m6A Regulator Information

General Information of the m6A Regulator (ID: REG00015)
Regulator Name Protein virilizer homolog (VIRMA)
Synonyms
KIAA1429; MSTP054
    Click to Show/Hide
Gene Name VIRMA
Sequence
MAVDSAMELLFLDTFKHPSAEQSSHIDVVRFPCVVYINEVRVIPPGVRAHSSLPDNRAYG
ETSPHTFQLDLFFNNVSKPSAPVFDRLGSLEYDENTSIIFRPNSKVNTDGLVLRGWYNCL
TLAIYGSVDRVISHDRDSPPPPPPPPPPPQPQPSLKRNPKHADGEKEDQFNGSPPRPQPR
GPRTPPGPPPPDDDEDDPVPLPVSGDKEEDAPHREDYFEPISPDRNSVPQEGQYSDEGEV
EEEQQEEGEEDEDDVDVEEEEDEDEDDRRTVDSIPEEEEEDEEEEGEEDEEGEGDDGYEQ
ISSDEDGIADLERETFKYPNFDVEYTAEDLASVPPMTYDPYDRELVPLLYFSCPYKTTFE
IEISRMKDQGPDKENSGAIEASVKLTELLDLYREDRGAKWVTALEEIPSLIIKGLSYLQL
KNTKQDSLGQLVDWTMQALNLQVALRQPIALNVRQLKAGTKLVSSLAECGAQGVTGLLQA
GVISGLFELLFADHVSSSLKLNAFKALDSVISMTEGMEAFLRGRQNEKSGYQKLLELILL
DQTVRVVTAGSAILQKCHFYEVLSEIKRLGDHLAEKTSSLPNHSEPDHDTDAGLERTNPE
YENEVEASMDMDLLESSNISEGEIERLINLLEEVFHLMETAPHTMIQQPVKSFPTMARIT
GPPERDDPYPVLFRYLHSHHFLELVTLLLSIPVTSAHPGVLQATKDVLKFLAQSQKGLLF
FMSEYEATNLLIRALCHFYDQDEEEGLQSDGVIDDAFALWLQDSTQTLQCITELFSHFQR
CTASEETDHSDLLGTLHNLYLITFNPVGRSAVGHVFSLEKNLQSLITLMEYYSKEALGDS
KSKKSVAYNYACILILVVVQSSSDVQMLEQHAASLLKLCKADENNAKLQELGKWLEPLKN
LRFEINCIPNLIEYVKQNIDNLMTPEGVGLTTALRVLCNVACPPPPVEGQQKDLKWNLAV
IQLFSAEGMDTFIRVLQKLNSILTQPWRLHVNMGTTLHRVTTISMARCTLTLLKTMLTEL
LRGGSFEFKDMRVPSALVTLHMLLCSIPLSGRLDSDEQKIQNDIIDILLTFTQGVNEKLT
ISEETLANNTWSLMLKEVLSSILKVPEGFFSGLILLSELLPLPLPMQTTQVIEPHDISVA
LNTRKLWSMHLHVQAKLLQEIVRSFSGTTCQPIQHMLRRICVQLCDLASPTALLIMRTVL
DLIVEDLQSTSEDKEKQYTSQTTRLLALLDALASHKACKLAILHLINGTIKGDERYAEIF
QDLLALVRSPGDSVIRQQCVEYVTSILQSLCDQDIALILPSSSEGSISELEQLSNSLPNK
ELMTSICDCLLATLANSESSYNCLLTCVRTMMFLAEHDYGLFHLKSSLRKNSSALHSLLK
RVVSTFSKDTGELASSFLEFMRQILNSDTIGCCGDDNGLMEVEGAHTSRTMSINAAELKQ
LLQSKEESPENLFLELEKLVLEHSKDDDNLDSLLDSVVGLKQMLESSGDPLPLSDQDVEP
VLSAPESLQNLFNNRTAYVLADVMDDQLKSMWFTPFQAEEIDTDLDLVKVDLIELSEKCC
SDFDLHSELERSFLSEPSSPGRTKTTKGFKLGKHKHETFITSSGKSEYIEPAKRAHVVPP
PRGRGRGGFGQGIRPHDIFRQRKQNTSRPPSMHVDDFVAAESKEVVPQDGIPPPKRPLKV
SQKISSRGGFSGNRGGRGAFHSQNRFFTPPASKGNYSRREGTRGSSWSAQNTPRGNYNES
RGGQSNFNRGPLPPLRPLSSTGYRPSPRDRASRGRGGLGPSWASANSGSGGSRGKFVSGG
SGRGRHVRSFTR
    Click to Show/Hide
Family vir family
Function
Associated component of the WMM complex, a complex that mediates N6-methyladenosine (m6A) methylation of RNAs, a modification that plays a role in the efficiency of mRNA splicing and RNA processing . Acts as a key regulator of m6A methylation by promoting m6A methylation of mRNAs in the 3'-UTR near the stop codon: recruits the catalytic core components METTL3 and METTL14, thereby guiding m6A methylation at specific sites. Required for mRNA polyadenylation via its role in selective m6A methylation: m6A methylation of mRNAs in the 3'-UTR near the stop codon correlating with alternative polyadenylation (APA).
