m6A Regulator Information

General Information of the m6A Regulator (ID: REG00002)
Regulator Name ELAV-like protein 1 (ELAVL1)
Synonyms
Hu-antigen R; HuR; HUR
    Click to Show/Hide
Gene Name ELAVL1
Sequence
MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHS
LGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQK
DVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPIT
VKFAANPNQNKNVALLSQLYHSPARRFGGPVHHQAQRFRFSPMGVDHMSGLSGVNVPGNA
SSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAM
AIASLNGYRLGDKILQVSFKTNKSHK
    Click to Show/Hide
Family RRM elav family
Function
RNA-binding protein that binds to the 3'-UTR region of mRNAs and increases their stability. Involved in embryonic stem cells (ESCs) differentiation: preferentially binds mRNAs that are not methylated by N6-methyladenosine (m6A), stabilizing them, promoting ESCs differentiation (By similarity). Binds to poly-U elements and AU-rich elements (AREs) in the 3'-UTR of target mRNAs. Binds avidly to the AU-rich element in FOS and IL3/interleukin-3 mRNAs. In the case of the FOS AU-rich element, binds to a core element of 27 nucleotides that contain AUUUA, AUUUUA, and AUUUUUA motifs. Binds preferentially to the 5'-UUUU[AG]UUU-3' motif in vitro. With ZNF385A, binds the 3'-UTR of p53/TP53 mRNA to control their nuclear export induced by CDKN2A. Hence, may regulate p53/TP53 expression and mediate in part the CDKN2A anti-proliferative activity. May also bind with ZNF385A the CCNB1 mRNA (By similarity). Increases the stability of the leptin mRNA harboring an AU-rich element (ARE) in its 3' UTR.
    Click to Show/Hide
Gene ID 1994
Uniprot ID
ELAV1_HUMAN
Regulator Type WRITER ERASER READER
Mechanism Diagram Click to View the Original Diagram
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
ELAVL1 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Cyclin-dependent kinase 4 (CDK4)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Liver cancer [ICD-11: 2C12]
Target Regulation Up regulation
Developmentally-regulated GTP-binding protein 1 (DRG1)
 Target Gene 
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Osteosarcoma [ICD-11: 2B51]
Target Regulation Up regulation
Cell Process Cell cycle
Cell apoptosis
In-vitro Model
 143B Osteosarcoma Homo sapiens CVCL_2270
hFOB 1.19 Normal Homo sapiens CVCL_3708
MG-63 Osteosarcoma Homo sapiens CVCL_0426
SaOS-2 Osteosarcoma Homo sapiens CVCL_0548
U2OS Osteosarcoma Homo sapiens CVCL_0042
Response Summary ELAVL1 knockdown impaired the stability of DRG1 mRNA, thereby reducing both the mRNA and protein levels of Developmentally-regulated GTP-binding protein 1 (DRG1). In all, DRG1 exerted tumorigenic effects in osteosarcoma, and the up-regulation of DRG1 in OS was induced by METTL3 and ELAVL1 in an m6A-dependent manner.
DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
 Target Gene 
Acute ischemic stroke [ICD-11: 8B11]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Acute ischemic stroke [ICD-11: 8B11]
Target Regulation Up regulation
In-vitro Model
 PC12 Rat adrenal gland pheochromocytoma Rattus norvegicus CVCL_0481
In-vivo Model The left internal carotid artery of the rats was isolated. Then the ligation of middle cerebral artery was performed by a 4/0 surgical nylon monofilament to occlude the blood flow. 2 h later, we removed the filament to restore the blood reperfusion for 24 h. During the entire operation, they were kept at 37.0 ± 0.5 °C. The laser Doppler flowmetry (Transonic Systems, Ithaca, NY, USA) was applied to confirm the regional ischemia and reperfusion. Rats were decapitated after 24 h of reperfusion.
