m6A Regulator Information

General Information of the m6A Regulator (ID: REG00012)

Regulator Name	Insulin-like growth factor 2 mRNA-binding protein 1 (IGF2BP1)
Synonyms	IGF2 mRNA-binding protein 1; IMP-1; IMP1; Coding region determinant-binding protein; CRD-BP; IGF-II mRNA-binding protein 1; VICKZ family member 1; Zipcode-binding protein 1; ZBP-1; CRDBP; VICKZ1; ZBP1 Click to Show/Hide
Gene Name	IGF2BP1
Sequence	MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGK VELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETA VVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQG SPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAA EKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLK KVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMSL QSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAI IGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEAQFKAQGRIYGKLKEENFF GPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKII GHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK Click to Show/Hide
Family	RRM IMP/VICKZ family
Function	RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). This transcript 'caging' into mRNPs allows mRNA transport and transient storage. It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation. Plays a direct role in the transport and translation of transcripts required for axonal regeneration in adult sensory neurons (By similarity). Regulates localized beta-actin/ACTB mRNA translation, a crucial process for cell polarity, cell migration and neurite outgrowth. Co-transcriptionally associates with the ACTB mRNA in the nucleus. This binding involves a conserved 54-nucleotide element in the ACTB mRNA 3'-UTR, known as the 'zipcode'. The RNP thus formed is exported to the cytoplasm, binds to a motor protein and is transported along the cytoskeleton to the cell periphery. During transport, prevents ACTB mRNA from being translated into protein. When the RNP complex reaches its destination near the plasma membrane, IGF2BP1 is phosphorylated. This releases the mRNA, allowing ribosomal 40S and 60S subunits to assemble and initiate ACTB protein synthesis. Monomeric ACTB then assembles into the subcortical actin cytoskeleton (By similarity). During neuronal development, key regulator of neurite outgrowth, growth cone guidance and neuronal cell migration, presumably through the spatiotemporal fine tuning of protein synthesis, such as that of ACTB (By similarity). May regulate mRNA transport to activated synapses (By similarity). Binds to and stabilizes ABCB1/MDR-1 mRNA (By similarity). During interstinal wound repair, interacts with and stabilizes PTGS2 transcript. PTGS2 mRNA stabilization may be crucial for colonic mucosal wound healing (By similarity). Binds to the 3'-UTR of IGF2 mRNA by a mechanism of cooperative and sequential dimerization and regulates IGF2 mRNA subcellular localization and translation. Binds to MYC mRNA, in the coding region instability determinant (CRD) of the open reading frame (ORF), hence prevents MYC cleavage by endonucleases and possibly microRNA targeting to MYC-CRD. Binds to the 3'-UTR of CD44 mRNA and stabilizes it, hence promotes cell adhesion and invadopodia formation in cancer cells. Binds to the oncofetal H19 transcript and to the neuron-specific TAU mRNA and regulates their localizations. Binds to and stabilizes BTRC/FBW1A mRNA. Binds to the adenine-rich autoregulatory sequence (ARS) located in PABPC1 mRNA and represses its translation. PABPC1 mRNA-binding is stimulated by PABPC1 protein. Prevents BTRC/FBW1A mRNA degradation by disrupting microRNA-dependent interaction with AGO2. Promotes the directed movement of tumor-derived cells by fine-tuning intracellular signaling networks. Binds to MAPK4 3'-UTR and inhibits its translation. Interacts with PTEN transcript open reading frame (ORF) and prevents mRNA decay. This combined action on MAPK4 (down-regulation) and PTEN (up-regulation) antagonizes HSPB1 phosphorylation, consequently it prevents G-actin sequestration by phosphorylated HSPB1, allowing F-actin polymerization. Hence enhances the velocity of cell migration and stimulates directed cell migration by PTEN-modulated polarization. Interacts with Hepatitis C virus (HCV) 5'-UTR and 3'-UTR and specifically enhances translation at the HCV IRES, but not 5'-cap-dependent translation, possibly by recruiting eIF3. Interacts with HIV-1 GAG protein and blocks the formation of infectious HIV-1 particles. Reduces HIV-1 assembly by inhibiting viral RNA packaging, as well as assembly and processing of GAG protein on cellular membranes. During cellular stress, such as oxidative stress or heat shock, stabilizes target mRNAs that are recruited to stress granules, including CD44, IGF2, MAPK4, MYC, PTEN, RAPGEF2 and RPS6KA5 transcripts. Click to Show/Hide
Gene ID	10642
Uniprot ID	IF2B1_HUMAN
Regulator Type	WRITER ERASER READER
Mechanism Diagram	Click to View the Original Diagram

Target Genes	Click to View Potential Target Genes of This Regulator

Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)

IGF2BP1 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.

Browse Target Gene related Disease

Browse Target Gene related Drug

Aldehyde dehydrogenase 1A1 (ALDH1A1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	A549 cell line	Homo sapiens
Treatment: IGF2BP1 knockout A549 cells Control: Wild type A549 cells		GSE146546
Regulation		logFC: -7.78E-01 p-value: 8.37E-08
More Results	Click to View More RNA-seq Results

Acute myeloid leukaemia [ICD-11: 2A60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[1]
Responsed Disease	Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation	Up regulation
In-vitro Model	MOLT-16	T acute lymphoblastic leukemia	Homo sapiens	CVCL_1424
	Reh	B acute lymphoblastic leukemia	Homo sapiens	CVCL_1650
	SKNO-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_2196
	Tanoue	B acute lymphoblastic leukemia	Homo sapiens	CVCL_1852
In-vivo Model	For the engraftment experiments, 1×10³ 1×10⁶ cells were injected into tail veins of non-irradiated 6-10 week-old female mice in 100 uL of DPBS per mouse. No blinding or randomization was applied to mice experiments. Routinely, each in vivo experiment was performed with three technical replicates (three mice per group) and independently repeated two to three times for each cell line.
Response Summary	IGF2BP1 decreases leukemia cells' tumorigenicity, promotes myeloid differentiation, increases leukemia cell death, and sensitizes acute myeloid leukemia cells to chemotherapeutic drugs. IGF2BP1 affects proliferation and tumorigenic potential of leukemia cells through critical regulators of self-renewal HOXB4 and MYB and through regulation of expression of the aldehyde dehydrogenase, Aldehyde dehydrogenase 1A1 (ALDH1A1).

Apoptosis regulator Bcl-2 (BCL2)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	ES-2 cell line	Homo sapiens
Treatment: siIGF2BP1 ES-2 cells Control: siControl ES-2 cells		GSE109604
Regulation		logFC: -7.97E-01 p-value: 9.99E-03
More Results	Click to View More RNA-seq Results

Malignant haematopoietic neoplasm [ICD-11: 2B33]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[2]
Responsed Disease	Myeloid leukaemia [ICD-11: 2B33.1]
Target Regulation	Up regulation
Cell Process	Cell apoptosis
In-vitro Model	Leukemia stem cell line (Leukemia stem cell line)
	Kasumi-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_0589
	MOLM-13	Adult acute myeloid leukemia	Homo sapiens	CVCL_2119
	THP-1	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0006
	MV4-11	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0064
	BV-173	Chronic myelogenous leukemia	Homo sapiens	CVCL_0181
	NOMO-1	Adult acute monocytic leukemia	Homo sapiens	CVCL_1609
	K-562	Chronic myelogenous leukemia	Homo sapiens	CVCL_0004
	KG-1a	Adult acute myeloid leukemia	Homo sapiens	CVCL_1824
Response Summary	YBX1 selectively functions in regulating survival of myeloid leukemia cells. YBX1 interacts with insulin-like growth factor 2 messenger RNA (mRNA)-binding proteins (IGF2BPs) and stabilizes m6A-tagged RNA. YBX1 deficiency dysregulates the expression of apoptosis-related genes and promotes mRNA decay of MYC and Apoptosis regulator Bcl-2 (BCL2) in an m6A-dependent manner, which contributes to the defective survival that results from deletion of YBX1.