    Click to Show/Hide
Gene ID 25962
Uniprot ID
VIR_HUMAN
Regulator Type WRITER ERASER READER
Mechanism Diagram Click to View the Original Diagram
Target Genes Click to View Potential Target Genes of This Regulator
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
VIRMA can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Browse Target Gene related Drug
Cyclin-dependent kinase 1 (CDK1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by VIRMA
Cell Line Human umbilical vein endothelial cells Homo sapiens
Treatment: siVIRMA HUVECs
Control: siControl HUVECs
 GSE167067
Regulation
logFC: -7.84E-01
p-value: 3.08E-02
More Results Click to View More RNA-seq Results
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process Cell proliferation and metastasis
Response Summary KIAA1429 acts as an oncogenic factor in breast cancer by regulating CDK1 in an N6-methyladenosine-independent manner.5'-fluorouracil was found to be very effective in reducing the expression of KIAA1429 and Cyclin-dependent kinase 1 (CDK1) in breast cancer.
Death-associated protein kinase 3 (DAPK3)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by VIRMA
Cell Line Human umbilical vein endothelial cells Homo sapiens
Treatment: siVIRMA HUVECs
Control: siControl HUVECs
 GSE167067
Regulation
logFC: 5.95E-01
p-value: 2.81E-02
More Results Click to View More RNA-seq Results
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Down regulation
In-vitro Model
 PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
Response Summary High expression of KIAA1429 was testified in patients with non-small cell lung cancer and predicted worse prognosis in patients. KIAA1429-guided m6A modifications promoted NSCLC progression via m6A-dependent degradation of Death-associated protein kinase 3 (DAPK3) mRNA.
Histone H2AX (H2AX)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by VIRMA
Cell Line Human umbilical vein endothelial cells Homo sapiens
Treatment: siVIRMA HUVECs
Control: siControl HUVECs
 GSE167067
Regulation
logFC: -1.09E+00
p-value: 1.68E-02
More Results Click to View More RNA-seq Results
Testicular cancer [ICD-11: 2C80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Germ cell tumour of testis [ICD-11: 2C80.2]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Down regulation
In-vitro Model
 2102EP Embryonal carcinoma Homo sapiens CVCL_C522
NCC-IT Testicular embryonal carcinoma Homo sapiens CVCL_1451
NT2 Malignant neoplasms Mus musculus CVCL_JA57
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary VIRMA has an oncogenic role in germ cell tumor confirming our previous tissue-based study and is further involved in response to cisplatin by interfering with DNA repair. Enhanced response to cisplatin after VIRMA knockdown was related to significant increase in DNA damage (with higher Histone H2AX (H2AX) and GADD45B levels) and downregulation of XLF and MRE11.
SMC protein 1A (SMC1A)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and VIRMA
Cell Line HeLa Homo sapiens
Regulation logFC: 1.58E+00 GSE102493
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Pathway Response Adherens junction hsa04520
Cell Process Epithelial-mesenchymal transition
Cell migration
Cell invasion
In-vitro Model
 ZR-75-1 Invasive breast carcinoma Homo sapiens CVCL_0588
SUM1315MO2 Invasive breast carcinoma of no special type Homo sapiens CVCL_5589
In-vivo Model For the mouse lung metastasis model, SUM-1315 cells (2 × 106/0.2 mL) expressing NC, shKIAA1429, SNAIL, or shKIAA1429+SNAIL were injected into the nude mice through the tail vein.
Response Summary KIAA1429 could significantly promote the migration and invasion of breast cancer cells. KIAA1429 could bind to the motif in the 3' UTR of SMC protein 1A (SMC1A) mRNA directly and enhance SMC1A mRNA stability. In conclusion, the study revealed a novel mechanism of the KIAA1429/SMC1A/SNAIL axis in the regulation of metastasis of breast cancer.
Transcription factor Jun (c-Jun/JUN)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and VIRMA
Cell Line HeLa Homo sapiens
Regulation logFC: 1.80E+00 GSE102493
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [5]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process Arrest cell cycle at the S phase
In-vitro Model
 MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
In-vivo Model Gastric cancer cell line MGC803 (shRNA-NC or shKIAA1429; 1 × 107) was injected subcutaneously into the armpit of BALB/c nude mice (5-week-old, male, n = 4 for each group). Tumor growth was monitored at 3-day intervals.
Response Summary KIAA1429 played a key role in promoting gastric cancer by regulating Transcription factor Jun (c-Jun/JUN) expression in an m6A independent manner.
Cyclin-dependent kinase 4 (CDK4)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Lung cancer [ICD-11: 2C25]
Cell Process Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
HBE (Human bronchial epithelial cell line)
LTEP-a2 Endocervical adenocarcinoma Homo sapiens CVCL_6929
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
Response Summary GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, CCND1, Cyclin-dependent kinase 4 (CDK4), EGR2, YBX1, and TLX, which were associated with lung cancers.
DNA-binding protein inhibitor ID-2 (ID2)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Up regulation
Pathway Response RNA degradation hsa03018
Cell Process Cell migration and invasion
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Hep-G2/2.2.15 Hepatoblastoma Homo sapiens CVCL_L855
L-02 Endocervical adenocarcinoma Homo sapiens CVCL_6926
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Response Summary KIAA1429 facilitated migration and invasion of Hepatocellular carcinoma cells by inhibiting DNA-binding protein inhibitor ID-2 (ID2) via upregulating m6A modification of ID2 mRNA.
