wilmington, NC, USA).
Response Summary METTL16 regulates Extracellular sulfatase Sulf-2 (Sulf2) expression via m6A modification and thereby contribute to PM2.5-induced pulmonary microvascular injury.
G1/S-specific cyclin-D1 (CCND1)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process G1/S blocking
In-vitro Model
 SNU-719 Gastric tubular adenocarcinoma Homo sapiens CVCL_5086
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
MKN28 Gastric tubular adenocarcinoma Homo sapiens CVCL_1416
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
GES-1 Normal Homo sapiens CVCL_EQ22
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
In-vivo Model Xenograft mouse model was used to verify the tumorigenic effect of METTL16 in vivo. BALB/c nude mice (4 weeks old) were injected with METTL16 gene knock-down stable MGC803 GC cells (3 × 106 cells/mice, subcutaneous injection) or shNC control cells (3 × 106, subcutaneous injection), and the dose was 100 uL, with PBS as solvent. The tumour size was measured every 3-5 days. At the end of feeding (6 weeks after subcutaneous injection), the mice were killed and the tumours were extracted for histological analysis.
Response Summary METTL16-mediated m6A methylation promotes proliferation of gastric cancer cells through enhancing G1/S-specific cyclin-D1 (CCND1) expression.
Programmed cell death 1 ligand 1 (CD274/PD-L1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [5]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
In-vitro Model
 NCM460 Normal Homo sapiens CVCL_0460
RKO Colon carcinoma Homo sapiens CVCL_0504
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
COLO 320 Colon adenocarcinoma Homo sapiens CVCL_1989
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCe-8693 Cecum adenocarcinoma Homo sapiens CVCL_6909
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
HT29 Colon cancer Mus musculus CVCL_A8EZ
FHC Normal Homo sapiens CVCL_3688
In-vivo Model Male BALB/c nude mice that aged 4 to 6-week-old were bought from Vital River Laboratory (China). SW480 cells transfected with control or METTL16 overexpression vectors (5 x 106 cells/site) were suspended in 50 μl saline and inoculated into the fact pat on back. Tumor size was measured and calculated every three days. After feeding for 30 days, the tumors were collected and made into paraffine-embedded samples.
Stearoyl-CoA desaturase (SCD)
 Target Gene 
Papillary Thyroid Cancer [ICD-11: XH1ND9]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Papillary Thyroid Cancer [ICD-11: XH1ND9]
Responsed Drug Simvastatin Approved
 Drug Info 
Target Regulation Down regulation
In-vitro Model
 B-CPAP Thyroid gland carcinoma Homo sapiens CVCL_0153
TPC-1 Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
K1 Thyroid gland papillary carcinoma Homo sapiens CVCL_2537
In-vivo Model These mice were provided with unrestricted access to both water and food, following a 12-h light and 12-h dark cycle. Subcutaneous injections of stably transfected K1 cells (2 × 106 cells per mouse) were administered in the armpits of the mice. Once the tumors became palpable, their volume was measured every three days and calculated using the formula: length × width2 × 0.5. The tumor weight was detected after the mice were sacrificed.
Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1)
 Target Gene 
Leukemogenesis [ICD-11: 2A82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Leukemogenesis [ICD-11: 2A82]
Target Regulation Up regulation
In-vitro Model
 THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
HL-60 Adult acute myeloid leukemia Homo sapiens CVCL_0002
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
HEL Erythroleukemia Homo sapiens CVCL_0001
ML-2 Adult acute myeloid leukemia Homo sapiens CVCL_1418
Kasumi-1 Myeloid leukemia with maturation Homo sapiens CVCL_0589
Branched-chain-amino-acid aminotransferase, mitochondrial (BCAT2)
 Target Gene 
Leukemogenesis [ICD-11: 2A82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Leukemogenesis [ICD-11: 2A82]
Target Regulation Up regulation
In-vitro Model
 THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
NB4 Acute promyelocytic leukemia Homo sapiens CVCL_0005
HL-60 Adult acute myeloid leukemia Homo sapiens CVCL_0002
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
HEL Erythroleukemia Homo sapiens CVCL_0001
ML-2 Adult acute myeloid leukemia Homo sapiens CVCL_1418
Kasumi-1 Myeloid leukemia with maturation Homo sapiens CVCL_0589
Eukaryotic translation initiation factor 4E type 2 (EIF4E2)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Lung cancer [ICD-11: 2C25]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H226 Pleural epithelioid mesothelioma Homo sapiens CVCL_1544
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
MEF Fibrosarcoma Homo sapiens CVCL_C1M8
HEK293 Normal Homo sapiens CVCL_0045
In-vivo Model For xenograft tumor growth assay, 5×106 NSCLC cells were subcutaneously injected into the left armpit of BALB/c nude mice (n=6 per group).