Cyclin-dependent kinase 4 (CDK4)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	PANC-1 cell line	Homo sapiens
Treatment: siIGF2BP1 PANC-1 cells Control: siControl PANC-1 cells		GSE161087
Regulation		logFC: -1.19E+00 p-value: 3.49E-04
More Results	Click to View More RNA-seq Results

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Cell Process	Cell apoptosis
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	NCI-H520	Lung squamous cell carcinoma	Homo sapiens	CVCL_1566
	HBE (Human bronchial epithelial cell line)
	LTEP-a2	Endocervical adenocarcinoma	Homo sapiens	CVCL_6929
	SK-MES-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_0630
Response Summary	GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, CCND1, Cyclin-dependent kinase 4 (CDK4), EGR2, YBX1, and TLX, which were associated with lung cancers.

Cystine/glutamate transporter (SLC7A11)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	MV3 cell line	Homo sapiens
Treatment: siIGF2BP1 MV3 cells Control: siControl MV3 cells		GSE146803
Regulation		logFC: -1.30E+00 p-value: 3.62E-06
More Results	Click to View More RNA-seq Results

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[4]
Responsed Disease	Hepatoblastoma [ICD-11: 2C12.01]
Target Regulation	Up regulation
Pathway Response	Ferroptosis			hsa04216
Cell Process	Ferroptosis
In-vitro Model	HuH-6	Hepatoblastoma	Homo sapiens	CVCL_4381
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
Response Summary	METTL3-mediated Cystine/glutamate transporter (SLC7A11) m6A modification enhances hepatoblastoma ferroptosis resistance. The METTL3/IGF2BP1/m6A modification promotes SLC7A11 mRNA stability and upregulates its expression by inhibiting the deadenylation process.

Fascin (FSCN1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	HepG2 cell line	Homo sapiens
Treatment: siIGF2BP1 HepG2 cells Control: siControl HepG2 cells		GSE161086
Regulation		logFC: 9.48E-01 p-value: 8.70E-06
More Results	Click to View More RNA-seq Results

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Cell Process	RNA decay
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
Response Summary	In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, Fascin (FSCN1), TK1, and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.

Cervical cancer [ICD-11: 2C77]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Cervical cancer [ICD-11: 2C77]
Cell Process	RNA decay
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
Response Summary	In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, Fascin (FSCN1), TK1, and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.

Histone-lysine N-methyltransferase EZH2 (EZH2)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	PANC-1 cell line	Homo sapiens
Treatment: siIGF2BP1 PANC-1 cells Control: siControl PANC-1 cells		GSE161087
Regulation		logFC: -1.26E+00 p-value: 4.20E-03
More Results	Click to View More RNA-seq Results

Neuroendocrine neoplasms [ICD-11: 2D4Y]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[6]
Responsed Disease	Neuroendocrine neoplasms [ICD-11: 2D4Y]
Target Regulation	Up regulation
Pathway Response	Cell cycle			hsa04110
Cell Process	Increase in G1 and sub-G1 phases
In-vitro Model	NCI-H727	Lung carcinoid tumor	Homo sapiens	CVCL_1584
In-vitro Model	COLO 320DM	Colon adenocarcinoma	Homo sapiens	CVCL_0219
In-vivo Model	RIP1-Tag2 mice were purchased from NCI Mouse Repository (Bethesda, Rockville, MD, USA) and maintained in a C57BL/6N background.
Response Summary	This data identify IGF2BP1 as an important driver of tumor progression in NEN, and indicate that disruption of the IGF2BP1-Myc-Histone-lysine N-methyltransferase EZH2 (EZH2) axis represents a promising approach for targeted therapy of neuroendocrine neoplasms.

Homeobox protein Hox-B4 (HOXB4)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	PANC-1 cell line	Homo sapiens
Treatment: siIGF2BP1 PANC-1 cells Control: siControl PANC-1 cells		GSE161087
Regulation		logFC: -9.62E-01 p-value: 3.85E-02
More Results	Click to View More RNA-seq Results

Acute myeloid leukaemia [ICD-11: 2A60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[1]
Responsed Disease	Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation	Up regulation
In-vitro Model	MOLT-16	T acute lymphoblastic leukemia	Homo sapiens	CVCL_1424
	Reh	B acute lymphoblastic leukemia	Homo sapiens	CVCL_1650
	SKNO-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_2196
	Tanoue	B acute lymphoblastic leukemia	Homo sapiens	CVCL_1852
In-vivo Model	For the engraftment experiments, 1×10³ 1×10⁶ cells were injected into tail veins of non-irradiated 6-10 week-old female mice in 100 uL of DPBS per mouse. No blinding or randomization was applied to mice experiments. Routinely, each in vivo experiment was performed with three technical replicates (three mice per group) and independently repeated two to three times for each cell line.
Response Summary	IGF2BP1 decreases leukemia cells' tumorigenicity, promotes myeloid differentiation, increases leukemia cell death, and sensitizes acute myeloid leukemia cells to chemotherapeutic drugs. IGF2BP1 affects proliferation and tumorigenic potential of leukemia cells through critical regulators of self-renewal Homeobox protein Hox-B4 (HOXB4) and MYB and through regulation of expression of the aldehyde dehydrogenase, ALDH1A1.

Interleukin enhancer-binding factor 3 (ILF3)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	PANC-1 cell line	Homo sapiens
Treatment: siIGF2BP1 PANC-1 cells Control: siControl PANC-1 cells		GSE161087
Regulation		logFC: -9.14E-01 p-value: 4.02E-03
More Results	Click to View More RNA-seq Results

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[7]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Up regulation
In-vitro Model	Huh-7	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0336
	Hep 3B2.1-7	Childhood hepatocellular carcinoma	Homo sapiens	CVCL_0326
	HEK293T	Normal	Homo sapiens	CVCL_0063
In-vivo Model	Approximately 5 × 10⁶ control and ILF3-AS1 silencing Huh7 cells were subcutaneously implanted into the right flank of nude mice.Xenograft size was measured every 7 days and calculated using the equation V(mm³)=(length×width2)/2. 35 days later, the mice were sacrificed, and the tumor tissues were isolated and weighed.
Response Summary	ILF3-AS1 expression was significantly elevated in HCC tissues,mechanistically, ILF3-AS1 associated with Interleukin enhancer-binding factor 3 (ILF3) mRNA and inhibited its degradation. ILF3-AS1 increased ILF3 m6A level via recruiting N6-methyladenosine (m6A) RNA methyltransferase METTL3. Moreover, IFL3-AS1 enhanced the interaction between ILF3 mRNA and m6A reader IGF2BP1.