Double-strand break repair protein MRE11 (MRE11)
 Target Gene 
Testicular cancer [ICD-11: 2C80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Germ cell tumour of testis [ICD-11: 2C80.2]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 2102EP Embryonal carcinoma Homo sapiens CVCL_C522
NCC-IT Testicular embryonal carcinoma Homo sapiens CVCL_1451
NT2 Malignant neoplasms Mus musculus CVCL_JA57
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary VIRMA has an oncogenic role in germ cell tumor confirming our previous tissue-based study and is further involved in response to cisplatin by interfering with DNA repair. Enhanced response to cisplatin after VIRMA knockdown was related to significant increase in DNA damage (with higher Gamma-H2AX and GADD45B levels) and downregulation of XLF and Double-strand break repair protein MRE11 (MRE11).
E3 SUMO-protein ligase EGR2 (EGR2)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Lung cancer [ICD-11: 2C25]
Cell Process Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
HBE (Human bronchial epithelial cell line)
LTEP-a2 Endocervical adenocarcinoma Homo sapiens CVCL_6929
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
Response Summary GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, CCND1, CDK4, E3 SUMO-protein ligase EGR2 (EGR2), YBX1, and TLX, which were associated with lung cancers.
E3 ubiquitin-protein ligase Hakai (CBLL1)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Cell Process Cell apoptosis
Response Summary KIAA1429 had the highest mutation frequency. Higher E3 ubiquitin-protein ligase Hakai (CBLL1) expression was associated with a better prognosis in breast cancer than lower CBLL1 expression.
G1/S-specific cyclin-D1 (CCND1)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Lung cancer [ICD-11: 2C25]
Cell Process Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
HBE (Human bronchial epithelial cell line)
LTEP-a2 Endocervical adenocarcinoma Homo sapiens CVCL_6929
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
Response Summary GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, G1/S-specific cyclin-D1 (CCND1), CDK4, EGR2, YBX1, and TLX, which were associated with lung cancers.
Homeobox protein Hox-A1 (HOXA1)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Responsed Drug Gefitinib Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
NHBE (Normal bronchial epithelial cells)
In-vivo Model PC9-GR cells stably infected with KIAA1429-targeting shRNA and control were suspended in 100 uL of PBS with Matrigel matrix (BD Biosciences). Then, cells were injected into one of the flanks of BALB/c nude mice.
Response Summary m6A methyltransferase KIAA1429 was highly expressed in gefitinib-resistant NSCLC cells (PC9-GR), tissues, and closely related to unfavorable survival. KIAA1429 plays essential oncogenic roles in NSCLC gefitinib resistance, which provided a feasible therapeutic target for NSCLC.
NAD-dependent protein deacetylase sirtuin-1 (SIRT1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
In-vitro Model
 SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
NCM460 Normal Homo sapiens CVCL_0460
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
In-vivo Model 5.0 × 106 SW480 cells (infected with scr or KIAA1429 shRNA) that suspended in 50 ul PBS and mixed with an equal volume of matrigel were subcutaneously injected in a 6-weeks-old male NOD/SCID (The Jackson Laboratory, Stock No: 001303) mice flank. We started measuring tumor size at the indicated times one week after injection.
Response Summary KIAA1429 increased the expression of NAD-dependent protein deacetylase sirtuin-1 (SIRT1) via regulating its mRNA stability in an m6A-dependent manner. More importantly, in vivo experiment showed that depletion of KIAA1429 significantly inhibited colorectal tumor growth.
Negative growth regulatory protein MyD118 (GADD45B)
 Target Gene 
Testicular cancer [ICD-11: 2C80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Germ cell tumour of testis [ICD-11: 2C80.2]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Down regulation
In-vitro Model
 2102EP Embryonal carcinoma Homo sapiens CVCL_C522
NCC-IT Testicular embryonal carcinoma Homo sapiens CVCL_1451
NT2 Malignant neoplasms Mus musculus CVCL_JA57
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary VIRMA has an oncogenic role in germ cell tumor confirming our previous tissue-based study and is further involved in response to cisplatin by interfering with DNA repair. Enhanced response to cisplatin after VIRMA knockdown was related to significant increase in DNA damage (with higher Gamma-H2AX and Negative growth regulatory protein MyD118 (GADD45B) levels) and downregulation of XLF and MRE11.
Non-homologous end-joining factor 1 (NHEJ1/XLF)
 Target Gene 
Testicular cancer [ICD-11: 2C80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Germ cell tumour of testis [ICD-11: 2C80.2]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 2102EP Embryonal carcinoma Homo sapiens CVCL_C522
NCC-IT Testicular embryonal carcinoma Homo sapiens CVCL_1451
NT2 Malignant neoplasms Mus musculus CVCL_JA57
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary VIRMA has an oncogenic role in germ cell tumor confirming our previous tissue-based study and is further involved in response to cisplatin by interfering with DNA repair. Enhanced response to cisplatin after VIRMA knockdown was related to significant increase in DNA damage (with higher Gamma-H2AX and GADD45B levels) and downregulation of Non-homologous end-joining factor 1 (NHEJ1/XLF) and MRE11.
Nuclear receptor subfamily 2 group E member 1 (TLX/NR2E1)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Lung cancer [ICD-11: 2C25]
Cell Process Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
HBE (Human bronchial epithelial cell line)
LTEP-a2 Endocervical adenocarcinoma Homo sapiens CVCL_6929
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
Response Summary GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, CCND1, CDK4, EGR2, YBX1, and Nuclear receptor subfamily 2 group E member 1 (TLX/NR2E1), which were associated with lung cancers.
