General Information of the m6A Regulator (ID: REG00003)
Regulator Name Heterogeneous nuclear ribonucleoproteins C1/C2 (HNRNPC)
Synonyms
hnRNP C1/C2; HNRPC
    Click to Show/Hide
Gene Name HNRNPC
Sequence
MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNE
RNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSS
SFDLDYDFQRDYYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQR
GSSKSGKLKGDDLQAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSS
SVKKDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSA
NGEDDS
    Click to Show/Hide
Family RRM HNRPC family; RALY subfamily
Function
Binds pre-mRNA and nucleates the assembly of 40S hnRNP particles. Interacts with poly-U tracts in the 3'-UTR or 5'-UTR of mRNA and modulates the stability and the level of translation of bound mRNA molecules . Single HNRNPC tetramers bind 230-240 nucleotides. Trimers of HNRNPC tetramers bind 700 nucleotides. May play a role in the early steps of spliceosome assembly and pre-mRNA splicing. N6-methyladenosine (m6A) has been shown to alter the local structure in mRNAs and long non-coding RNAs (lncRNAs) via a mechanism named 'm(6)A-switch', facilitating binding of HNRNPC, leading to regulation of mRNA splicing.
    Click to Show/Hide
Gene ID 3183
Uniprot ID
HNRPC_HUMAN
Regulator Type WRITER ERASER READER
Mechanism Diagram Click to View the Original Diagram
Target Genes Click to View Potential Target Genes of This Regulator
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
HNRNPC can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Browse Target Gene related Drug
Galectin-9 (LGALS9)
Representative RNA-seq result indicating the expression of this target gene regulated by HNRNPC
Cell Line MG63 cell line Homo sapiens
Treatment: HNRNPC knockdown MG63 cells
Control: Wild type MG63 cells
GSE63086
Regulation
logFC: -2.10E+00
p-value: 1.66E-04
More Results Click to View More RNA-seq Results
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
In-vitro Model
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
Response Summary HNRNPA2B1 and HNRNPC were extensively expressed in the Glioblastoma multiforme(GBM) microenvironment. m6A regulators promoted the stemness state in GBM cancer cells. Cell communication analysis identified genes in the GALECTIN signaling network in GBM samples, and expression of these genes (Galectin-9 (LGALS9), CD44, CD45, and HAVCR2) correlated with that of m6A regulators.
Superoxide dismutase [Mn], mitochondrial (SOD2)
Representative RNA-seq result indicating the expression of this target gene regulated by HNRNPC
Cell Line MG63 cell line Homo sapiens
Treatment: HNRNPC knockdown MG63 cells
Control: Wild type MG63 cells
GSE63086
Regulation
logFC: -1.14E+00
p-value: 6.60E-05
More Results Click to View More RNA-seq Results
Bladder cancer [ICD-11: 2C94]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Bladder cancer [ICD-11: 2C94]
Target Regulation Up regulation
Cell Process Cell apoptosis
Cell proliferation
Cell migration
Cell invasion
In-vitro Model
EJ (Human bladder cancer cells)
J82 Bladder carcinoma Homo sapiens CVCL_0359
Response Summary SNP rs5746136 affects m6A modification and regulate Superoxide dismutase [Mn], mitochondrial (SOD2) expression by guiding the binding of hnRNPC to SOD2, which played a critical tumor suppressor role in bladder cancer cells by promoting cell apoptosis and inhibiting proliferation, migration and invasion.
Adenylate kinase 4, mitochondrial (AK4)
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Target Regulation Up regulation
In-vitro Model
CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
SCC-4 Tongue squamous cell carcinoma Homo sapiens CVCL_1684
UM-SCC-1 Floor of mouth squamous cell carcinoma Homo sapiens CVCL_7707
SCC-9 Tongue squamous cell carcinoma Homo sapiens CVCL_1685
NHOK (Normal oral keratinocytes)
CD44 antigen (CD44)
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
In-vitro Model
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
Response Summary HNRNPA2B1 and HNRNPC were extensively expressed in the Glioblastoma multiforme(GBM) microenvironment. m6A regulators promoted the stemness state in GBM cancer cells. Cell communication analysis identified genes in the GALECTIN signaling network in GBM samples, and expression of these genes (LGALS9, CD44 antigen (CD44), CD45, and HAVCR2) correlated with that of m6A regulators.