Hepatoma-derived growth factor (HDGF)
 Target Gene 
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Cell Process mRNA stability
Zinc finger E-box-binding homeobox 1 (ZEB1)
 Target Gene 
Triple-negative breast cancer [ICD-11: 2C6Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [5]
Responsed Disease Triple-negative breast cancer [ICD-11: 2C6Z]
In-vitro Model
 MDA-MB-453 Breast adenocarcinoma Homo sapiens CVCL_0418
MDA-MB-436 Invasive breast carcinoma of no special type Homo sapiens CVCL_0623
14-3-3 protein zeta/delta (YWHAZ)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
In-vitro Model
 MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
MKN28 Gastric tubular adenocarcinoma Homo sapiens CVCL_1416
MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
GES-1 Normal Homo sapiens CVCL_EQ22
Anoctamin-7 (ANO7)
 Target Gene 
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
In-vitro Model
 WPMY-1 Normal Homo sapiens CVCL_3814
LNCaP Prostate carcinoma Homo sapiens CVCL_0395
22Rv1 Prostate carcinoma Homo sapiens CVCL_1045
DU145 Prostate carcinoma Homo sapiens CVCL_0105
LNCaP C4-2B Prostate carcinoma Homo sapiens CVCL_4784
PC-3 Prostate carcinoma Homo sapiens CVCL_0035
LNCaP C4-2 Prostate carcinoma Homo sapiens CVCL_4782
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model Ten mice were randomly divided into two groups, and C4-2-pZXE-circDDIT4 or C4-2-pZXE-NC cell suspension was concentrated to 5 × 106 cells/100 μL PBS and then injected into the flanks of the nude mice. After 20 days, the mice were euthanized, and the xenograft tumors were harvested, weighed, and photographed.
Cysteine methyltransferase DNMT3A (DNMT3A)
 Target Gene 
Chronic obstructive pulmonary disease [ICD-11: CA22]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Chronic obstructive pulmonary disease [ICD-11: CA22]
Target Regulation Up regulation
In-vivo Model Male BALB/c mice (SJA Laboratory Animal Company, Hunan, China) with age of 6-8 weeks were used in this study to establish COPD model. Mice were housed in individually ventilated cages under a pathogen-free condition, with ad libitum access to food and water. Animal welfare was monitored daily, and all efforts were made to minimize suffering. All animal procedures were conducted in accordance with the guidelines for use of laboratory animals, with approval from the Institutional Animal Care and Use Committee at Jiangxi Provincial People's Hospital (The First Affiliated Hospital of Nanchang Medical College).
ZEB1 antisense RNA 1 (ZEB1-AS1)
 Target Gene 
Triple-negative breast cancer [ICD-11: 2C6Z]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [5]
Responsed Disease Triple-negative breast cancer [ICD-11: 2C6Z]
In-vitro Model
 MDA-MB-453 Breast adenocarcinoma Homo sapiens CVCL_0418
MDA-MB-436 Invasive breast carcinoma of no special type Homo sapiens CVCL_0623
Click to View Potential Drug Response of This Regulator
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
RNA modification
m6A Target: Hepatoma-derived growth factor (HDGF)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00073
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target Hepatoma-derived growth factor (HDGF)
Crosstalk relationship m5C → m6A
Disease Bladder cancer
 Disease Info 
Crosstalk ID: M6ACROT00074
 Crosstalk Info 
Epigenetic Regulator RNA cytosine C(5)-methyltransferase NSUN2 (NSUN2)
Regulated Target Hepatoma-derived growth factor (HDGF)
Crosstalk relationship m5C → m6A
Disease Bladder cancer
 Disease Info 
m6A Target: Cyclin-dependent kinase 6 (CDK6)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00455