Pre-mRNA-splicing regulator WTAP (WTAP)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Lung cancer [ICD-11: 2C25]
Cell Process Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
HBE (Human bronchial epithelial cell line)
LTEP-a2 Endocervical adenocarcinoma Homo sapiens CVCL_6929
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
Response Summary GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, Pre-mRNA-splicing regulator WTAP (WTAP), CCND1, CDK4, EGR2, YBX1, and TLX, which were associated with lung cancers.
Protein BTG2 (BTG2)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Up regulation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
SPC-A1 Endocervical adenocarcinoma Homo sapiens CVCL_6955
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
HBE (Human bronchial epithelial cell line)
In-vivo Model For the in vivo cell proliferation assay, A549 and SPCA1 cells were stably transfected with sh-Ctrl and sh-KIAA1429 using lentivirus (GeneChem, Shanghai, China). The cells were subcutaneously injected into either side of the posterior flanks of the mouse. The tumor volume was measured every few days (length×width2×0.5).
Response Summary Knockdown of KIAA1429 significantly decreased the m6A levels of Protein BTG2 (BTG2) mRNA, leading to enhanced YTHDF2-dependent BTG2 mRNA stability and promoted the expression of BTG2; thus, participating in the tumorigenesis of LUAD.
Trans-acting T-cell-specific transcription factor GATA-3 (GATA3)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Down regulation
Cell Process Cell proliferation and metastasis
In-vitro Model
 HCCLM3 Adult hepatocellular carcinoma Homo sapiens CVCL_6832
HEK293T Normal Homo sapiens CVCL_0063
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
SK-HEP-1 Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
SNU-182 Adult hepatocellular carcinoma Homo sapiens CVCL_0090
SNU-449 Adult hepatocellular carcinoma Homo sapiens CVCL_0454
Response Summary KIAA1429 induced m6A methylation on the 3' UTR of Trans-acting T-cell-specific transcription factor GATA-3 (GATA3) pre-mRNA, leading to the separation of the RNA-binding protein HuR and the degradation of GATA3 pre-mRNA. KIAA1429 was considerably upregulated in Hepatocellular carcinoma tissues.
Transcription factor E2F3 (E2F3)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Lung cancer [ICD-11: 2C25]
Cell Process Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
HBE (Human bronchial epithelial cell line)
LTEP-a2 Endocervical adenocarcinoma Homo sapiens CVCL_6929
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
Response Summary GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including Transcription factor E2F3 (E2F3), WTAP, CCND1, CDK4, EGR2, YBX1, and TLX, which were associated with lung cancers.
Y-box-binding protein 1 (YBX1)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Lung cancer [ICD-11: 2C25]
Cell Process Cell apoptosis
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H520 Lung squamous cell carcinoma Homo sapiens CVCL_1566
HBE (Human bronchial epithelial cell line)
LTEP-a2 Endocervical adenocarcinoma Homo sapiens CVCL_6929
SK-MES-1 Lung squamous cell carcinoma Homo sapiens CVCL_0630
Response Summary GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, CCND1, CDK4, EGR2, Y-box-binding protein 1 (YBX1), and TLX, which were associated with lung cancers.
Zinc finger protein SNAI1 (SNAI1)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Pathway Response Adherens junction hsa04520
Cell Process Epithelial-mesenchymal transition
Cell migration
Cell invasion
In-vitro Model
 ZR-75-1 Invasive breast carcinoma Homo sapiens CVCL_0588
SUM1315MO2 Invasive breast carcinoma of no special type Homo sapiens CVCL_5589
In-vivo Model For the mouse lung metastasis model, SUM-1315 cells (2 × 106/0.2 mL) expressing NC, shKIAA1429, SNAIL, or shKIAA1429+SNAIL were injected into the nude mice through the tail vein.
Response Summary KIAA1429 could significantly promote the migration and invasion of breast cancer cells. KIAA1429 could bind to the motif in the 3' UTR of SMC1A mRNA directly and enhance SMC1A mRNA stability. In conclusion, the study revealed a novel mechanism of the KIAA1429/SMC1A/Zinc finger protein SNAI1 (SNAI1) axis in the regulation of metastasis of breast cancer.
Colon cancer associated transcript 1 (CCAT1)
 Target Gene 
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [13]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
Cell Process RNA stability
In-vitro Model
 22Rv1 Prostate carcinoma Homo sapiens CVCL_1045
DU145 Prostate carcinoma Homo sapiens CVCL_0105
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
VCaP Prostate carcinoma Homo sapiens CVCL_2235
Response Summary VIRMA downregulation attenuates the aggressive phenotype of prostate cancer by overall reduction of m6A-levels decreasing stability and abundance of oncogenic lncRNAs. VIRMA depletion and m6A reduction decreased the stability and abundance of Colon cancer associated transcript 1 (CCAT1) transcripts.
Colon cancer associated transcript 2 (CCAT2)
 Target Gene 
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [13]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
Cell Process RNA stability
In-vitro Model
 22Rv1 Prostate carcinoma Homo sapiens CVCL_1045
DU145 Prostate carcinoma Homo sapiens CVCL_0105
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
VCaP Prostate carcinoma Homo sapiens CVCL_2235
Response Summary VIRMA downregulation attenuates the aggressive phenotype of prostate cancer by overall reduction of m6A-levels decreasing stability and abundance of oncogenic lncRNAs. VIRMA depletion and m6A reduction decreased the stability and abundance of Colon cancer associated transcript 2 (CCAT2) transcripts.