Hepatitis A virus cellular receptor 2 (HAVCR2)
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
In-vitro Model
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
Response Summary HNRNPA2B1 and HNRNPC were extensively expressed in the Glioblastoma multiforme(GBM) microenvironment. m6A regulators promoted the stemness state in GBM cancer cells. Cell communication analysis identified genes in the GALECTIN signaling network in GBM samples, and expression of these genes (LGALS9, CD44, CD45, and Hepatitis A virus cellular receptor 2 (HAVCR2)) correlated with that of m6A regulators.
Interferon beta (IFNB1)
Parkinson disease [ICD-11: 8A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Parkinson disease [ICD-11: 8A00]
Target Regulation Down regulation
Cell Process Immune inflammation
Cell apoptosis
In-vitro Model
PC12 Rat adrenal gland pheochromocytoma Rattus norvegicus CVCL_0481
Response Summary Overexpression of HNRNPC can promote the proliferation of PC12 cells, inhibit their apoptosis, and inhibit the expression of inflammatory factors Interferon beta (IFNB1), IL-6, and TNF-Alpha, suggesting that HNRNPC can cause PD by inhibiting the proliferation of dopaminergic nerve cells, promoting their apoptosis, and causing immune inflammation.
Receptor-type tyrosine-protein phosphatase C (CD45)
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
In-vitro Model
U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
Response Summary HNRNPA2B1 and HNRNPC were extensively expressed in the Glioblastoma multiforme(GBM) microenvironment. m6A regulators promoted the stemness state in GBM cancer cells. Cell communication analysis identified genes in the GALECTIN signaling network in GBM samples, and expression of these genes (LGALS9, CD44, Receptor-type tyrosine-protein phosphatase C (CD45), and HAVCR2) correlated with that of m6A regulators.
Transcription factor AP-2-alpha (TFAP2A)
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [5]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
In-vitro Model
EO771 Malignant neoplasms of the mouse mammary gland Mus musculus CVCL_GR23
EMT6 Malignant neoplasms of the mouse mammary gland Mus musculus CVCL_1923
4T1.2 Malignant neoplasms of the mouse mammary gland Mus musculus CVCL_GR32
NMuMG
N.A. Mus musculus CVCL_0075
microRNA 186 (MIR186)
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Esophageal cancer [ICD-11: 2B70]
In-vitro Model
HEEC cell line (Normal esophageal epithelial cell line)
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
TE-1 Esophageal squamous cell carcinoma Homo sapiens CVCL_1759
Response Summary HNRNPC, YTHDF, ZC3H13, YTHDC2, and METTL14 were dysregulated in esophageal cancer tissues. miR-186 interacted with HNRNPC and suppressed the expression of HNRNPC. Four miRNAs (microRNA 186 (MIR186), miR-320c, miR-320d, and miR-320b) were used to construct a prognostic signature, which could serve as a prognostic predictor independent from routine clinicopathological features.
hsa-miR-183-3p
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
Target Regulation Down regulation
In-vitro Model
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
CFPAC-1 Cystic fibrosis Homo sapiens CVCL_1119
Response Summary Rs7495 in 3'UTR of hnRNPC was associated with pancreatic ductal adenocarcinoma susceptibility in a Chinese population. The rs7495, in the hnRNPC 3'UTR, might disrupt a binding site for hsa-miR-183-3p, thus increasing the expression of hnRNPC and promoting the proliferation of PDAC cells.