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 149 (MIR149)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00456
 Crosstalk Info 
Epigenetic Regulator Methyltransferase-like protein 1 (METTL1)
Regulated Target MicroRNA 149 (MIR149)
Crosstalk relationship m7G → m6A
m6A Target: High mobility group protein HMGI-C (HMGA2)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00465
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 149 (MIR149)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00466
 Crosstalk Info 
Epigenetic Regulator Methyltransferase-like protein 1 (METTL1)
Regulated Target MicroRNA 149 (MIR149)
Crosstalk relationship m7G → m6A
m6A Target: NAD-dependent protein deacetylase sirtuin-1 (SIRT1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00478
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 155 (MIR155)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00517
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 221 (MIR221)
Crosstalk relationship A-to-I → m6A
m6A Target: Caspase-2 (CASP2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00480
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 155 (MIR155)
Crosstalk relationship A-to-I → m6A
m6A Target: Cyclin-dependent kinase inhibitor 1B (CDKN1B/p27)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00503
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 222 (MIR222)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00504
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 222 (MIR222)
Crosstalk relationship A-to-I → m6A
m6A Target: Cyclic-AMP-dependent transcription factor ATF-3 (ATF3)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT00505
 Crosstalk Info 
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target MicroRNA 222 (MIR222)
Crosstalk relationship A-to-I → m6A
Crosstalk ID: M6ACROT00506
 Crosstalk Info 
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target MicroRNA 222 (MIR222)
Crosstalk relationship A-to-I → m6A
m6A Target: ZEB1 antisense RNA 1 (ZEB1-AS1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00551
 Crosstalk Info 
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target MicroRNA 205 (MIR205)
Crosstalk relationship m6A → m5C
DNA modification
m6A Target: Cysteine methyltransferase DNMT3A (DNMT3A)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02070
 Crosstalk Info 
Epigenetic Regulator Cysteine methyltransferase DNMT3A (DNMT3A)
Regulated Target Dachshund family transcription factor 1 (DACH1)
Crosstalk relationship m6A → DNA modification
Disease Chronic obstructive pulmonary disease
 Disease Info 
m6A Target: DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT02072
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Crosstalk relationship m6A → DNA modification
Drug Cisplatin
 Drug Info 
Crosstalk ID: M6ACROT02073
 Crosstalk Info 
Epigenetic Regulator DNA (cytosine-5)-methyltransferase 3B (DNMT3B)
Regulated Target Serine/threonine-protein kinase PINK1, mitochondrial (PINK1)
Crosstalk relationship m6A → DNA modification
Disease Acute ischemic stroke
 Disease Info 
Non-coding RNA
m6A Target: 14-3-3 protein zeta/delta (YWHAZ)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05002
 Crosstalk Info 
Epigenetic Regulator Small nucleolar RNA host gene 12 (SNHG12)
Regulated Target ELAV-like protein 1 (HuR/ELAVL1)
Crosstalk relationship ncRNA → m6A
Disease Gastric cancer
 Disease Info 
m6A Target: Cyclin-dependent kinase 4 (CDK4)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05003
 Crosstalk Info 
Epigenetic Regulator VPS9D1 antisense RNA 1 (VPS9D1-AS1)
Regulated Target ELAV-like protein 1 (HuR/ELAVL1)