Long intergenic non-protein coding RNA 958 (LINC00958)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [14]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Cell Process Glycolysis
In-vitro Model
 SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
GES-1 Normal Homo sapiens CVCL_EQ22
BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
In-vivo Model Ten four-week-old BALB/c nude mice were injected with LINC00958-overexpressing or vector-transfected cells. Briefly, 5 × 106 cells were subcutaneously injected in the flank of mice. Four weeks after injection, the mice were sacrificed and examined by weighting.
Response Summary Long intergenic non-protein coding RNA 958 (LINC00958) accelerated the aerobic glycolysis of GC cells. Mechanistically, KIAA1429 interacted with the m6A modification site and promoted the enrichment of LINC00958, and LINC00958 subsequently cooperated with GLUT1 mRNA to enhance its mRNA stability.
hsa-miR-143-3p
 Target Gene 
Aortic aneurysm or dissection [ICD-11: BD50]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [15]
Responsed Disease Aortic aneurysm or dissection [ICD-11: BD50]
Target Regulation Down regulation
Pathway Response RNA degradation hsa03018
Cell Process Cell apoptosis
In-vitro Model
 IM-HAEC Normal Homo sapiens CVCL_B5WL
In-vivo Model Osmotic mini-pumps containing AngII (1 ug/kg/min, Enzo Bioche) were implanted in 7-week-old male mice. To interfere with the expression of KIAA1429, ALKBH5, or DDX6 in vivo, adeno-associated virus 9 (AAV9) vectors carrying a variety of overexpression plasmids or interfering RNA were randomly injected through the tail vein to C57BL/6N mice.
Response Summary KIAA1429 is downregulated while ALKBH5 is upregulated in aortic tissues from aortic dissection patients. KIAA1429/ALKBH5-mediated m6A modifications can regulate the processing of hsa-miR-143-3p through interacting with the microprocessor protein DGCR8. KIAA1429 and ALKBH5 can oppositely regulate HASMC proliferation, HAEC apoptosis, and AD progression in AngII-infused mice via the miR-143-3p/DDX6 pathway.
Circ_DLC1
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [16]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation Down regulation
Pathway Response RNA degradation hsa03018
Cell Process RNA stability
In-vitro Model
 SNU-449 Adult hepatocellular carcinoma Homo sapiens CVCL_0454
SK-HEP-1 Liver and intrahepatic bile duct epithelial neoplasm Homo sapiens CVCL_0525
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Hep 3B2.1-7 Childhood hepatocellular carcinoma Homo sapiens CVCL_0326
In-vivo Model 5 × 105 cells were injected subcutaneously into the right axilla of mice. Tumor volume was measured by a caliper weekly and calculated as length × width2 × 0.52. For the liver orthotopic-implanted models, each liver of mice was injected with 1 × 106 cells.
Response Summary Circ_DLC1, a downstream target of KIAA1429, is a promising prognostic marker for HCC patients, and the circDLC1-HuR-MMP1 axis serve as a potential therapeutic target for HCC treatment.
Unspecific Target Gene
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [17]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Responsed Drug Gemcitabine Approved
 Drug Info 
Pathway Response Adipocytokine signaling pathway hsa04920
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
HDE-CT cell line (A normal human pancreatic cell line)
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response Summary Lasso regression identified a six-m6A-regulator-signature prognostic model (KIAA1429, HNRNPC, METTL3, YTHDF1, IGF2BP2, and IGF2BP3). Gene set enrichment analysis revealed m6A regulators (KIAA1429, HNRNPC, and IGF2BP2) were related to multiple biological behaviors in pancreatic cancer, including adipocytokine signaling, the well vs. poorly differentiated tumor pathway, tumor metastasis pathway, epithelial mesenchymal transition pathway, gemcitabine resistance pathway, and stemness pathway.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug Teniposide Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Nucleotide excision repair hsa03420
mTOR signaling pathway hsa04150
Cell Process DNA repair
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model To establish a tumour model, C57BL/6 mice were intraperitoneal injected with 25 mg/kg diethylnitrosamine at 2 weeks of age.
Response Summary The m6A model includes LRPPRC, YTHDF2, KIAA14219, and RBM15B, classified A-hepatocellular carcinoma patients into high/low-risk subtypes. The expression of Immunosuppressive cytokines DNMT1/EZH2 was up-regulated in A-hepatocellular carcinoma patients, and teniposide can be a potential therapeutic drug for A-hepatocellular carcinoma.
Testicular cancer [ICD-11: 2C80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Testicular cancer [ICD-11: 2C80]
Target Regulation Up regulation
Cell Process Transcription
Response Summary Abundance of m6A and expression of VIRMA/YTHDF3 were different among Testicular Germ Cell Tumors subtypes, with higher levels in SEs, suggesting a contribution to SE phenotype maintenance.