hsa-miR-320b
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Esophageal cancer [ICD-11: 2B70]
In-vitro Model
HEEC cell line (Normal esophageal epithelial cell line)
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
TE-1 Esophageal squamous cell carcinoma Homo sapiens CVCL_1759
Response Summary HNRNPC, YTHDF, ZC3H13, YTHDC2, and METTL14 were dysregulated in esophageal cancer tissues. miR-186 interacted with HNRNPC and suppressed the expression of HNRNPC. Four miRNAs (miR-186, miR-320c, miR-320d, and hsa-miR-320b) were used to construct a prognostic signature, which could serve as a prognostic predictor independent from routine clinicopathological features.
hsa-miR-320c
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Esophageal cancer [ICD-11: 2B70]
In-vitro Model
HEEC cell line (Normal esophageal epithelial cell line)
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
TE-1 Esophageal squamous cell carcinoma Homo sapiens CVCL_1759
Response Summary HNRNPC, YTHDF, ZC3H13, YTHDC2, and METTL14 were dysregulated in esophageal cancer tissues. miR-186 interacted with HNRNPC and suppressed the expression of HNRNPC. Four miRNAs (miR-186, hsa-miR-320c, miR-320d, and miR-320b) were used to construct a prognostic signature, which could serve as a prognostic predictor independent from routine clinicopathological features.
hsa-miR-320d
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Esophageal cancer [ICD-11: 2B70]
In-vitro Model
HEEC cell line (Normal esophageal epithelial cell line)
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
TE-1 Esophageal squamous cell carcinoma Homo sapiens CVCL_1759
Response Summary HNRNPC, YTHDF, ZC3H13, YTHDC2, and METTL14 were dysregulated in esophageal cancer tissues. miR-186 interacted with HNRNPC and suppressed the expression of HNRNPC. Four miRNAs (miR-186, miR-320c, hsa-miR-320d, and miR-320b) were used to construct a prognostic signature, which could serve as a prognostic predictor independent from routine clinicopathological features.
Disks large-associated protein 5 (DLGAP5)
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Non-small cell lung cancer [ICD-11: 2C25.Y]
In-vitro Model
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
In-vivo Model In the xenograft tumor model in the nude mice, 5 × 106 A549 cells were mixed with 40 μg serum-EVs-oe-NC or serum-EVs-oe-HNRNPC, respectively, and then inoculated subcutaneously in the left armpit of BALB/c nude mice. / In the tumor metastasis model in nude mice, 1 × 106 A549 cells were injected into BALB/c nude mice via the tail vein. The nude mice were randomly treated with serum-EVs-oe-NC or serum-EVs-oe-HNRNPC; 20 mg EVs were injected via the tail vein once a week for 4 weeks.
Growth factor receptor-bound protein 2 (GRB2)
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Lung cancer [ICD-11: 2C25]
In-vitro Model
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
Methylosome protein WDR77 (WDR77)
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease Breast cancer [ICD-11: 2C60]
In-vitro Model
MCF-10A Normal Homo sapiens CVCL_0598
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
T-47D Invasive breast carcinoma Homo sapiens CVCL_0553
SK-BR-3 Breast adenocarcinoma Homo sapiens CVCL_0033
HCC1937 Breast ductal carcinoma Homo sapiens CVCL_0290
BT-549 Invasive breast carcinoma Homo sapiens CVCL_1092
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
Nucleosome assembly protein 1-like 2 (NAP1L2)
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Target Regulation Up regulation
In-vitro Model
22Rv1 Prostate carcinoma Homo sapiens CVCL_1045
HNC PC3 Retromolar trigone squamous cell carcinoma Homo sapiens CVCL_C8XA
LNCaP C4-2B Prostate carcinoma Homo sapiens CVCL_4784
VCaP Prostate carcinoma Homo sapiens CVCL_2235
DU145 Prostate carcinoma Homo sapiens CVCL_0105
RWPE-1 Normal Homo sapiens CVCL_3791
Unspecific Target Gene
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Responsed Drug Gemcitabine Approved
Pathway Response Adipocytokine signaling pathway hsa04920
Cell Process Epithelial-mesenchymal transition
In-vitro Model
BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
HDE-CT cell line (A normal human pancreatic cell line)
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response Summary Lasso regression identified a six-m6A-regulator-signature prognostic model (KIAA1429, HNRNPC, METTL3, YTHDF1, IGF2BP2, and IGF2BP3). Gene set enrichment analysis revealed m6A regulators (KIAA1429, HNRNPC, and IGF2BP2) were related to multiple biological behaviors in pancreatic cancer, including adipocytokine signaling, the well vs. poorly differentiated tumor pathway, tumor metastasis pathway, epithelial mesenchymal transition pathway, gemcitabine resistance pathway, and stemness pathway.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [13]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Response Summary High HNRNPC expression is significantly related to poor overall survival in patients with LUAD, suggesting that HNRNPC is a cancer-promoting factor and a potential prognostic biomarker in LUAD.