Leukocyte surface antigen CD47 (CD47)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	PANC-1 cell line	Homo sapiens
Treatment: siIGF2BP1 PANC-1 cells Control: siControl PANC-1 cells		GSE161087
Regulation		logFC: -8.42E-01 p-value: 5.16E-03
More Results	Click to View More RNA-seq Results

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[8]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Up regulation
Cell Process	Epithelial-mesenchymal transition
In-vitro Model	Huh-7	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0336
In-vitro Model	HCCLM3	Adult hepatocellular carcinoma	Homo sapiens	CVCL_6832
Response Summary	METTL3/IGF2BP1/Leukocyte surface antigen CD47 (CD47) mediated EMT transition contributes to the incomplete ablation induced metastasis in HCC cells.

MARCKS-related protein (MARCKSL1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	A549 cell line	Homo sapiens
Treatment: IGF2BP1 knockout A549 cells Control: Wild type A549 cells		GSE146546
Regulation		logFC: -9.80E-01 p-value: 8.88E-07
More Results	Click to View More RNA-seq Results

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Cell Process	RNA decay
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
Response Summary	In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, FSCN1, TK1, and MARCKS-related protein (MARCKSL1), exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.

Cervical cancer [ICD-11: 2C77]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Cervical cancer [ICD-11: 2C77]
Cell Process	RNA decay
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
Response Summary	In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, FSCN1, TK1, and MARCKS-related protein (MARCKSL1), exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.

Myc proto-oncogene protein (MYC)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	HepG2 cell line	Homo sapiens
Treatment: siIGF2BP1 HepG2 cells Control: siControl HepG2 cells		GSE161086
Regulation		logFC: -9.94E-01 p-value: 1.72E-04
More Results	Click to View More RNA-seq Results

Malignant haematopoietic neoplasm [ICD-11: 2B33]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[2]
Responsed Disease	Myeloid leukaemia [ICD-11: 2B33.1]
Target Regulation	Up regulation
Cell Process	Cell apoptosis
In-vitro Model	Leukemia stem cell line (Leukemia stem cell line)
	Kasumi-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_0589
	MOLM-13	Adult acute myeloid leukemia	Homo sapiens	CVCL_2119
	THP-1	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0006
	MV4-11	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0064
	BV-173	Chronic myelogenous leukemia	Homo sapiens	CVCL_0181
	NOMO-1	Adult acute monocytic leukemia	Homo sapiens	CVCL_1609
	K-562	Chronic myelogenous leukemia	Homo sapiens	CVCL_0004
	KG-1a	Adult acute myeloid leukemia	Homo sapiens	CVCL_1824
Response Summary	YBX1 selectively functions in regulating survival of myeloid leukemia cells. YBX1 interacts with insulin-like growth factor 2 messenger RNA (mRNA)-binding proteins (IGF2BPs) and stabilizes m6A-tagged RNA. YBX1 deficiency dysregulates the expression of apoptosis-related genes and promotes mRNA decay of Myc proto-oncogene protein (MYC) and BCL2 in an m6A-dependent manner, which contributes to the defective survival that results from deletion of YBX1.

Gastric cancer [ICD-11: 2B72]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[9]
Responsed Disease	Gastric cancer [ICD-11: 2B72]
Target Regulation	Up regulation
Pathway Response	Central carbon metabolism in cancer			hsa05230
Pathway Response	Glycolysis / Gluconeogenesis			hsa00010
Cell Process	Aerobic glycolysis
In-vitro Model	SNU-216	Gastric tubular adenocarcinoma	Homo sapiens	CVCL_3946
	MKN45	Gastric adenocarcinoma	Homo sapiens	CVCL_0434
	HGC-27	Gastric carcinoma	Homo sapiens	CVCL_1279
	GES-1	Normal	Homo sapiens	CVCL_EQ22
	AGS	Gastric adenocarcinoma	Homo sapiens	CVCL_0139
In-vivo Model	A total of 5 × 10⁶ transfected MKN-45 cells, stably transfected with sh-IGF2BP1 vector or empty vector were subcutaneously injected into the flank of the mice. Tumor growth was measured every three days, and calculated using the following equation = a × b2/2 (a for longitudinal diameter; and b for latitudinal diameter). Three weeks after injection, mice were sacrificed.
Response Summary	IGF2BP1 upregulated in GC tissue and acted as a predictor of poor prognosis for GC patients. IGF2BP1 directly interacted with Myc proto-oncogene protein (MYC) mRNA via m6A-dependent manner to by stabilize its stability.

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Cell Process	RNA decay
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
Response Summary	In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including Myc proto-oncogene protein (MYC), FSCN1, TK1, and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.

Breast cancer [ICD-11: 2C60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[10]
Responsed Disease	Breast cancer [ICD-11: 2C60]
Target Regulation	Up regulation
Pathway Response	Signaling pathways regulating pluripotency of stem cells			hsa04550
In-vitro Model	BT-474	Invasive breast carcinoma	Homo sapiens	CVCL_0179
	BT-549	Invasive breast carcinoma	Homo sapiens	CVCL_1092
	HEK293T	Normal	Homo sapiens	CVCL_0063
	Hs 578T	Invasive breast carcinoma	Homo sapiens	CVCL_0332
	MCF-7	Invasive breast carcinoma	Homo sapiens	CVCL_0031
	MDA-MB-231	Breast adenocarcinoma	Homo sapiens	CVCL_0062
	MDA-MB-453	Breast adenocarcinoma	Homo sapiens	CVCL_0418
	MDA-MB-468	Breast adenocarcinoma	Homo sapiens	CVCL_0419
	T-47D	Invasive breast carcinoma	Homo sapiens	CVCL_0553
In-vivo Model	The enriched mammosphere cells derived from engineered BT549 and Hs578T with silenced lncRNA KB-1980E6.3 (shKB/vector), BT549, and Hs578T with lncRNA KB-1980E6.3 knockdown combined with ectopic c-Myc (shKB/c-Myc), BT549, and Hs578T with silenced IGF2BP1 (shIGF2BP1/vector), BT549, and Hs578T with knocked down IGF2BP1 combined with ectopic c-Myc (shIGF2BP1/c-Myc), and BT549, and Hs578T/shNC/vector control cells were used in Xenograft experiments. Three doses (1 × 10⁵, 1 × 10⁴ and 1 × 10³) of spheres derived from the engineered Hs578T and 1 × 10⁵ of spheres derived from the engineered BT549 were subcutaneously inoculated into 4- to 6-week-old female nude mice (n = 5 per group). Mice were then treated with either bevacizumab (10 mg/kg every 3 days) to form a hypoxic tumor microenvironment or vehicle PBS to form a non-hypoxic condition
Response Summary	Hypoxia-induced lncRNA KB-1980E6.3 is involved in the self-renewal and stemness maintenance of breast cancer stem cells by recruiting IGF2BP1 to regulate Myc proto-oncogene protein (MYC) mRNA stability.

Cervical cancer [ICD-11: 2C77]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Cervical cancer [ICD-11: 2C77]
Cell Process	RNA decay
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
Response Summary	In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including Myc proto-oncogene protein (MYC), FSCN1, TK1, and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.