Histone-lysine N-methyltransferase SETD2 (SETD2)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Down regulation
In-vitro Model
 AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
MKN28 Gastric tubular adenocarcinoma Homo sapiens CVCL_1416
GES-1 Normal Homo sapiens CVCL_EQ22
Histone-lysine N-methyltransferase SUV39H1 (SUV39H1)
 Target Gene 
Ageing-related disease [ICD-11: 9B10-9B60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease Ageing-related disease [ICD-11: 9B10-9B60]
Target Regulation Up regulation
lnc-CSMD1-7
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
In-vitro Model
 SK-HEP-1 Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
SNU-449 Adult hepatocellular carcinoma Homo sapiens CVCL_0454
HEK293T Normal Homo sapiens CVCL_0063
SMMC-7721 Endocervical adenocarcinoma Homo sapiens CVCL_0534
Microtubule cross-linking factor 2 (SOGA1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
NUTM2B antisense RNA 1 (NUTM2B-AS1)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [14]
Responsed Disease Liver cancer [ICD-11: 2C12]
Target Regulation Up regulation
Phospholipid hydroperoxide glutathione peroxidase GPX4 (GPX4)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [15]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
In-vitro Model
 MCF-10A Normal Homo sapiens CVCL_0598
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MDA-MB-468 Breast adenocarcinoma Homo sapiens CVCL_0419
MDA-MB-453 Breast adenocarcinoma Homo sapiens CVCL_0418
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
In-vivo Model The width and length of tumors were recorded every 5 days and calculated as width [2] × length/2. After growth for 30 days, the mice were sacrificed and tumors were collected for further experiments.
PR domain zinc finger protein 15 (PRDM15)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [16]
Responsed Disease Intrahepatic cholangiocarcinoma [ICD-11: 2C12.10]
Target Regulation Up regulation
In-vitro Model
 CC-LP-1 Intrahepatic cholangiocarcinoma Homo sapiens CVCL_0205
HuCC-T1 Intrahepatic cholangiocarcinoma Homo sapiens CVCL_0324
In-vivo Model For subcutaneous inoculation, 1 × 106 control or METTL16-depleted CCA cells suspended in 100 μL PBS mixed with matrix gel (BD, 356,234) at 1:1 ratio was injected into the mice's flanks.For intrahepatic inoculation, 1 × 106 control or METTL16-depleted CCLP1 cells suspended in 10 μL PBS mixed with matrix gel (BD, 356,234) at a 1:1 ratio was implanted into the livers of NOD-SCID mice.
Protein MROH8 (MROH8)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [17]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
In-vitro Model
 AsPC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
Capan-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0237
Capan-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0026
CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
HEK293T Normal Homo sapiens CVCL_0063
HPDE6c7 Normal Homo sapiens CVCL_0P38
THLE-3 Normal Homo sapiens CVCL_3804
Segment polarity protein dishevelled homolog DVL-2 (DVL2)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Target Regulation Down regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model
 PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
AsPC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0152
HPDE6c7 Normal Homo sapiens CVCL_0P38
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
In-vivo Model The hepatic metastasis model was used to detect the function of METTL16 in vivo. BALB/c nude mice aged 4 weeks were divided into four groups randomly (n = 3). Subsequently, a longitudinal abdominal median incision was created after the mice were anesthetized. A total of 2.0 x 106 cells were injected into the spleen. Approximately 2.5 months later, liver tissues were harvested, imaged, and subjected to H&E staining.
transcript inducer of AURKA lysosomal degradation (TIALD)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Liver hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug MLN8237 Phase 3
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 SNU-449 Adult hepatocellular carcinoma Homo sapiens CVCL_0454
SK-HEP-1 Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
Hep-G2/C3A Hepatoblastoma Homo sapiens CVCL_1098
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
SMMC-7721 Endocervical adenocarcinoma Homo sapiens CVCL_0534
In-vivo Model In the therapeutic study, TIALD stable knockdown or control cells were further infected by lentiviruses (Ubi-MCS-firefly_Luciferase-SV40-neomycin, Genechem, China) and selected by G418 (500 μg/mL). 45 B-NDG mice were divided into 3 groups, including the control group (n = 15), TIALD knockdown group (n = 15) and Alisertib treatment group (n = 15). The modified control cells described above were injected into the mice of control group via tail vein, while the modified TIALD knockdown cells were injected into the mice of TIALD knockdown group and Alisertib treatment group.