Histone H2AX (H2AX)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by VIRMA
Cell Line Human umbilical vein endothelial cells Homo sapiens
Treatment: siVIRMA HUVECs
Control: siControl HUVECs
 GSE167067
Regulation
logFC: -1.09E+00
p-value: 1.68E-02
More Results Click to View More RNA-seq Results
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [3]
Responsed Disease Germ cell tumour of testis ICD-11: 2C80.2
 Disease Info 
Target Regulation Down regulation
In-vitro Model 2102EP Embryonal carcinoma Homo sapiens CVCL_C522
NCC-IT Testicular embryonal carcinoma Homo sapiens CVCL_1451
NT2 Malignant neoplasms Mus musculus CVCL_JA57
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary VIRMA has an oncogenic role in germ cell tumor confirming our previous tissue-based study and is further involved in response to cisplatin by interfering with DNA repair. Enhanced response to cisplatin after VIRMA knockdown was related to significant increase in DNA damage (with higher Histone H2AX (H2AX) and GADD45B levels) and downregulation of XLF and MRE11.
Double-strand break repair protein MRE11 (MRE11)
 Target Gene 
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [3]
Responsed Disease Germ cell tumour of testis ICD-11: 2C80.2
 Disease Info 
Target Regulation Up regulation
In-vitro Model 2102EP Embryonal carcinoma Homo sapiens CVCL_C522
NCC-IT Testicular embryonal carcinoma Homo sapiens CVCL_1451
NT2 Malignant neoplasms Mus musculus CVCL_JA57
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary VIRMA has an oncogenic role in germ cell tumor confirming our previous tissue-based study and is further involved in response to cisplatin by interfering with DNA repair. Enhanced response to cisplatin after VIRMA knockdown was related to significant increase in DNA damage (with higher Gamma-H2AX and GADD45B levels) and downregulation of XLF and Double-strand break repair protein MRE11 (MRE11).
Homeobox protein Hox-A1 (HOXA1)
 Target Gene 
Gefitinib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [9]
Responsed Disease Non-small-cell lung carcinoma ICD-11: 2C25.Y
 Disease Info 
Target Regulation Up regulation
In-vitro Model Gefitinib-resistant cell line PC9GR (Gefitinib-resistant PC9 cell line)
PC-9 Lung adenocarcinoma Homo sapiens CVCL_B260
NHBE (Normal bronchial epithelial cells)
In-vivo Model PC9-GR cells stably infected with KIAA1429-targeting shRNA and control were suspended in 100 uL of PBS with Matrigel matrix (BD Biosciences). Then, cells were injected into one of the flanks of BALB/c nude mice.
Response Summary m6A methyltransferase KIAA1429 was highly expressed in gefitinib-resistant NSCLC cells (PC9-GR), tissues, and closely related to unfavorable survival. KIAA1429 plays essential oncogenic roles in NSCLC gefitinib resistance, which provided a feasible therapeutic target for NSCLC.
Negative growth regulatory protein MyD118 (GADD45B)
 Target Gene 
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [3]
Responsed Disease Germ cell tumour of testis ICD-11: 2C80.2
 Disease Info 
Target Regulation Down regulation
In-vitro Model 2102EP Embryonal carcinoma Homo sapiens CVCL_C522
NCC-IT Testicular embryonal carcinoma Homo sapiens CVCL_1451
NT2 Malignant neoplasms Mus musculus CVCL_JA57
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary VIRMA has an oncogenic role in germ cell tumor confirming our previous tissue-based study and is further involved in response to cisplatin by interfering with DNA repair. Enhanced response to cisplatin after VIRMA knockdown was related to significant increase in DNA damage (with higher Gamma-H2AX and Negative growth regulatory protein MyD118 (GADD45B) levels) and downregulation of XLF and MRE11.
Non-homologous end-joining factor 1 (NHEJ1/XLF)
 Target Gene 
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [3]
Responsed Disease Germ cell tumour of testis ICD-11: 2C80.2
 Disease Info 
Target Regulation Up regulation
In-vitro Model 2102EP Embryonal carcinoma Homo sapiens CVCL_C522
NCC-IT Testicular embryonal carcinoma Homo sapiens CVCL_1451
NT2 Malignant neoplasms Mus musculus CVCL_JA57
TCam-2 Testicular seminoma Homo sapiens CVCL_T012
Response Summary VIRMA has an oncogenic role in germ cell tumor confirming our previous tissue-based study and is further involved in response to cisplatin by interfering with DNA repair. Enhanced response to cisplatin after VIRMA knockdown was related to significant increase in DNA damage (with higher Gamma-H2AX and GADD45B levels) and downregulation of Non-homologous end-joining factor 1 (NHEJ1/XLF) and MRE11.
Unspecific Target Gene
Gemcitabine [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [17]
Responsed Disease Pancreatic cancer ICD-11: 2C10
 Disease Info 
Pathway Response Adipocytokine signaling pathway hsa04920
Cell Process Epithelial-mesenchymal transition
In-vitro Model BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
HDE-CT cell line (A normal human pancreatic cell line)
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response Summary Lasso regression identified a six-m6A-regulator-signature prognostic model (KIAA1429, HNRNPC, METTL3, YTHDF1, IGF2BP2, and IGF2BP3). Gene set enrichment analysis revealed m6A regulators (KIAA1429, HNRNPC, and IGF2BP2) were related to multiple biological behaviors in pancreatic cancer, including adipocytokine signaling, the well vs. poorly differentiated tumor pathway, tumor metastasis pathway, epithelial mesenchymal transition pathway, gemcitabine resistance pathway, and stemness pathway.