Polycomb complex protein BMI-1 (BMI1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	PANC-1 cell line	Homo sapiens
Treatment: siIGF2BP1 PANC-1 cells Control: siControl PANC-1 cells		GSE161087
Regulation		logFC: -6.85E-01 p-value: 1.16E-03
More Results	Click to View More RNA-seq Results

Head and neck squamous carcinoma [ICD-11: 2B6E]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[11]
Responsed Disease	Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Target Regulation	Up regulation
In-vitro Model	UM1	Tongue squamous cell carcinoma	Homo sapiens	CVCL_VH00
	SCC-9	Tongue squamous cell carcinoma	Homo sapiens	CVCL_1685
	SCC-25	Tongue squamous cell carcinoma	Homo sapiens	CVCL_1682
	SCC-15	Tongue squamous cell carcinoma	Homo sapiens	CVCL_1681
	HSC-3	Tongue squamous cell carcinoma	Homo sapiens	CVCL_1288
	HOK	Normal	Hexagrammos otakii	CVCL_YE19
In-vivo Model	To construct the subcutaneous tumorigenesis model, the cells were suspended in 100 uL of PBS and Matrigel matrix (BD Biosciences, USA) (1:1) and injected into the right flanks of 6-week-old female BALB/c nude mice.To construct the lymph node metastasis model, we injected 1 × 10⁵/50 uL stably infected SCC9 cells into the left hind footpads of BALB/c mice.
Response Summary	METTL3 promotes Polycomb complex protein BMI-1 (BMI1) translation in OSCC under the cooperation with m6A reader IGF2BP1. And the study revealed that METTL3 promotes OSCC proliferation and metastasis through BMI1 m6A methylation.

Pre-mRNA-splicing regulator WTAP (WTAP)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	HepG2 cell line	Homo sapiens
Treatment: siIGF2BP1 HepG2 cells Control: siControl HepG2 cells		GSE161086
Regulation		logFC: -7.39E-01 p-value: 8.18E-05
More Results	Click to View More RNA-seq Results

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Cell Process	Cell apoptosis
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	NCI-H520	Lung squamous cell carcinoma	Homo sapiens	CVCL_1566
	HBE (Human bronchial epithelial cell line)
	LTEP-a2	Endocervical adenocarcinoma	Homo sapiens	CVCL_6929
	SK-MES-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_0630
Response Summary	GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, Pre-mRNA-splicing regulator WTAP (WTAP), CCND1, CDK4, EGR2, YBX1, and TLX, which were associated with lung cancers.

Retrotransposon-derived protein PEG10 (PEG10)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	ES-2 cell line	Homo sapiens
Treatment: siIGF2BP1 ES-2 cells Control: siControl ES-2 cells		GSE161087
Regulation		logFC: 1.77E+00 p-value: 9.40E-06
More Results	Click to View More RNA-seq Results

Endometrial cancer [ICD-11: 2C76]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[12]
Responsed Disease	Endometrial cancer [ICD-11: 2C76]
Target Regulation	Up regulation
In-vitro Model	RL95-2	Endometrial adenosquamous carcinoma	Homo sapiens	CVCL_0505
	KLE	Endometrial adenocarcinoma	Homo sapiens	CVCL_1329
	Ishikawa	Endometrial adenocarcinoma	Homo sapiens	CVCL_2529
	HEC-1-B	Endometrial adenocarcinoma	Homo sapiens	CVCL_0294
	HEC-1-A	Endometrial adenocarcinoma	Homo sapiens	CVCL_0293
	AN3-CA	Endometrial adenocarcinoma	Homo sapiens	CVCL_0028
In-vivo Model	Six-week-old, female SCID-Berge mice were purchased from Vitalriver. EC cells with IGF2BP1 overexpression or silencing or the appropriate controls (1×10⁶) were injected into lower abdominal cavity of each mouse (n = 5 mice/group).
Response Summary	IGF2BP1 expression increased in EC, and high expression of this protein correlated with poor prognosis. IGF2BP1 can recognize m6A sites in the 3'UTR of PEG10 mRNA and recruits PABPC1 to enhance Retrotransposon-derived protein PEG10 (PEG10) mRNA stability, which consequently promotes PEG10 protein expression.

Serum response factor (SRF)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	MV3 cell line	Homo sapiens
Treatment: siIGF2BP1 MV3 cells Control: siControl MV3 cells		GSE146803
Regulation		logFC: -9.12E-01 p-value: 4.27E-10
More Results	Click to View More RNA-seq Results

Solid tumour/cancer [ICD-11: 2A00-2F9Z]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[13]
Responsed Disease	Solid tumour/cancer [ICD-11: 2A00-2F9Z]
Target Regulation	Up regulation
Cell Process	Cell growth
Cell Process	Cell invasion
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	K-562	Chronic myelogenous leukemia	Homo sapiens	CVCL_0004
Response Summary	IGF2BP1 promotes Serum response factor (SRF) and SRF target genes at the post-transcriptional level suggesting it as a post-transcriptional enhancer of SRF itself as well as SRF-dependent gene expression in cancer cells.

Signal transducer and activator of transcription 3 (STAT3)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	ES-2 cell line	Homo sapiens
Treatment: siIGF2BP1 ES-2 cells Control: siControl ES-2 cells		GSE161087
Regulation		logFC: 6.53E-01 p-value: 9.70E-05
More Results	Click to View More RNA-seq Results

Atherosclerosis [ICD-11: BD40]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[14]
Responsed Disease	Atherosclerosis [ICD-11: BD40.Z]
Target Regulation	Up regulation
Pathway Response	JAK-STAT signaling pathway			hsa04630
Cell Process	Cell proliferation and migration
In-vitro Model	HUVEC-C	Normal	Homo sapiens	CVCL_2959
In-vivo Model	The adeno-associated viruses (AAV) that could silence METTL3 (sh-METTL3) and the negative control adeno-associated viruses (sh-NC) were obtained from WZ Biosciences Inc. (Jinan, China). APOE^-/- mice were randomly divided into AS + sh-NC and AS + sh-METTL3 groups. Each group contains five mice. Mice were fed with the standard diet for 1 week to acclimatize. After 1 week of acclimation, mice were challenged with a high-fat and high-cholesterol feed H10540 (Beijing HFK BIOSCIENCE Co., Ltd., Beijing, China). The formula of the H10540 feed was shown in Supplementary File S1. After 8 weeks of HFD feeding, sh-NC or sh-METTL3 adeno-associated virus serotype 9 (AAV9, 1012 viral genome copies per mouse) were respectively delivered into mice in AS + sh-NC or AS + sh-METTL3 group through tail vein injection. At 14 weeks after HDF feeding, mice fasted overnight.
Response Summary	METTL3 knockdown prevented Atherosclerosis progression by inhibiting JAK2/Signal transducer and activator of transcription 3 (STAT3) pathway via IGF2BP1.

Thymidine kinase, cytosolic (TK1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	MV3 cell line	Homo sapiens
Treatment: siIGF2BP1 MV3 cells Control: siControl MV3 cells		GSE146803
Regulation		logFC: -6.03E-01 p-value: 6.27E-08
More Results	Click to View More RNA-seq Results

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Cell Process	RNA decay
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
Response Summary	In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, FSCN1, Thymidine kinase, cytosolic (TK1), and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.

Cervical cancer [ICD-11: 2C77]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Cervical cancer [ICD-11: 2C77]
Cell Process	RNA decay
In-vitro Model	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
Response Summary	In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, FSCN1, Thymidine kinase, cytosolic (TK1), and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.