Vacuolar protein sorting-associated protein 33B (VPS33B)
 Target Gene 
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [20]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Target Regulation Down regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
In-vitro Model
 HOS Osteosarcoma Homo sapiens CVCL_0312
MG-63 Osteosarcoma Homo sapiens CVCL_0426
SaOS-2 Osteosarcoma Homo sapiens CVCL_0548
143B Osteosarcoma Homo sapiens CVCL_2270
U2OS Osteosarcoma Homo sapiens CVCL_0042
HEK293T Normal Homo sapiens CVCL_0063
hFOB 1.19 Normal Homo sapiens CVCL_3708
OS-RC-2 Clear cell renal cell carcinoma Homo sapiens CVCL_1626
In-vivo Model Nude mice (6 weeks, female) were injected with shNC, shMETTL16, shMETTL16 + shNC, and shMETTL16 + shVPS33B HOS cells to induce subcutaneous tumor formation randomly (n = 6 per group).
Unspecific Target Gene
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [21]
Responsed Disease Glioma [ICD-11: 2A00.0]
In-vitro Model
 LN-229 Glioblastoma Homo sapiens CVCL_0393
A-172 Glioblastoma Homo sapiens CVCL_0131
Male fertility disorders [ICD-11: VV5Y]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [22]
Responsed Disease Male fertility disorders [ICD-11: VV5Y]
Stearoyl-CoA desaturase (SCD)
 Target Gene 
Simvastatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [6]
Responsed Disease Papillary Thyroid Cancer ICD-11: XH1ND9
 Disease Info 
Target Regulation Down regulation
In-vitro Model B-CPAP Thyroid gland carcinoma Homo sapiens CVCL_0153
TPC-1 Thyroid gland papillary carcinoma Homo sapiens CVCL_6298
K1 Thyroid gland papillary carcinoma Homo sapiens CVCL_2537
In-vivo Model These mice were provided with unrestricted access to both water and food, following a 12-h light and 12-h dark cycle. Subcutaneous injections of stably transfected K1 cells (2 × 106 cells per mouse) were administered in the armpits of the mice. Once the tumors became palpable, their volume was measured every three days and calculated using the formula: length × width2 × 0.5. The tumor weight was detected after the mice were sacrificed.
transcript inducer of AURKA lysosomal degradation (TIALD)
 Target Gene 
MLN8237 [Phase 3]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [19]
Responsed Disease Liver hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
Target Regulation Up regulation
In-vitro Model SNU-449 Adult hepatocellular carcinoma Homo sapiens CVCL_0454
SK-HEP-1 Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
Hep-G2/C3A Hepatoblastoma Homo sapiens CVCL_1098
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
SMMC-7721 Endocervical adenocarcinoma Homo sapiens CVCL_0534
In-vivo Model In the therapeutic study, TIALD stable knockdown or control cells were further infected by lentiviruses (Ubi-MCS-firefly_Luciferase-SV40-neomycin, Genechem, China) and selected by G418 (500 μg/mL). 45 B-NDG mice were divided into 3 groups, including the control group (n = 15), TIALD knockdown group (n = 15) and Alisertib treatment group (n = 15). The modified control cells described above were injected into the mice of control group via tail vein, while the modified TIALD knockdown cells were injected into the mice of TIALD knockdown group and Alisertib treatment group.