Teniposide [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [18]
Responsed Disease Hepatocellular carcinoma ICD-11: 2C12.02
 Disease Info 
Target Regulation Up regulation
Pathway Response Nucleotide excision repair hsa03420
mTOR signaling pathway hsa04150
Cell Process DNA repair
In-vitro Model Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
In-vivo Model To establish a tumour model, C57BL/6 mice were intraperitoneal injected with 25 mg/kg diethylnitrosamine at 2 weeks of age.
Response Summary The m6A model includes LRPPRC, YTHDF2, KIAA14219, and RBM15B, classified A-hepatocellular carcinoma patients into high/low-risk subtypes. The expression of Immunosuppressive cytokines DNMT1/EZH2 was up-regulated in A-hepatocellular carcinoma patients, and teniposide can be a potential therapeutic drug for A-hepatocellular carcinoma.
Click to View Potential Drug Response of This Regulator
Xenobiotics Compound(s) Regulating the m6A Methylation Regulator
Compound Name 5-FU Approved
Synonyms
5-Fluorouracil; 51-21-8; fluorouracil; 5-FU; Fluoroplex; Adrucil; Efudex; Carac; Fluracil; Fluoroblastin; 5-fluoropyrimidine-2,4(1H,3H)-dione; Kecimeton; Timazin; Carzonal; Efudix; Arumel; Fluril; Queroplex; Fluracilum; Ulup; 5-Fluoracil; Phthoruracil; Fluro Uracil; 5-Fluoro-2,4(1H,3H)-pyrimidinedione; Ftoruracil; Fluorouracilum; Efurix; Fluri; 5 Fluorouracil; Effluderm (free base); 5-fluoro-1H-pyrimidine-2,4-dione; Fluorouracilo; Fluroblastin; Phtoruracil; 2,4-Dihydroxy-5-fluoropyrimidine; 2,4(1H,3H)-Pyrimidinedione, 5-fluoro-; Adrucil; Effluderm; Fluorouracile; Fluoruracil; Fluracedyl; Flurodex; Neofluor; Onkofluor; Ribofluor; Tetratogen; URF; Allergan Brand of Fluorouracil; Biosyn Brand of Fluorouracil; CSP Brand of Fluorouracil; Cinco FU; Dakota Brand of Fluorouracil; Dermatech Brand of Fluorouracil; Dermik Brandof Fluorouracil; Ferrer Brand of Fluorouracil; Fluoro Uracile ICN; Fluorouracil GRY; Fluorouracil Mononitrate; Fluorouracil Monopotassium Salt; Fluorouracil Monosodium Salt; Fluorouracil Potassium Salt; Fluorouracil Teva Brand; Fluorouracile Dakota; Fluorouracile [DCIT]; Fluorouracilo Ferrer Far; Gry Brand of Fluorouracil; Haemato Brand of Fluorouracil; Haemato fu; Hexal Brand of Fluorouracil; ICN Brand of Fluorouracil; Inhibits thymilidate synthetase; Medac Brand of Fluorouracil; Neocorp Brand of Fluorouracil; Onkoworks Brand of Fluorouracil; Ribosepharm Brand of Fluorouracil; Riemser Brand of Fluorouracil; Roche Brand of Fluorouracil; Teva Brand of Fluorouracil; F 6627; F0151; IN1335; U 8953; Adrucil (TN); Carac (TN); Dakota, Fluorouracile; Efudex (TN); Fluoro-Uracile ICN; Fluoro-uracile; Fluoro-uracilo; Fluoroplex (TN); Fluorouracil-GRY; Fluorouracilo [INN-Spanish]; Fluorouracilum [INN-Latin]; Haemato-fu; Ro 2-9757; U-8953; Ro-2-9757; Fluorouracil (JP15/USP/INN); Fluorouracil [USAN:INN:BAN:JAN]; 1-fluoro-1h-pyrimidine-2,4-dione; 2,4-Dioxo-5-fluoropryimidine; 2,4-Dioxo-5-fluoropyrimidine; 5 FU Lederle; 5 FU medac; 5 Fluorouracil biosyn; 5 HU Hexal; 5-FU (TN); 5-FU Lederle; 5-FU medac; 5-Faracil; 5-Fluor-2,4(1H,3H)-pyrimidindion; 5-Fluor-2,4(1H,3H)-pyrimidindion [Czech]; 5-Fluor-2,4-dihydroxypyrimidin; 5-Fluor-2,4-dihydroxypyrimidin [Czech]; 5-Fluor-2,4-pyrimidindiol; 5-Fluor-2,4-pyrimidindiol [Czech]; 5-Fluoracil [German]; 5-Fluoracyl; 5-Fluoro-2,4-pyrimidinedione; 5-Fluoropyrimidin-2,4-diol; 5-Fluoropyrimidine-2,4-dione; 5-Fluorouracil-biosyn; 5-Fluoruracil; 5-Fluoruracil [German]; 5-Ftouracyl; 5-HU Hexal; 5-fluoro uracil; 5FU
    Click to Show/Hide
External link
CID: 3385
TTD: D05LEO
DrugBank: DB00544
Description
KIAA1429 acts as an oncogenic factor inbreast cancer by regulating CDK1 in an N6-methyladenosine-independent manner.5'-fluorouracil was found to be very effective in reducing the expression of KIAA1429 andCDK1 in breast cancer.