Transcription factor AP-2 gamma (TFAP2C)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	A549 cell line	Homo sapiens
Treatment: IGF2BP1 knockout A549 cells Control: Wild type A549 cells		GSE146546
Regulation		logFC: 6.39E-01 p-value: 1.76E-04
More Results	Click to View More RNA-seq Results

Testicular cancer [ICD-11: 2C80]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[15]
Responsed Disease	Testicular cancer [ICD-11: 2C80]
Responsed Drug	Cisplatin		Approved	Drug Info
Target Regulation	Up regulation
Pathway Response	Nucleotide excision repair			hsa03420
Cell Process	DNA repair
In-vitro Model	TCam-2	Testicular seminoma	Homo sapiens	CVCL_T012
In-vivo Model	Male mice were subcutaneously injected with tumour cells near the limbs to establish xenografts (1 × 10⁶/mouse, 0.2 mL for each injection site; METTL3-overexpressing TCam-2/CDDP cells were inoculated once at the initial time and IGF2BP1-inhibited TCam-2/CDDP cells were inoculated every 3 days).
Response Summary	METTL3 potentiates resistance to cisplatin through m6A modification of Transcription factor AP-2 gamma (TFAP2C) in seminoma. Enhanced stability of TFAP2C mRNA promoted seminoma cell survival under cisplatin treatment burden probably through up-regulation of DNA repair-related genes. IGF2BP1 binds to TFAP2C and enhances TFAP2C mRNA stability.

Transcription factor E2F3 (E2F3)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	HepG2 cell line	Homo sapiens
Treatment: siIGF2BP1 HepG2 cells Control: siControl HepG2 cells		GSE161086
Regulation		logFC: -8.52E-01 p-value: 2.50E-03
More Results	Click to View More RNA-seq Results

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Cell Process	Cell apoptosis
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	NCI-H520	Lung squamous cell carcinoma	Homo sapiens	CVCL_1566
	HBE (Human bronchial epithelial cell line)
	LTEP-a2	Endocervical adenocarcinoma	Homo sapiens	CVCL_6929
	SK-MES-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_0630
Response Summary	GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including Transcription factor E2F3 (E2F3), WTAP, CCND1, CDK4, EGR2, YBX1, and TLX, which were associated with lung cancers.

Transcription factor SOX-2 (SOX2)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	A549 cell line	Homo sapiens
Treatment: IGF2BP1 knockout A549 cells Control: Wild type A549 cells		GSE146546
Regulation		logFC: -2.55E+00 p-value: 6.23E-05
More Results	Click to View More RNA-seq Results

Endometrial cancer [ICD-11: 2C76]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[16]
Responsed Disease	Endometrial cancer [ICD-11: 2C76]
Target Regulation	Up regulation
Cell Process	RNA stability
In-vitro Model	Ishikawa	Endometrial adenocarcinoma	Homo sapiens	CVCL_2529
In-vitro Model	ECC-1	Endometrial Cancer	Homo sapiens	CVCL_7260
In-vivo Model	Nude mice were subcutaneously injected with 1 × 10⁷ PADI2 depleted or IGF2BP1 depleted Ishikawa cells on the left flanks, and the corresponding control cells on the right flanks.
Response Summary	Dysregulation of IGF2BP1 by PADI2/MEK1/ERK signaling results in abnormal accumulation of oncogenic Transcription factor SOX-2 (SOX2) expression, therefore supporting the malignant state of EC.

Translocation protein SEC62 (SEC62)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	HepG2 cell line	Homo sapiens
Treatment: siIGF2BP1 HepG2 cells Control: siControl HepG2 cells		GSE161086
Regulation		logFC: -8.16E-01 p-value: 3.16E-03
More Results	Click to View More RNA-seq Results

Gastric cancer [ICD-11: 2B72]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[17]
Responsed Disease	Gastric cancer [ICD-11: 2B72]
Target Regulation	Up regulation
Pathway Response	Protein processing in endoplasmic reticulum			hsa04141
Cell Process	RNA stability
Cell Process	Cell apoptosis
In-vitro Model	GES-1	Normal	Homo sapiens	CVCL_EQ22
	HGC-27	Gastric carcinoma	Homo sapiens	CVCL_1279
	MGC-803	Gastric mucinous adenocarcinoma	Homo sapiens	CVCL_5334
	MKN45	Gastric adenocarcinoma	Homo sapiens	CVCL_0434
	MKN45	Gastric adenocarcinoma	Homo sapiens	CVCL_0434
Response Summary	miR-4429 prevented gastric cancer progression through targeting METTL3 to inhibit m6A-caused stabilization of Translocation protein SEC62 (SEC62), indicating miR-4429 as a promising target for treatment improvement for Gastric cancer. METTL3 interacted with SEC62 to induce the m6A on SEC62 mRNA, therefore facilitated the stabilizing effect of IGF2BP1 on SEC62 mRNA.

Tyrosine-protein kinase JAK2 (JAK2)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	HepG2 cell line	Homo sapiens
Treatment: siIGF2BP1 HepG2 cells Control: siControl HepG2 cells		GSE161086
Regulation		logFC: -1.30E+00 p-value: 1.73E-03
More Results	Click to View More RNA-seq Results

Atherosclerosis [ICD-11: BD40]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[14]
Responsed Disease	Atherosclerosis [ICD-11: BD40.Z]
Target Regulation	Up regulation
Pathway Response	JAK-STAT signaling pathway			hsa04630
Cell Process	Cell proliferation and migration
In-vitro Model	HUVEC-C	Normal	Homo sapiens	CVCL_2959
In-vivo Model	The adeno-associated viruses (AAV) that could silence METTL3 (sh-METTL3) and the negative control adeno-associated viruses (sh-NC) were obtained from WZ Biosciences Inc. (Jinan, China). APOE^-/- mice were randomly divided into AS + sh-NC and AS + sh-METTL3 groups. Each group contains five mice. Mice were fed with the standard diet for 1 week to acclimatize. After 1 week of acclimation, mice were challenged with a high-fat and high-cholesterol feed H10540 (Beijing HFK BIOSCIENCE Co., Ltd., Beijing, China). The formula of the H10540 feed was shown in Supplementary File S1. After 8 weeks of HFD feeding, sh-NC or sh-METTL3 adeno-associated virus serotype 9 (AAV9, 1012 viral genome copies per mouse) were respectively delivered into mice in AS + sh-NC or AS + sh-METTL3 group through tail vein injection. At 14 weeks after HDF feeding, mice fasted overnight.
Response Summary	METTL3 knockdown prevented Atherosclerosis progression by inhibiting Tyrosine-protein kinase JAK2 (JAK2)/STAT3 pathway via IGF2BP1.

Ubiquitin-like modifier-activating enzyme 6 (UBA6)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	PANC-1 cell line	Homo sapiens
Treatment: siIGF2BP1 PANC-1 cells Control: siControl PANC-1 cells		GSE161087
Regulation		logFC: -1.00E+00 p-value: 7.50E-03
More Results	Click to View More RNA-seq Results

Ovarian cancer [ICD-11: 2C73]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[18]
Responsed Disease	Ovarian cancer [ICD-11: 2C73]
Target Regulation	Up regulation
In-vitro Model	SK-OV-3	Ovarian serous cystadenocarcinoma	Homo sapiens	CVCL_0532
In-vitro Model	OVCAR-3	Ovarian serous adenocarcinoma	Homo sapiens	CVCL_0465
Response Summary	IGF2BP1 was identified as the m6A reader protein of UBA6-AS1-RBM15-mediated m6A modification of Ubiquitin-like modifier-activating enzyme 6 (UBA6) mRNA, which enhanced the stability of UBA6 mRNA. UBA6-AS1 suppressed the proliferation, migration and invasion of OC cells via UBA6.