Unspecific Target Gene
Gemcitabine [Approved]
In total 1 item(s) under this drug
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [12]
Responsed Disease Pancreatic cancer ICD-11: 2C10
Pathway Response Adipocytokine signaling pathway hsa04920
Cell Process Epithelial-mesenchymal transition
In-vitro Model BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
HDE-CT cell line (A normal human pancreatic cell line)
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response Summary Lasso regression identified a six-m6A-regulator-signature prognostic model (KIAA1429, HNRNPC, METTL3, YTHDF1, IGF2BP2, and IGF2BP3). Gene set enrichment analysis revealed m6A regulators (KIAA1429, HNRNPC, and IGF2BP2) were related to multiple biological behaviors in pancreatic cancer, including adipocytokine signaling, the well vs. poorly differentiated tumor pathway, tumor metastasis pathway, epithelial mesenchymal transition pathway, gemcitabine resistance pathway, and stemness pathway.
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
RNA modification
m6A Target: microRNA 21 (MIR21)
In total 7 item(s) under this m6A target
Crosstalk ID: M6ACROT00589
Epigenetic Regulator Interferon-inducible protein 4 (ADAR1)
Regulated Target Protein sprouty homolog 2 (SPRY2)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00591
Epigenetic Regulator Double-stranded RNA-specific editase 1 (ADARB1)
Regulated Target Protein sprouty homolog 2 (SPRY2)
Crosstalk relationship m6A → A-to-I
Crosstalk ID: M6ACROT00593
Epigenetic Regulator Y-box-binding protein 1 (YBX1)
Regulated Target Growth arrest specific 5 (GAS5)
Crosstalk relationship m5C → m6A
Crosstalk ID: M6ACROT00595
Epigenetic Regulator Putative methyltransferase NSUN7 (NSUN7)
Regulated Target Phosphofructokinase, muscle (PFKM)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00597
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00599
Epigenetic Regulator Methylcytosine dioxygenase TET2 (TET2)
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → m5C
Crosstalk ID: M6ACROT00601
Epigenetic Regulator Methylcytosine dioxygenase TET3 (TET3)
Regulated Target Mutated in multiple advanced cancers 1 (PTEN)
Crosstalk relationship m6A → m5C
Non-coding RNA
m6A Target: Adenylate kinase 4, mitochondrial (AK4)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05010
Epigenetic Regulator Long intergenic non-protein coding RNA 662 (LINC00662)
Regulated Target Heterogeneous nuclear ribonucleoprotein C (HNRNPC)
Crosstalk relationship ncRNA → m6A
Disease Oral squamous cell carcinoma
m6A Target: Transcription factor AP-2-alpha (TFAP2A)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05074
Epigenetic Regulator hsa-miR-944
Regulated Target Heterogeneous nuclear ribonucleoprotein C (HNRNPC)
Crosstalk relationship ncRNA → m6A
Disease Breast cancer
Crosstalk ID: M6ACROT05076
Epigenetic Regulator Circ_BACH2
Regulated Target hsa-miR-944
Crosstalk relationship ncRNA → m6A
Disease Breast cancer
m6A Target: Methylosome protein WDR77 (WDR77)
In total 2 item(s) under this m6A target
Crosstalk ID: M6ACROT05075