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
 Disease Info 
m6A Target: Zinc finger E-box-binding homeobox 1 (ZEB1)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05023
 Crosstalk Info 
Epigenetic Regulator ZEB1 antisense RNA 1 (ZEB1-AS1)
Regulated Target ELAV-like protein 1 (HuR/ELAVL1)
Crosstalk relationship ncRNA → m6A
Disease Triple-negative breast cancer
 Disease Info 
Crosstalk ID: M6ACROT05887
 Crosstalk Info 
Epigenetic Regulator ZEB1 antisense RNA 1 (ZEB1-AS1)
Regulated Target ELAV-like protein 1 (HuR/ELAVL1)
Crosstalk relationship m6A → ncRNA
Disease Triple-negative breast cancer
 Disease Info 
m6A Target: Anoctamin-7 (ANO7)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05078
 Crosstalk Info 
Epigenetic Regulator Circ_DDIT4
Regulated Target ELAV-like protein 1 (HuR/ELAVL1)
Crosstalk relationship ncRNA → m6A
Disease Prostate cancer
 Disease Info 
m6A Target: Long intergenic non-protein coding RNA 336 (LINC00336)
 Target Gene 
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05785
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 336 (LINC00336)
Regulated Target MicroRNA 6852 (MIR6852)
Crosstalk relationship m6A → ncRNA
Disease Lung cancer
 Disease Info 
Crosstalk ID: M6ACROT05890
 Crosstalk Info 
Epigenetic Regulator MicroRNA 6852 (MIR6852)
Regulated Target Cystathionine beta-synthase (CBS)
Crosstalk relationship m6A → ncRNA
Disease Lung cancer
 Disease Info 
m6A Target: Alpha-(1,3)-fucosyltransferase 4 (FUT4)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05888
 Crosstalk Info 
Epigenetic Regulator HOXB cluster antisense RNA 1 (HOXB-AS1)
Regulated Target ELAV-like protein 1 (HuR/ELAVL1)
Crosstalk relationship ncRNA → m6A
Disease Multiple myeloma
 Disease Info 
Xenobiotics Compound(s) Regulating the m6A Methylation Regulator
Compound Name 1-(Benzenesulfonyl)-3-phenylindole-4,5-dione Investigative
Synonyms
CHEMBL4075458; SCHEMBL19737490; BDBM50270003
    Click to Show/Hide
External link
CID: 132251303
Activity
Ki = 12.8 nM
 [9]
Compound Name 1-(Benzenesulfonyl)-7-(4-methoxyphenyl)sulfanyl-3-phenylindole-4,5-dione Investigative
Synonyms
CHEMBL4064932; BDBM50269995
    Click to Show/Hide
External link
CID: 137635149
Activity
Ki = 15 nM
 [9]
Compound Name 1-(Benzenesulfonyl)-7-(4-methoxyphenyl)-3-phenylindole-4,5-dione Investigative
Synonyms
CHEMBL4095060; SCHEMBL22130724; BDBM50269992
    Click to Show/Hide
External link
CID: 137652621
Activity
Ki = 41 nM
 [9]
Compound Name 1-(4-Fluorophenyl)sulfonyl-3-phenylindole-4,5-dione Investigative
Synonyms
CHEMBL4100171; SCHEMBL21222486; BDBM50269999
    Click to Show/Hide
External link
CID: 137659568
Activity
Ki = 48 nM
 [9]
Compound Name Dihydrotanshinone I Investigative
Synonyms
Dihydrotanshinone I; 87205-99-0; 15,16-dihydrotanshinone I; UNII-562G9360V6; (-)-Dihydrotanshinone I; (1R)-1,6-dimethyl-1,2-dihydronaphtho[1,2-g][1]benzofuran-10,11-dione; DIHYDROTANSHINONE; 562G9360V6; DihydrotanshinoneI; Dihydrotanshinone-I; Tanshinone I, dihydro-; SR-05000002191; HSDB 8105; DHTS; 4m0e; CHEMBL227075; SCHEMBL13049977; DTXSID20236187; CHEBI:149872; HY-N0360; ZINC2585546; BDBM50423877; MFCD28016070; s9020; AKOS032962078; CCG-208567; Dihydrotanshinone I, >=98% (HPLC); NCGC00163651-01; NCGC00163651-06; D5379; N1844; A862726; SR-05000002191-2; SR-05000002191-3; Q21099654; (1R)-1,6-dimethyl-1,2-dihydrophenanthro[1,2-b]furan-10,11-dione; (R)-1,6-dimethyl-1,2-dihydrophenanthro[1,2-b]furan-10,11-dione; (-)-1,2-Dihydro-1,6-dimethylphenanthro[1,2-b]furan-10,11-dione;1,6-Dimethyl-1,2,10,11-tetrahydrophenanthro[1,2-b]furan-10,11-dione;4,17-Dimethyl-15-oxagona-1,3,5(10),6,8,13-hexene-11,12-dione;15,16-Dihydrotanshine I;1,6-DiMethyl-1,2-dihydrophenanthro[1,2-b]furan-10,11-dione