Click to View Potential Drug Response of This Regulator
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
RNA modification
m6A Target: Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00523
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 142 (MIR142)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00527
 Crosstalk Info 
Epigenetic Regulator Fat mass and obesity-associated protein (FTO)
Regulated Target MicroRNA 576 (MIR576)
Crosstalk relationship m6Am → m6A
m6A Target: Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00534
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 26a-1 (MIR26A1)
Crosstalk relationship m6A → A-to-I
DNA modification
m6A Target: Stearoyl-CoA desaturase (SCD)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02050
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 1 (DNMT1)
Regulated Target Methyltransferase 16, RNA N6-adenosine (METTL16)
Crosstalk relationship DNA modification → m6A
Disease Papillary Thyroid Cancer
 Disease Info 
Drug Simvastatin
 Drug Info 
Histone modification
m6A Target: Histone-lysine N-methyltransferase SETD2 (SETD2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03046
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase SETD2 (SETD2)
Regulated Target Histone H3 lysine 36 trimethylation (H3K36me3)
Crosstalk relationship m6A → Histone modification
Disease Gastric cancer
 Disease Info 
m6A Target: PR domain zinc finger protein 15 (PRDM15)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03069
 Crosstalk Info 
Epigenetic Regulator Histone acetyltransferase p300 (P300)
Regulated Target Histone H3 lysine 27 acetylation (H3K27ac)
Crosstalk relationship Histone modification → m6A
Disease Intrahepatic cholangiocarcinoma
 Disease Info 
m6A Target: Histone-lysine N-methyltransferase SUV39H1 (SUV39H1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT03180
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase SUV39H1 (SUV39H1)
Regulated Target Histone H3 lysine 9 trimethylation (H3K9me3)
Crosstalk relationship m6A → Histone modification
Disease Ageing-related disease
 Disease Info 
Crosstalk ID: M6ACROT06002
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase SUV39H1 (SUV39H1)
Regulated Target Histone H3 lysine 9 trimethylation (H3K9me3)
Crosstalk relationship m6A → Histone modification
Disease Ageing-related disease
 Disease Info 
m6A Target: NUTM2B antisense RNA 1 (NUTM2B-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT03252
 Crosstalk Info 
Epigenetic Regulator Histone-lysine N-methyltransferase 2A (KMT2A)
Regulated Target Histone H3 lysine 4 trimethylation (H3K4me3)
Crosstalk relationship m6A → Histone modification
Disease Liver cancer
 Disease Info 
Non-coding RNA
m6A Target: Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05374
 Crosstalk Info 
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Crosstalk relationship m6A → ncRNA
Crosstalk ID: M6ACROT05794
 Crosstalk Info 
Epigenetic Regulator Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
Crosstalk relationship m6A → ncRNA
m6A Target: Transcript inducer of AURKA lysosomal degradation (TIALD)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05726
 Crosstalk Info 
Epigenetic Regulator Transcript inducer of AURKA lysosomal degradation (TIALD)
Regulated Target Aurora kinase A (AURKA)
Crosstalk relationship m6A → ncRNA
Disease Liver cancer
 Disease Info 
Drug alisertib
 Drug Info 
m6A Target: Lnc-CSMD1-7
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05747
 Crosstalk Info 
Epigenetic Regulator Lnc-CSMD1-7
Regulated Target RNA binding fox-1 homolog 2 (RBFOX2)
Crosstalk relationship m6A → ncRNA
Disease Liver cancer
 Disease Info 
m6A Target: RNA, U6 small nuclear 1 (RNU6-1)
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05782
 Crosstalk Info 
Epigenetic Regulator RNA, U6 small nuclear 1 (RNU6-1)
Crosstalk relationship m6A → ncRNA
Crosstalk ID: M6ACROT05783
 Crosstalk Info 
Epigenetic Regulator RNA, U6 small nuclear 1 (RNU6-1)
Crosstalk relationship m6A → ncRNA
Crosstalk ID: M6ACROT05790
 Crosstalk Info 
Epigenetic Regulator RNA, U6 small nuclear 1 (RNU6-1)
Crosstalk relationship m6A → ncRNA
m6A Target: RNA, 18S ribosomal 1 (RNA18S1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05791
 Crosstalk Info 
Epigenetic Regulator RNA, 18S ribosomal 1 (RNA18S1)
Crosstalk relationship m6A → ncRNA
m6A Target: RNA28S1
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05792
 Crosstalk Info 
Epigenetic Regulator RNA28S1
Crosstalk relationship m6A → ncRNA
m6A Target: RNA5S1
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05793
 Crosstalk Info 
Epigenetic Regulator RNA5S1
Crosstalk relationship m6A → ncRNA
Xenobiotics Compound(s) Regulating the m6A Methylation Regulator
Compound Name Butyrate Investigative
Synonyms
butyrate; butanoate; N-Butyrate; n-butanoate; Butanoic acid, ion(1-); propylformate; 461-55-2; butanate; 1-butanoate; propanecarboxylate; 1-butyrate; 1-propanecarboxylate; CHEMBL62381; NCGC00167555-01; ethyl,acetate; Sodium; butyrate; C11H23NOS; DTXSID8040432; CHEBI:17968; CH3-[CH2]2-COO(-); BDBM50079401; c0035; M135; AB01566831_01; Q55582441
    Click to Show/Hide
External link
CID: 104775
Description
In cell model induced by sodium butyrate and cell density, while METTL3, METTL16 and WTAP were decreased during the differentiation of cells.
 [23]
References
Ref 1 Gene Signatures and Prognostic Values of m6A Regulators in Hepatocellular Carcinoma. Front Genet. 2020 Oct 2;11:540186. doi: 10.3389/fgene.2020.540186. eCollection 2020.
Ref 2 O-arylmandelic acids as highly selective human PPAR alpha/gamma agonists. Bioorg Med Chem Lett. 2003 Oct 6;13(19):3185-90. doi: 10.1016/s0960-894x(03)00702-9.