Epigenetic Regulator hsa-miR-944
Regulated Target Heterogeneous nuclear ribonucleoprotein C (HNRNPC)
Crosstalk relationship ncRNA → m6A
Disease Breast cancer
Crosstalk ID: M6ACROT05077
Epigenetic Regulator Circ_BACH2
Regulated Target hsa-miR-944
Crosstalk relationship ncRNA → m6A
Disease Breast cancer
m6A Target: Nucleosome assembly protein 1-like 2 (NAP1L2)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05102
Epigenetic Regulator Nucleosome assembly protein 1 like 6, pseudogene (NAP1L6P)
Regulated Target Heterogeneous nuclear ribonucleoprotein C (HNRNPC)
Crosstalk relationship ncRNA → m6A
Disease Prostate cancer
m6A Target: Growth factor receptor-bound protein 2 (GRB2)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05365
Epigenetic Regulator Long intergenic non-protein coding RNA 1705 (LINC01705)
Regulated Target Heterogeneous nuclear ribonucleoprotein C (HNRNPC)
Crosstalk relationship ncRNA → m6A
Disease Lung cancer
m6A Target: hsa-miR-183-3p
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05469
Epigenetic Regulator hsa-miR-183-3p
Regulated Target Heterogeneous nuclear ribonucleoprotein C (HNRNPC)
Crosstalk relationship m6A → ncRNA
Disease Pancreatic ductal adenocarcinoma
m6A Target: microRNA 186 (MIR186)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05506
Epigenetic Regulator MicroRNA 186 (MIR186)
Regulated Target Heterogeneous nuclear ribonucleoprotein C (HNRNPC)
Crosstalk relationship m6A → ncRNA
Disease Esophageal cancer
m6A Target: hsa-miR-320c
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05507
Epigenetic Regulator hsa-miR-320c
Regulated Target Heterogeneous nuclear ribonucleoprotein C (HNRNPC)
Crosstalk relationship m6A → ncRNA
Disease Esophageal cancer
m6A Target: hsa-miR-320d
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05508
Epigenetic Regulator hsa-miR-320d
Regulated Target Heterogeneous nuclear ribonucleoprotein C (HNRNPC)
Crosstalk relationship m6A → ncRNA
Disease Esophageal cancer
m6A Target: hsa-miR-320b
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05509
Epigenetic Regulator hsa-miR-320b
Regulated Target Heterogeneous nuclear ribonucleoprotein C (HNRNPC)
Crosstalk relationship m6A → ncRNA
Disease Esophageal cancer
m6A Target: microRNA 21 (MIR21)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05777
Epigenetic Regulator MicroRNA 21 (MIR21)
Crosstalk relationship m6A → ncRNA
Xenobiotics Compound(s) Regulating the m6A Methylation Regulator
Compound Name Dabigatran Investigative
Synonyms
Dabigatran; 211914-51-1; BIBR 953; BIBR-953; 3-[[2-[(4-carbamimidoylanilino)methyl]-1-methylbenzimidazole-5-carbonyl]-pyridin-2-ylamino]propanoic acid; CHEBI:70752; BIBR 953 (Dabigatran, Pradaxa); UNII-I0VM4M70GC; I0VM4M70GC; BIBR 953 ZW; CHEMBL48361; 3-[[2-[[(4-CARBAMIMIDOYLPHENYL)AMINO]METHYL]-1-METHYL-BENZOIMIDAZOLE-5-CARBONYL]-PYRIDIN-2-YL-AMINO]PROPANOIC ACID; N-[(2-{[(4-Carbamimidoylphenyl)amino]methyl}-1-Methyl-1h-Benzimidazol-5-Yl)carbonyl]-N-Pyridin-2-Yl-Beta-Alanine; 3-(2-(((4-carbamimidoylphenyl)amino)methyl)-1-methyl-N-(pyridin-2-yl)-1H-benzo[d]imidazole-5-carboxamido)propanoic