Y-box-binding protein 1 (YBX1)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	PANC-1 cell line	Homo sapiens
Treatment: siIGF2BP1 PANC-1 cells Control: siControl PANC-1 cells		GSE161087
Regulation		logFC: -6.25E-01 p-value: 4.95E-03
More Results	Click to View More RNA-seq Results

Malignant haematopoietic neoplasm [ICD-11: 2B33]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[2]
Responsed Disease	Myeloid leukaemia [ICD-11: 2B33.1]
Target Regulation	Up regulation
Cell Process	Cell apoptosis
In-vitro Model	Leukemia stem cell line (Leukemia stem cell line)
	Kasumi-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_0589
	MOLM-13	Adult acute myeloid leukemia	Homo sapiens	CVCL_2119
	THP-1	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0006
	MV4-11	Childhood acute monocytic leukemia	Homo sapiens	CVCL_0064
	BV-173	Chronic myelogenous leukemia	Homo sapiens	CVCL_0181
	NOMO-1	Adult acute monocytic leukemia	Homo sapiens	CVCL_1609
	K-562	Chronic myelogenous leukemia	Homo sapiens	CVCL_0004
	KG-1a	Adult acute myeloid leukemia	Homo sapiens	CVCL_1824
Response Summary	Y-box-binding protein 1 (YBX1) selectively functions in regulating survival of myeloid leukemia cells. YBX1 interacts with insulin-like growth factor 2 messenger RNA (mRNA)-binding proteins (IGF2BPs) and stabilizes m6A-tagged RNA. YBX1 deficiency dysregulates the expression of apoptosis-related genes and promotes mRNA decay of MYC and BCL2 in an m6A-dependent manner, which contributes to the defective survival that results from deletion of YBX1.

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Cell Process	Cell apoptosis
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	NCI-H520	Lung squamous cell carcinoma	Homo sapiens	CVCL_1566
	HBE (Human bronchial epithelial cell line)
	LTEP-a2	Endocervical adenocarcinoma	Homo sapiens	CVCL_6929
	SK-MES-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_0630
Response Summary	GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, CCND1, CDK4, EGR2, Y-box-binding protein 1 (YBX1), and TLX, which were associated with lung cancers.

Complex I-AGGG (NDUFB2)

Target Gene

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[19]
Responsed Disease	Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation	Down regulation
Pathway Response	Ubiquitin mediated proteolysis			hsa04120
Cell Process	Tumour immunology
Cell Process	Ubiquitination degradation
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	BEAS-2B	Normal	Homo sapiens	CVCL_0168
	NCI-H1299	Lung large cell carcinoma	Homo sapiens	CVCL_0060
	NCI-H1650	Minimally invasive lung adenocarcinoma	Homo sapiens	CVCL_1483
	NCI-H1703	Lung squamous cell carcinoma	Homo sapiens	CVCL_1490
	NCI-H1975	Lung adenocarcinoma	Homo sapiens	CVCL_1511
	NCI-H460	Lung large cell carcinoma	Homo sapiens	CVCL_0459
	HCC827	Lung adenocarcinoma	Homo sapiens	CVCL_2063
	LL/2 (LLC1)	Malignant tumors	Mus musculus	CVCL_4358
In-vivo Model	A549 cells were transfected with the pZW1-FCS-circNDUFB2 plasmid or pZW1-FCS-Vector plasmid, and selected with G418 (800 ug/ml) for 4 weeks, and then 2 × 10⁶ A549 cells were subcutaneously injected into the right flank of each mouse.
Response Summary	Complex I-AGGG (NDUFB2) interacts with IGF2BP1/2/3 in NSCLC cells. circNDUFB2 participates in the degradation of IGF2BPs and activation of anti-tumor immunity during NSCLC progression via the modulation of both protein ubiquitination and degradation, as well as cellular immune responses.

E3 SUMO-protein ligase EGR2 (EGR2)

Target Gene

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Cell Process	Cell apoptosis
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	NCI-H520	Lung squamous cell carcinoma	Homo sapiens	CVCL_1566
	HBE (Human bronchial epithelial cell line)
	LTEP-a2	Endocervical adenocarcinoma	Homo sapiens	CVCL_6929
	SK-MES-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_0630
Response Summary	GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, CCND1, CDK4, E3 SUMO-protein ligase EGR2 (EGR2), YBX1, and TLX, which were associated with lung cancers.

G1/S-specific cyclin-D1 (CCND1)

Target Gene

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Cell Process	Cell apoptosis
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	NCI-H520	Lung squamous cell carcinoma	Homo sapiens	CVCL_1566
	HBE (Human bronchial epithelial cell line)
	LTEP-a2	Endocervical adenocarcinoma	Homo sapiens	CVCL_6929
	SK-MES-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_0630
Response Summary	GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, G1/S-specific cyclin-D1 (CCND1), CDK4, EGR2, YBX1, and TLX, which were associated with lung cancers.

Mammalian target of rapamycin complex 2 (mTORC2)

Target Gene

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[20]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Pathway Response	Chemical carcinogenesis - DNA adducts			hsa05204
Cell Process	Malignant transformation
In-vitro Model	BEAS-2B	Normal	Homo sapiens	CVCL_0168
In-vivo Model	Twenty 5-week-old male nude mice were randomly divided into two groups and injected with either 2B-NNK or 2B-C cells. Tumor growth was measured every 3 days.
Response Summary	NNK is a Group 1 human carcinogen, as classified by the International Agency for Research of Cancer (IARC), and plays a significant role in lung carcinogenesis. However IGF2BP1 is involved in the NNK-induced malignant transformation of Beas-2B cells, via m6A modification.

Nuclear receptor subfamily 2 group E member 1 (TLX/NR2E1)

Target Gene

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Cell Process	Cell apoptosis
In-vitro Model	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
	NCI-H520	Lung squamous cell carcinoma	Homo sapiens	CVCL_1566
	HBE (Human bronchial epithelial cell line)
	LTEP-a2	Endocervical adenocarcinoma	Homo sapiens	CVCL_6929
	SK-MES-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_0630
Response Summary	GSEA revealed that KIAA1429, METTL3, and IGF2BP1 were significantly related to multiple biological behaviors, including proliferation, apoptosis, metastasis, energy metabolism, drug resistance, and recurrence, and that KIAA1429 and IGF2BP1 had potential target genes, including E2F3, WTAP, CCND1, CDK4, EGR2, YBX1, and Nuclear receptor subfamily 2 group E member 1 (TLX/NR2E1), which were associated with lung cancers.

Transcriptional activator Myb (MYB)

Target Gene

Acute myeloid leukaemia [ICD-11: 2A60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[1]
Responsed Disease	Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation	Up regulation
In-vitro Model	MOLT-16	T acute lymphoblastic leukemia	Homo sapiens	CVCL_1424
	Reh	B acute lymphoblastic leukemia	Homo sapiens	CVCL_1650
	SKNO-1	Myeloid leukemia with maturation	Homo sapiens	CVCL_2196
	Tanoue	B acute lymphoblastic leukemia	Homo sapiens	CVCL_1852
In-vivo Model	For the engraftment experiments, 1×10³ 1×10⁶ cells were injected into tail veins of non-irradiated 6-10 week-old female mice in 100 uL of DPBS per mouse. No blinding or randomization was applied to mice experiments. Routinely, each in vivo experiment was performed with three technical replicates (three mice per group) and independently repeated two to three times for each cell line.
Response Summary	IGF2BP1 decreases leukemia cells' tumorigenicity, promotes myeloid differentiation, increases leukemia cell death, and sensitizes acute myeloid leukemia cells to chemotherapeutic drugs. IGF2BP1 affects proliferation and tumorigenic potential of leukemia cells through critical regulators of self-renewal HOXB4 and Transcriptional activator Myb (MYB) and through regulation of expression of the aldehyde dehydrogenase, ALDH1A1.