    Click to Show/Hide
External link
CID: 11425923
Activity
Ki = 50 nM
 [9]
Compound Name 1-(Benzenesulfonyl)-7-(3-methoxyphenyl)-3-phenylindole-4,5-dione Investigative
Synonyms
CHEMBL4105230; BDBM50269991
    Click to Show/Hide
External link
CID: 137657529
Activity
Ki = 55 nM
 [9]
Compound Name 1-Methylsulfonyl-3-phenylindole-4,5-dione Investigative
Synonyms
CHEMBL4073526; SCHEMBL19737481; BDBM50270012
    Click to Show/Hide
External link
CID: 132251294
Activity
Ki = 56 nM
 [9]
Compound Name N-[4-(4,5-dioxo-3-phenylindol-1-yl)sulfonylphenyl]acetamide Investigative
Synonyms
CHEMBL4094161; SCHEMBL22130699; BDBM50269996
    Click to Show/Hide
External link
CID: 137655418
Activity
Ki = 81 nM
 [9]
Compound Name 1-(3-Nitrophenyl)sulfonyl-3-phenylindole-4,5-dione Investigative
Synonyms
CHEMBL4081086; SCHEMBL19737379; BDBM50270013
    Click to Show/Hide
External link
CID: 132251198
Activity
Ki > 100 nM
 [9]
Compound Name 1-(Benzenesulfonyl)-7-(4-nitrophenyl)-3-phenylindole-4,5-dione Investigative
Synonyms
CHEMBL4067653; BDBM50270007
    Click to Show/Hide
External link
CID: 137633625
Activity
Ki > 100 nM
 [9]
Compound Name 1-(3-Fluorophenyl)sulfonyl-3-phenylindole-4,5-dione Investigative
Synonyms
CHEMBL4092808; SCHEMBL19737426; BDBM50269997
    Click to Show/Hide
External link
CID: 132251245
Activity
Ki > 100 nM
 [9]
Compound Name 1-(Benzenesulfonyl)-3-[4-(dimethylamino)phenyl]indole-4,5-dione Investigative
Synonyms
CHEMBL4076484; SCHEMBL19737562; BDBM50270014
    Click to Show/Hide
External link
CID: 132251374
Activity
Ki > 100 nM
 [9]
Compound Name 1-(Benzenesulfonyl)-3,7-diphenylindole-4,5-dione Investigative
Synonyms
CHEMBL4102819; SCHEMBL21222570; BDBM50269994
    Click to Show/Hide
External link
CID: 137657577
Activity
Ki > 100 nM
 [9]
Compound Name 1-(Benzenesulfonyl)-7-methyl-3-phenylindole-4,5-dione Investigative
Synonyms
CHEMBL4070465; SCHEMBL22130661; BDBM50269990
    Click to Show/Hide
External link
CID: 137638771
Activity
Ki > 200 nM
 [9]
Compound Name 1-(Benzenesulfonyl)-3-(3-methoxyphenyl)indole-4,5-dione Investigative
Synonyms
CHEMBL4075620; SCHEMBL19737487; BDBM50270001
    Click to Show/Hide
External link
CID: 132251300
Activity
Ki > 200 nM
 [9]
Compound Name 1-(Benzenesulfonyl)-3-(4-methoxyphenyl)indole-4,5-dione Investigative
Synonyms
CHEMBL4077265; SCHEMBL19737482; BDBM50270002
    Click to Show/Hide
External link
CID: 132251295
Activity
Ki > 200 nM
 [9]
Compound Name 4-(Benzenesulfonyl)-6-phenyl-4-azatetracyclo[9.2.2.02,10.03,7]pentadeca-2(10),3(7),5,12-tetraene-8,9-dione Investigative
Synonyms
CHEMBL4073683; SCHEMBL19737542; BDBM50270004
    Click to Show/Hide
External link
CID: 132251354
Activity
Ki > 300 nM
 [9]
Compound Name CMLD-2 Investigative
Synonyms
958843-91-9; 5,7-dimethoxy-8-(1-(4-methoxyphenyl)-3-oxo-3-(pyrrolidin-1-yl)propyl)-4-phenyl-2H-chromen-2-one; CMLD-2; MLS000879470; SMR000465530; 5,7-dimethoxy-8-[1-(4-methoxyphenyl)-3-oxo-3-pyrrolidin-1-ylpropyl]-4-phenylchromen-2-one; KUC101379N; 5,7-dimethoxy-8-[1-(4-methoxyphenyl)-3-oxo-3-(pyrrolidin-1-yl)propyl]-4-phenyl-2H-chromen-2-one; CHEMBL1499653; SCHEMBL20928323; BDBM50746; cid_16746438; HMS2210J15; AKOS037647737; NCGC00166452-01; AS-74611; HY-124828; CS-0087821; W15560; 8-[3-keto-1-(4-methoxyphenyl)-3-pyrrolidino-propyl]-5,7-dimethoxy-4-phenyl-coumarin; 5,7-dimethoxy-8-[1-(4-methoxyphenyl)-3-oxidanylidene-3-pyrrolidin-1-yl-propyl]-4-phenyl-chromen-2-one; 5,7-dimethoxy-8-[1-(4-methoxyphenyl)-3-oxo-3-(1-pyrrolidinyl)propyl]-4-phenyl-1-benzopyran-2-one
    Click to Show/Hide
External link
CID: 16746438
Activity