Ref 3 PM2.5 induces pulmonary microvascular injury in COPD via METTL16-mediated m6A modification. Environ Pollut. 2022 Jun 15;303:119115. doi: 10.1016/j.envpol.2022.119115. Epub 2022 Mar 5.
Ref 4 METTL16 promotes cell proliferation by up-regulating cyclin D1 expression in gastric cancer. J Cell Mol Med. 2021 Jul;25(14):6602-6617. doi: 10.1111/jcmm.16664. Epub 2021 Jun 2.
Ref 5 US patent application no. 6,133,032, Antisense modulation of PI3 kinase p110 beta expression.
Ref 6 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019
Ref 7 Diazinon, chlorpyrifos and parathion are metabolised by multiple cytochromes P450 in human liver. Toxicology. 2006 Jul 5;224(1-2):22-32. doi: 10.1016/j.tox.2006.04.024. Epub 2006 Apr 26.
Ref 8 Metabolism and Disposition of Hepatitis C Polymerase Inhibitor Dasabuvir in Humans. Drug Metab Dispos. 2016 Aug;44(8):1139-47. doi: 10.1124/dmd.115.067512. Epub 2016 May 13.
Ref 9 Epidermal growth factor receptor inhibitor PKI-166 governs cardiovascular protection without beneficial effects on the kidney in hypertensive 5/6 nephrectomized rats. J Pharmacol Exp Ther. 2013 Jun;345(3):393-403. doi: 10.1124/jpet.113.203497. Epub 2013 Mar 25.
Ref 10 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800033173)
Ref 11 Clinical pipeline report, company report or official report of Actinium Pharmaceuticals.
Ref 12 Anti-ageing pipeline starts to mature. Nat Rev Drug Discov. 2018 Sep;17(9):609-612. doi: 10.1038/nrd.2018.134. Epub 2018 Aug 3.
Ref 13 Contribution of human hepatic cytochrome P450s and steroidogenic CYP17 to the N-demethylation of aminopyrine. Xenobiotica. 1999 Feb;29(2):187-93. doi: 10.1080/004982599238731.
Ref 14 ClinicalTrials.gov (NCT02541370) Treatment of Relapsed and/or Chemotherapy Refractory Advanced Malignancies by CART133
Ref 15 Caspase-dependent apoptosis of cells expressing the chemokine receptor CXCR4 is induced by cell membrane-associated human immunodeficiency virus type 1 envelope glycoprotein (gp120). Virology. 2000 Mar 15;268(2):329-44. doi: 10.1006/viro.1999.0151.
Ref 16 PG545, a dual heparanase and angiogenesis inhibitor, induces potent anti-tumour and anti-metastatic efficacy in preclinical models. Br J Cancer. 2011 Feb 15;104(4):635-42. doi: 10.1038/bjc.2011.11. Epub 2011 Feb 1.
Ref 17 Active efflux of the 5-HT(1A) receptor agonist flesinoxan via P-glycoprotein at the blood-brain barrier. Eur J Pharm Sci. 2001 Aug;14(1):81-6.
Ref 18 Clinical pipeline report, company report or official report of Sumitomo Dainippon Pharma.
Ref 19 A phase II, randomized, double-blind, placebo-controlled study evaluating the efficacy and safety of MDX-1100, a fully human anti-CXCL10 monoclonal antibody, in combination with methotrexate in patients with rheumatoid arthritis. Arthritis Rheum. 2012 Jun;64(6):1730-9. doi: 10.1002/art.34330. Epub 2011 Dec 6.
Ref 20 Down-regulation of survivin in nitric oxide-induced cell growth inhibition and apoptosis of the human lung carcinoma cells. J Biol Chem. 2004 May 7;279(19):20267-76. doi: 10.1074/jbc.M312381200. Epub 2004 Feb 26.
Ref 21 Involvement of BCRP (ABCG2) in the biliary excretion of pitavastatin. Mol Pharmacol. 2005 Sep;68(3):800-7. doi: 10.1124/mol.105.014019. Epub 2005 Jun 13.
Ref 22 Curcumin inhibits the activity of ABCG2/BCRP1, a multidrug resistance-linked ABC drug transporter in mice. Pharm Res. 2009 Feb;26(2):480-7. doi: 10.1007/s11095-008-9735-8. Epub 2008 Oct 9.
Ref 23 The differentiation of colorectal cancer is closely relevant to m6A modification. Biochem Biophys Res Commun. 2021 Mar 26;546:65-73. doi: 10.1016/j.bbrc.2021.02.001. Epub 2021 Feb 8.