UBA6 divergent transcript (UBA6-DT/UBA6-AS1)

Target Gene

Ovarian cancer [ICD-11: 2C73]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[18]
Responsed Disease	Ovarian cancer [ICD-11: 2C73]
Target Regulation	Up regulation
In-vitro Model	SK-OV-3	Ovarian serous cystadenocarcinoma	Homo sapiens	CVCL_0532
In-vitro Model	OVCAR-3	Ovarian serous adenocarcinoma	Homo sapiens	CVCL_0465
Response Summary	IGF2BP1 was identified as the m6A reader protein of UBA6 divergent transcript (UBA6-DT/UBA6-AS1)-RBM15-mediated m6A modification of UBA6 mRNA, which enhanced the stability of UBA6 mRNA. UBA6-AS1 suppressed the proliferation, migration and invasion of OC cells via UBA6.

Circ_MAP3K4

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[21]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Responsed Drug	Cisplatin		Approved	Drug Info
Target Regulation	Up regulation
Pathway Response	Ubiquitin mediated proteolysis			hsa04120
Cell Process	Proteasome pathway degradation
In-vitro Model	Huh-7	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0336
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	PLC/PRF/5	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0485
Response Summary	Driven by m6A modification, Circ_MAP3K4 encoded circMAP3K4-455aa, protected HCC cells from cisplatin exposure, and predicted worse prognosis of HCC patients. IGF2BP1 facilitates circMAP3K4 peptide translation, then the circMAP3K4 peptide inhibits AIF cleavage and nuclear distribution

Circ_PTPRA

Target Gene

Bladder cancer [ICD-11: 2C94]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[22]
Responsed Disease	Bladder cancer [ICD-11: 2C94]
Target Regulation	Up regulation
Cell Process	Cell proliferation
	Cell migration
	Cell invasion
In-vitro Model	T24T	Bladder carcinoma	Homo sapiens	CVCL_M892
	EJ (Human bladder cancer cells)
In-vivo Model	For melittin treatment study, 4-week-old female BALB/c nude mice were subcutaneously injected with 1 × 10⁷ T24 or BIU87 cells.
Response Summary	IGF2BP1 was predominantly binded with Circ_PTPRA in the cytoplasm in BC cells.

KB-1980E6.3

Target Gene

Breast cancer [ICD-11: 2C60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[10]
Responsed Disease	Breast cancer [ICD-11: 2C60]
Target Regulation	Up regulation
Pathway Response	Signaling pathways regulating pluripotency of stem cells			hsa04550
In-vitro Model	BT-474	Invasive breast carcinoma	Homo sapiens	CVCL_0179
	BT-549	Invasive breast carcinoma	Homo sapiens	CVCL_1092
	HEK293T	Normal	Homo sapiens	CVCL_0063
	Hs 578T	Invasive breast carcinoma	Homo sapiens	CVCL_0332
	MCF-7	Invasive breast carcinoma	Homo sapiens	CVCL_0031
	MDA-MB-231	Breast adenocarcinoma	Homo sapiens	CVCL_0062
	MDA-MB-453	Breast adenocarcinoma	Homo sapiens	CVCL_0418
	MDA-MB-468	Breast adenocarcinoma	Homo sapiens	CVCL_0419
	T-47D	Invasive breast carcinoma	Homo sapiens	CVCL_0553
In-vivo Model	The enriched mammosphere cells derived from engineered BT549 and Hs578T with silenced lncRNA KB-1980E6.3 (shKB/vector), BT549, and Hs578T with lncRNA KB-1980E6.3 knockdown combined with ectopic c-Myc (shKB/c-Myc), BT549, and Hs578T with silenced IGF2BP1 (shIGF2BP1/vector), BT549, and Hs578T with knocked down IGF2BP1 combined with ectopic c-Myc (shIGF2BP1/c-Myc), and BT549, and Hs578T/shNC/vector control cells were used in Xenograft experiments. Three doses (1 × 10⁵, 1 × 10⁴ and 1 × 10³) of spheres derived from the engineered Hs578T and 1 × 10⁵ of spheres derived from the engineered BT549 were subcutaneously inoculated into 4- to 6-week-old female nude mice (n = 5 per group). Mice were then treated with either bevacizumab (10 mg/kg every 3 days) to form a hypoxic tumor microenvironment or vehicle PBS to form a non-hypoxic condition
Response Summary	Hypoxia-induced lncRNA KB-1980E6.3 is involved in the self-renewal and stemness maintenance of breast cancer stem cells by recruiting IGF2BP1 to regulate c-Myc mRNA stability.

Transcription factor AP-2 gamma (TFAP2C)

Target Gene

*Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP1*
Cell Line	A549 cell line	Homo sapiens
Treatment: IGF2BP1 knockout A549 cells Control: Wild type A549 cells		GSE146546
Regulation		logFC: 6.39E-01 p-value: 1.76E-04
More Results	Click to View More RNA-seq Results

Cisplatin [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[15]
Responsed Disease	Testicular cancer		ICD-11: 2C80	Disease Info
Target Regulation	Up regulation
Pathway Response	Nucleotide excision repair			hsa03420
Cell Process	DNA repair
In-vitro Model	TCam-2	Testicular seminoma	Homo sapiens	CVCL_T012
In-vivo Model	Male mice were subcutaneously injected with tumour cells near the limbs to establish xenografts (1 × 10⁶/mouse, 0.2 mL for each injection site; METTL3-overexpressing TCam-2/CDDP cells were inoculated once at the initial time and IGF2BP1-inhibited TCam-2/CDDP cells were inoculated every 3 days).
Response Summary	METTL3 potentiates resistance to cisplatin through m6A modification of Transcription factor AP-2 gamma (TFAP2C) in seminoma. Enhanced stability of TFAP2C mRNA promoted seminoma cell survival under cisplatin treatment burden probably through up-regulation of DNA repair-related genes. IGF2BP1 binds to TFAP2C and enhances TFAP2C mRNA stability.