acid; C25H25N7O3; 3-[1-(2-{[(4-carbamimidoylphenyl)amino]methyl}-1-methyl-1H-1,3-benzodiazol-5-yl)-N-(pyridin-2-yl)formamido]propanoic acid; BIBR953; beta-Alanine, N-((2-(((4-(aminoiminomethyl)phenyl)amino)methyl)-1-methyl-1H-benzimidazol-5-yl)carbonyl)-N-2-pyridinyl-; BETA-ALANINE, N-[[2-[[[4-(AMINOIMINOMETHYL)PHENYL]AMINO]METHYL]-1-METHYL-1H-BENZIMIDAZOL-5-YL]CARBONYL]-N-2-PYRIDINYL-; Pradaxa (dabigatran); Dabigatran-[13C6]; Dabigatran-D3 solution; Dabigatran (USAN/INN); BIBR 953(Dabigatran); Epitope ID:186729; Dabigatran (BIBR-953); SCHEMBL3573; BIBR 953ZW; BIBR-953ZW; BIBR-953-ZW; Dabigatran [USAN:INN:BAN]; GTPL6380; BIBR 953,Dabigatran, Pradaxa; HSDB 8062; AOB5262; DTXSID50175419; BCP06664; ZINC1910616; BDBM50112086; BIBR 953 - Dabigatran - Pradaxa; MFCD09837830; s2196; STL450902; AKOS005266720; AM81238; CS-1399; DB14726; PB38204; SB20292; NCGC00346575-01; NCGC00346575-06; (non-labelled)Dabigatran-d4 Hydrochloride; AC-25299; AS-11488; HY-10163; BIBR 953 (Dabigatran etexilate, Pradaxa); FT-0648482; FT-0665441; 2,6-Bis[(R)-4-phenyloxazolin-2-yl]pyridine; C21556; D09707; AB01274802-01; AB01274802_02; A815190; Q419345; Q-102529; 1-Methyl-2-[(4-amidinophenyl)aminomethyl]benzimidazol-5-yl-carboxylic acid-N-(2-pyridyl)-N-(2-hydroxycarbonylethyl)amide; 1-Methyl-2-[N-(4-amidinophenyl)-aminomethyl]-benzimidazol-5-yl-carboxylic acid-N-(2-pyridyl)-N-(2-hydroxycarbonylethyl)-amide; 1-Methyl-2-[N-(4-amidinophenyl)aminomethyl]benzimidazol-5-yl-carboxylic acid-N-(2-pyridyl)-N-(2-hydroxycarbonylethyl)amide; 3-(((2-(((4-Carbamimidoylphenyl)amino)methyl)-1-methyl-1H-benzimidazol-5-yl)carbonyl)(pyridin-2-yl)amino)propanoic acid; 3-({2-[(4-Carbamimidoyl-phenylamino)-methyl]-1-methyl-1H-benzoimidazole-5-carbonyl}-pyridin-2-yl-amino)-propionic acid; 3-[[[2-[(4-carbamimidoylanilino)methyl]-1-methyl-5-benzimidazolyl]-oxomethyl]-(2-pyridinyl)amino]propanoic acid; 3-[[2-[[(4-carbamimidoylphenyl)amino]methyl]-1-methyl-benzimidazol-5-yl]carbonyl-pyridin-2-yl-amino]propanoic acid; 3-[[2-[[(4-carbamimidoylphenyl)amino]methyl]-1-methylbenzimidazole-5-carbonyl]-pyridin-2-ylamino]propanoic acid; b-Alanine,N-[[2-[[[4-(aminoiminomethyl)phenyl]amino]methyl]-1-methyl-1H-benzimidazol-5-yl]carbonyl]-N-2-pyridinyl-; N-((2-((p-Amidinoanilino)methyl)-1-methyl-5-benzimidazolyl)carbonyl)-N-2-pyridyl-beta-alanine
    Click to Show/Hide
External link
Activity
IC50=60000 nM
[14]
Compound Name 3-[[2-[[4-[N'-[4-[[(3S)-4-[3-[2-[2-[3-[5-[(3aS,4S,6aR)-2-oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-4-yl]pentanoylamino]propoxy]ethoxy]ethoxy]propylamino]-4-oxo-3-[[4-[3-(trifluoromethyl)diazirin-3-yl]benzoyl]amino]butanoyl]amino]butyl]carbamimidoyl]anilino]methyl]-1-methylbenzimidazole-5-carbonyl]-pyridin-2-ylamino]propanoic acid Investigative
Synonyms
CHEMBL2216801
    Click to Show/Hide
External link
Activity
IC50=800 nM
[14]
References
Ref 1 Roles of the m(6)A Modification of RNA in the Glioblastoma Microenvironment as Revealed by Single-Cell Analyses. Front Immunol. 2022 Apr 26;13:798583. doi: 10.3389/fimmu.2022.798583. eCollection 2022.