Ki = 350 nM
 [10]
Compound Name 2-Amino-6-[2-(3,4-dihydroxyphenyl)-2-oxoethyl]sulfanyl-4-[4-(phenoxymethyl)phenyl]pyridine-3,5-dicarbonitrile Investigative
Synonyms
CHEMBL4061748
    Click to Show/Hide
External link
CID: 137637060
Activity
IC50 = 380 nM
 [10]
Compound Name 3-(5,7-dimethoxy-2-oxo-4-phenylchromen-8-yl)-N,N-diethyl-3-(4-methoxyphenyl)propanamide Investigative
Synonyms
CHEMBL1522581; NCGC00166661-01
    Click to Show/Hide
External link
CID: 24868003
Activity
Ki = 570 nM
 [10]
Compound Name 3-(5,7-dimethoxy-2-oxo-4-phenylchromen-8-yl)-N,N-diethyl-3-(3,4,5-trimethoxyphenyl)propanamide Investigative
Synonyms
MLS000879482; SMR000465537; KUC101391N; CHEMBL1330249; SCHEMBL20928107; BDBM50745; cid_16746297; HMS2220E05; HMS3331O06; NCGC00166568-01; 3-(5,7-dimethoxy-2-oxidanylidene-4-phenyl-chromen-8-yl)-N,N-diethyl-3-(3,4,5-trimethoxyphenyl)propanamide; 3-(5,7-dimethoxy-2-oxo-4-phenyl-1-benzopyran-8-yl)-N,N-diethyl-3-(3,4,5-trimethoxyphenyl)propanamide; 3-(5,7-dimethoxy-2-oxo-4-phenylchromen-8-yl)-N,N-diethyl-3-(3,4,5-trimethoxyphenyl)propanamide; N,N-diethyl-3-(2-keto-5,7-dimethoxy-4-phenyl-chromen-8-yl)-3-(3,4,5-trimethoxyphenyl)propionamide
    Click to Show/Hide
External link
CID: 16746297
Activity
Ki = 590 nM
 [10]
Compound Name 8-[3-Keto-1-(4-methoxyphenyl)-3-morpholino-propyl]-5,7-dimethoxy-4-phenyl-coumarin Investigative
Synonyms
MLS000879474; SMR000465528; KUC101375N; CHEMBL1390568; BDBM51309; cid_16746461; HMS2212O19; HMS3348C12; NCGC00166769-01; 5,7-dimethoxy-8-[1-(4-methoxyphenyl)-3-morpholin-4-yl-3-oxopropyl]-4-phenylchromen-2-one; 8-[3-keto-1-(4-methoxyphenyl)-3-morpholino-propyl]-5,7-dimethoxy-4-phenyl-coumarin; 5,7-dimethoxy-8-[1-(4-methoxyphenyl)-3-(4-morpholinyl)-3-oxopropyl]-4-phenyl-1-benzopyran-2-one; 5,7-dimethoxy-8-[1-(4-methoxyphenyl)-3-morpholin-4-yl-3-oxidanylidene-propyl]-4-phenyl-chromen-2-one
    Click to Show/Hide
External link
CID: 16746461
Activity
Ki = 800 nM
 [10]
References
Ref 1 Clinical pipeline report, company report or official report of Regeneron Pharmaceuticals.
Ref 2 m6A-dependent up-regulation of DRG1 by METTL3 and ELAVL1 promotes growth, migration, and colony formation in osteosarcoma. Biosci Rep. 2020 Apr 30;40(4):BSR20200282. doi: 10.1042/BSR20200282.
Ref 3 Antidiabetic and hypolipidemic effects of a novel dual peroxisome proliferator-activated receptor (PPAR) alpha/gamma agonist, E3030, in db/db mice and beagle dogs. J Pharmacol Sci. 2008 Sep;108(1):40-8. doi: 10.1254/jphs.fp0072346. Epub 2008 Sep 6.
Ref 4 FDA Approved Drug Products from FDA Official Website. 2004. Application Number: (ANDA) 125085.
Ref 5 2011 Pipeline of Santaris Pharma.
Ref 6 First-in-human phase I study of BPI-9016M, a dual MET/Axl inhibitor, in patients with non-small cell lung cancer. J Hematol Oncol. 2020 Jan 16;13(1):6. doi: 10.1186/s13045-019-0834-2.
Ref 7 MK-2461, a novel multitargeted kinase inhibitor, preferentially inhibits the activated c-Met receptor. Cancer Res. 2010 Feb 15;70(4):1524-33. doi: 10.1158/0008-5472.CAN-09-2541. Epub 2010 Feb 9.
Ref 8 Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics. 2005 Aug;86(2):127-41. doi: 10.1016/j.ygeno.2005.04.008.
Ref 9 Interfering with HuR-RNA Interaction: Design, Synthesis and Biological Characterization of Tanshinone Mimics as Novel, Effective HuR Inhibitors. J Med Chem. 2018 Feb 22;61(4):1483-1498. doi: 10.1021/acs.jmedchem.7b01176. Epub 2018 Jan 31.
Ref 10 Compounds Interfering with Embryonic Lethal Abnormal Vision (ELAV) Protein-RNA Complexes: An Avenue for Discovering New Drugs. J Med Chem. 2017 Oct 26;60(20):8257-8267. doi: 10.1021/acs.jmedchem.6b01871. Epub 2017 Jun 19.