 [1]
Compound Name . Investigative
References
Ref 1 KIAA1429 acts as an oncogenic factor in breast cancer by regulating CDK1 in an N6-methyladenosine-independent manner. Oncogene. 2019 Aug;38(33):6123-6141. doi: 10.1038/s41388-019-0861-z. Epub 2019 Jul 8.
Ref 2 VIRMA contributes to non-small cell lung cancer progression via N(6)-methyladenosine-dependent DAPK3 post-transcriptional modification. Cancer Lett. 2021 Dec 1;522:142-154. doi: 10.1016/j.canlet.2021.08.027. Epub 2021 Sep 11.
Ref 3 The component of the m(6)A writer complex VIRMA is implicated in aggressive tumor phenotype, DNA damage response and cisplatin resistance in germ cell tumors. J Exp Clin Cancer Res. 2021 Aug 25;40(1):268. doi: 10.1186/s13046-021-02072-9.
Ref 4 SMC1A regulated by KIAA1429 in m6A-independent manner promotes EMT progress in breast cancer. Mol Ther Nucleic Acids. 2021 Aug 19;27:133-146. doi: 10.1016/j.omtn.2021.08.009. eCollection 2022 Mar 8.
Ref 5 KIAA1429 regulates cell proliferation by targeting c-Jun messenger RNA directly in gastric cancer. J Cell Physiol. 2020 Oct;235(10):7420-7432. doi: 10.1002/jcp.29645. Epub 2020 Feb 13.
Ref 6 Identification of pathology-specific regulators of m(6)A RNA modification to optimize lung cancer management in the context of predictive, preventive, and personalized medicine. EPMA J. 2020 Jul 29;11(3):485-504. doi: 10.1007/s13167-020-00220-3. eCollection 2020 Sep.
Ref 7 KIAA1429 regulates the migration and invasion of hepatocellular carcinoma by altering m6A modification of ID2 mRNA. Onco Targets Ther. 2019 May 7;12:3421-3428. doi: 10.2147/OTT.S180954. eCollection 2019.
Ref 8 Expression and clinical prognostic value of m6A RNA methylation modification in breast cancer. Biomark Res. 2021 Apr 29;9(1):28. doi: 10.1186/s40364-021-00285-w.
Ref 9 N(6)-methyladenosine (m(6)A) methyltransferase KIAA1429 accelerates the gefitinib resistance of non-small-cell lung cancer. Cell Death Discov. 2021 May 17;7(1):108. doi: 10.1038/s41420-021-00488-y.
Ref 10 m(6)A methyltransferase KIAA1429 acts as an oncogenic factor in colorectal cancer by regulating SIRT1 in an m(6)A-dependent manner. Cell Death Discov. 2022 Feb 25;8(1):83. doi: 10.1038/s41420-022-00878-w.
Ref 11 Gene amplification-driven RNA methyltransferase KIAA1429 promotes tumorigenesis by regulating BTG2 via m6A-YTHDF2-dependent in lung adenocarcinoma. Cancer Commun (Lond). 2022 Jul;42(7):609-626. doi: 10.1002/cac2.12325. Epub 2022 Jun 21.
Ref 12 KIAA1429 contributes to liver cancer progression through N6-methyladenosine-dependent post-transcriptional modification of GATA3. Mol Cancer. 2019 Dec 19;18(1):186. doi: 10.1186/s12943-019-1106-z.
Ref 13 VIRMA-Dependent N6-Methyladenosine Modifications Regulate the Expression of Long Non-Coding RNAs CCAT1 and CCAT2 in Prostate Cancer. Cancers (Basel). 2020 Mar 25;12(4):771. doi: 10.3390/cancers12040771.
Ref 14 m(6) A transferase KIAA1429-stabilized LINC00958 accelerates gastric cancer aerobic glycolysis through targeting GLUT1. IUBMB Life. 2021 Nov;73(11):1325-1333. doi: 10.1002/iub.2545. Epub 2021 Aug 26.
Ref 15 KIAA1429 and ALKBH5 Oppositely Influence Aortic Dissection Progression via Regulating the Maturation of Pri-miR-143-3p in an m6A-Dependent Manner. Front Cell Dev Biol. 2021 Aug 19;9:668377. doi: 10.3389/fcell.2021.668377. eCollection 2021.
Ref 16 Circular RNA circDLC1 inhibits MMP1-mediated liver cancer progression via interaction with HuR. Theranostics. 2021 Jan 1;11(3):1396-1411. doi: 10.7150/thno.53227. eCollection 2021.
Ref 17 Gene Signature and Identification of Clinical Trait-Related m(6) A Regulators in Pancreatic Cancer. Front Genet. 2020 Jul 10;11:522. doi: 10.3389/fgene.2020.00522. eCollection 2020.
Ref 18 Identification and Characterization of Alcohol-related Hepatocellular Carcinoma Prognostic Subtypes based on an Integrative N6-methyladenosine methylation Model. Int J Biol Sci. 2021 Aug 14;17(13):3554-3572. doi: 10.7150/ijbs.62168. eCollection 2021.
Ref 19 m(6)A RNA modification and its writer/reader VIRMA/YTHDF3 in testicular germ cell tumors: a role in seminoma phenotype maintenance. J Transl Med. 2019 Mar 12;17(1):79. doi: 10.1186/s12967-019-1837-z.