Circ_MAP3K4

Target Gene

Cisplatin [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[21]
Responsed Disease	Hepatocellular carcinoma		ICD-11: 2C12.02	Disease Info
Target Regulation	Up regulation
Pathway Response	Ubiquitin mediated proteolysis			hsa04120
Cell Process	Proteasome pathway degradation
In-vitro Model	Huh-7	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0336
	Hep-G2	Hepatoblastoma	Homo sapiens	CVCL_0027
	PLC/PRF/5	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0485
Response Summary	Driven by m6A modification, Circ_MAP3K4 encoded circMAP3K4-455aa, protected HCC cells from cisplatin exposure, and predicted worse prognosis of HCC patients. IGF2BP1 facilitates circMAP3K4 peptide translation, then the circMAP3K4 peptide inhibits AIF cleavage and nuclear distribution

Click to View Potential Drug Response of This Regulator

Xenobiotics Compound(s) Regulating the m6A Methylation Regulator

Compound Name	Betaine	Approved
Synonyms	Cystadane Click to Show/Hide
External link	CID: 247 TTD: D0XB8P DrugBank: DB06756
Description	MiR-670-3p functions as the regulator of Igf2bp1 expression and plays a crucial role inparthenogenetic activation development through m6A modification. The treatment with betaine could significantly restore the m6A level.	[23]
Compound Name	PMID34895045-Compound-7773	Investigative
Activity	IC50 = 30.45 uM	[24]

References

Ref 1	RNA-binding protein IGF2BP1 maintains leukemia stem cell properties by regulating HOXB4, MYB, and ALDH1A1. Leukemia. 2020 May;34(5):1354-1363. doi: 10.1038/s41375-019-0656-9. Epub 2019 Nov 25.
Ref 2	YBX1 is required for maintaining myeloid leukemia cell survival by regulating BCL2 stability in an m6A-dependent manner. Blood. 2021 Jul 8;138(1):71-85. doi: 10.1182/blood.2020009676.
Ref 3	Identification of pathology-specific regulators of m(6)A RNA modification to optimize lung cancer management in the context of predictive, preventive, and personalized medicine. EPMA J. 2020 Jul 29;11(3):485-504. doi: 10.1007/s13167-020-00220-3. eCollection 2020 Sep.
Ref 4	The N6-methyladenosine modification enhances ferroptosis resistance through inhibiting SLC7A11 mRNA deadenylation in hepatoblastoma. Clin Transl Med. 2022 May;12(5):e778. doi: 10.1002/ctm2.778.
Ref 5	Recognition of RNA N(6)-methyladenosine by IGF2BP proteins enhances mRNA stability and translation. Nat Cell Biol. 2018 Mar;20(3):285-295. doi: 10.1038/s41556-018-0045-z. Epub 2018 Feb 23.
Ref 6	IGF2BP1 Promotes Proliferation of Neuroendocrine Neoplasms by Post-Transcriptional Enhancement of EZH2. Cancers (Basel). 2022 Apr 24;14(9):2121. doi: 10.3390/cancers14092121.
Ref 7	Long non-coding RNA ILF3-AS1 facilitates hepatocellular carcinoma progression by stabilizing ILF3 mRNA in an m(6)A-dependent manner. Hum Cell. 2021 Nov;34(6):1843-1854. doi: 10.1007/s13577-021-00608-x. Epub 2021 Sep 7.
Ref 8	METTL3/IGF2BP1/CD47 contributes to the sublethal heat treatment induced mesenchymal transition in HCC. Biochem Biophys Res Commun. 2021 Mar 26;546:169-177. doi: 10.1016/j.bbrc.2021.01.085. Epub 2021 Feb 12.
Ref 9	N(6)-methyladenosine (m(6)A) reader IGF2BP1 accelerates gastric cancer aerobic glycolysis in c-Myc-dependent manner. Exp Cell Res. 2022 Aug 1;417(1):113176. doi: 10.1016/j.yexcr.2022.113176. Epub 2022 Apr 27.
Ref 10	A novel hypoxic long noncoding RNA KB-1980E6.3 maintains breast cancer stem cell stemness via interacting with IGF2BP1 to facilitate c-Myc mRNA stability. Oncogene. 2021 Mar;40(9):1609-1627. doi: 10.1038/s41388-020-01638-9. Epub 2021 Jan 19.
Ref 11	METTL3 Promotes Tumorigenesis and Metastasis through BMI1 m(6)A Methylation in Oral Squamous Cell Carcinoma. Mol Ther. 2020 Oct 7;28(10):2177-2190. doi: 10.1016/j.ymthe.2020.06.024. Epub 2020 Jun 24.
Ref 12	IGF2BP1 overexpression stabilizes PEG10 mRNA in an m6A-dependent manner and promotes endometrial cancer progression. Theranostics. 2021 Jan 1;11(3):1100-1114. doi: 10.7150/thno.49345. eCollection 2021.
Ref 13	IGF2BP1 promotes SRF-dependent transcription in cancer in a m6A- and miRNA-dependent manner. Nucleic Acids Res. 2019 Jan 10;47(1):375-390. doi: 10.1093/nar/gky1012.
Ref 14	N6-Methyladenosine Methyltransferase METTL3 Promotes Angiogenesis and Atherosclerosis by Upregulating the JAK2/STAT3 Pathway via m6A Reader IGF2BP1. Front Cell Dev Biol. 2021 Dec 7;9:731810. doi: 10.3389/fcell.2021.731810. eCollection 2021.
Ref 15	METTL3 potentiates resistance to cisplatin through m(6) A modification of TFAP2C in seminoma. J Cell Mol Med. 2020 Oct;24(19):11366-11380. doi: 10.1111/jcmm.15738. Epub 2020 Aug 28.
Ref 16	PADI2-Catalyzed MEK1 Citrullination Activates ERK1/2 and Promotes IGF2BP1-Mediated SOX2 mRNA Stability in Endometrial Cancer. Adv Sci (Weinh). 2021 Jan 29;8(6):2002831. doi: 10.1002/advs.202002831. eCollection 2021 Mar.
Ref 17	MiR-4429 prevented gastric cancer progression through targeting METTL3 to inhibit m(6)A-caused stabilization of SEC62. Biochem Biophys Res Commun. 2019 Oct 1;517(4):581-587. doi: 10.1016/j.bbrc.2019.07.058. Epub 2019 Aug 5.
Ref 18	Long noncoding RNA UBA6-AS1 inhibits the malignancy of ovarian cancer cells via suppressing the decay of UBA6 mRNA. Bioengineered. 2022 Jan;13(1):178-189. doi: 10.1080/21655979.2021.2011640.
Ref 19	circNDUFB2 inhibits non-small cell lung cancer progression via destabilizing IGF2BPs and activating anti-tumor immunity. Nat Commun. 2021 Jan 12;12(1):295. doi: 10.1038/s41467-020-20527-z.
Ref 20	Involvement of m6A regulatory factor IGF2BP1 in malignant transformation of human bronchial epithelial Beas-2B cells induced by tobacco carcinogen NNK. Toxicol Appl Pharmacol. 2022 Feb 1;436:115849. doi: 10.1016/j.taap.2021.115849. Epub 2021 Dec 30.
Ref 21	A novel peptide encoded by N6-methyladenosine modified circMAP3K4 prevents apoptosis in hepatocellular carcinoma. Mol Cancer. 2022 Apr 2;21(1):93. doi: 10.1186/s12943-022-01537-5.
Ref 22	CircPTPRA blocks the recognition of RNA N(6)-methyladenosine through interacting with IGF2BP1 to suppress bladder cancer progression. Mol Cancer. 2021 Apr 14;20(1):68. doi: 10.1186/s12943-021-01359-x.
Ref 23	microRNA-670 modulates Igf2bp1 expression to regulate RNA methylation in parthenogenetic mouse embryonic development. Sci Rep. 2020 Mar 16;10(1):4782. doi: 10.1038/s41598-020-61816-3.
Ref 24	Small molecule inhibitor of Igf2bp1 represses Kras and a pro-oncogenic phenotype in cancer cells. RNA Biol. 2022;19(1):26-43. doi: 10.1080/15476286.2021.2010983. Epub 2021 Dec 31.

m6A Regulator Information

Cite M6AREG

Correspondence

Prof. Feng ZHU

Prof. Shuiping Liu

Visitor Map