Ref 2 Genetic variants in N6-methyladenosine are associated with bladder cancer risk in the Chinese population. Arch Toxicol. 2021 Jan;95(1):299-309. doi: 10.1007/s00204-020-02911-2. Epub 2020 Sep 22.
Ref 3 Development of a marrow transplant regimen for acute leukemia using targeted hematopoietic irradiation delivered by 131I-labeled anti-CD45 antibody, combined with cyclophosphamide and total body irradiation. Blood. 1995 Feb 15;85(4):1122-31.
Ref 4 Influence of N6-Methyladenosine Modification Gene HNRNPC on Cell Phenotype in Parkinson's Disease. Parkinsons Dis. 2021 Dec 20;2021:9919129. doi: 10.1155/2021/9919129. eCollection 2021.
Ref 5 Methylenetetrahydrofolate reductase gene polymorphisms: genomic predictors of clinical response to fluoropyrimidine-based chemotherapy?. Cancer Chemother Pharmacol. 2006 Jun;57(6):835-40. doi: 10.1007/s00280-005-0089-1. Epub 2005 Sep 27.
Ref 6 Network analysis of miRNA targeting m6A-related genes in patients with esophageal cancer. PeerJ. 2021 Jul 29;9:e11893. doi: 10.7717/peerj.11893. eCollection 2021.
Ref 7 Identification of genetic variants in m(6)A modification genes associated with pancreatic cancer risk in the Chinese population. Arch Toxicol. 2021 Mar;95(3):1117-1128. doi: 10.1007/s00204-021-02978-5. Epub 2021 Jan 21.
Ref 8 Pharmacokinetics of dipeptidylpeptidase-4 inhibitors. Diabetes Obes Metab. 2010 Aug;12(8):648-58. doi: 10.1111/j.1463-1326.2010.01212.x.
Ref 9 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1619).
Ref 10 The tyrosine kinase inhibitor imatinib mesylate enhances the efficacy of photodynamic therapy by inhibiting ABCG2. Clin Cancer Res. 2007 Apr 15;13(8):2463-70.
Ref 11 Clinical pipeline report, company report or official report of SystImmune.
Ref 12 Gene Signature and Identification of Clinical Trait-Related m(6) A Regulators in Pancreatic Cancer. Front Genet. 2020 Jul 10;11:522. doi: 10.3389/fgene.2020.00522. eCollection 2020.
Ref 13 Elevated Heterogeneous Nuclear Ribonucleoprotein C Expression Correlates With Poor Prognosis in Patients With Surgically Resected Lung Adenocarcinoma. Front Oncol. 2021 Jan 25;10:598437. doi: 10.3389/fonc.2020.598437. eCollection 2020.
Ref 14 Dabigatran and dabigatran ethyl ester: potent inhibitors of ribosyldihydronicotinamide dehydrogenase (NQO2). J Med Chem. 2012 Apr 26;55(8):3934-44. doi: 10.1021/jm3001339. Epub 2012 Apr 17.