m6A Regulator Information

General Information of the m6A Regulator (ID: REG00004)
Regulator Name Heterogeneous nuclear ribonucleoproteins A2/B1 (HNRNPA2B1)
Synonyms
hnRNP A2/B1; HNRPA2B1
    Click to Show/Hide
Gene Name HNRNPA2B1
Sequence
MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKR
SRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIK
EDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGH
NAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGF
GDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNY
NDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY
    Click to Show/Hide
Function
Heterogeneous nuclear ribonucleoprotein (hnRNP) that associates with nascent pre-mRNAs, packaging them into hnRNP particles. The hnRNP particle arrangement on nascent hnRNA is non-random and sequence-dependent and serves to condense and stabilize the transcripts and minimize tangling and knotting. Packaging plays a role in various processes such as transcription, pre-mRNA processing, RNA nuclear export, subcellular location, mRNA translation and stability of mature mRNAs. Forms hnRNP particles with at least 20 other different hnRNP and heterogeneous nuclear RNA in the nucleus. Involved in transport of specific mRNAs to the cytoplasm in oligodendrocytes and neurons: acts by specifically recognizing and binding the A2RE (21 nucleotide hnRNP A2 response element) or the A2RE11 (derivative 11 nucleotide oligonucleotide) sequence motifs present on some mRNAs, and promotes their transport to the cytoplasm. Specifically binds single-stranded telomeric DNA sequences, protecting telomeric DNA repeat against endonuclease digestion (By similarity). Also binds other RNA molecules, such as primary miRNA (pri-miRNAs): acts as a nuclear 'reader' of the N6-methyladenosine (m6A) mark by specifically recognizing and binding a subset of nuclear m6A-containing pri-miRNAs. Binding to m6A-containing pri-miRNAs promotes pri-miRNA processing by enhancing binding of DGCR8 to pri-miRNA transcripts. Involved in miRNA sorting into exosomes following sumoylation, possibly by binding (m6A)-containing pre-miRNAs. Acts as a regulator of efficiency of mRNA splicing, possibly by binding to m6A-containing pre-mRNAs. Plays a role in the splicing of pyruvate kinase PKM by binding repressively to sequences flanking PKM exon 9, inhibiting exon 9 inclusion and resulting in exon 10 inclusion and production of the PKM M2 isoform. Also plays a role in the activation of the innate immune response. Mechanistically, senses the presence of viral DNA in the nucleus, homodimerizes and is demethylated by JMJD6. In turn, translocates to the cytoplasm where it activates the TBK1-IRF3 pathway, leading to interferon alpha/beta production; (Microbial infection) Involved in the transport of HIV-1 genomic RNA out of the nucleus, to the microtubule organizing center (MTOC), and then from the MTOC to the cytoplasm: acts by specifically recognizing and binding the A2RE (21 nucleotide hnRNP A2 response element) sequence motifs present on HIV-1 genomic RNA, and promotes its transport.
    Click to Show/Hide
Gene ID 3181
Uniprot ID
ROA2_HUMAN
Regulator Type WRITER ERASER READER
Mechanism Diagram Click to View the Original Diagram
Target Genes Click to View Potential Target Genes of This Regulator
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
HNRNPA2B1 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Browse Target Gene related Drug
ATP-citrate synthase (ACLY)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by HNRNPA2B1
Cell Line HeLa cell line Homo sapiens
Treatment: HNRNPA2B1 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: 7.79E-01
p-value: 2.27E-02
More Results Click to View More RNA-seq Results
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Esophageal cancer [ICD-11: 2B70]
Target Regulation Up regulation
Pathway Response Metabolic pathways hsa01100
Cell Process Fatty acid synthesis
In-vitro Model
 TE-10 Esophageal squamous cell carcinoma Homo sapiens CVCL_1760
Eca-109 Esophageal squamous cell carcinoma Homo sapiens CVCL_6898
Response Summary The levels of m6A and its regulator HNRNPA2B1 were significantly increased in cancerous tissues of esophageal cancer(ESCA), and overexpression of HNRNPA2B1 promotes ESCA progression via up-regulation of de novo fatty acid synthetic enzymes ATP-citrate synthase (ACLY) and ACC1.
E3 ubiquitin-protein ligase SIAH1 (SIAH1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by HNRNPA2B1
Cell Line c2c12 cell line Mus musculus
Treatment: HNRNPA2B1 knockout c2c12 cells
Control: WT c2c12 cells
 GSE152467
Regulation
logFC: 1.19E+00
p-value: 5.63E-11
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
Pathway Response Proteasome hsa03050
Cell Process Proteasomal degradation
In-vitro Model
 DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCT 15 Colon adenocarcinoma Homo sapiens CVCL_0292
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
RKO Colon carcinoma Homo sapiens CVCL_0504
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
In-vivo Model HCT-15 RP11 stable overexpression or control cells (2 × 106 per mouse) diluted in 100 uL normal medium + 100 uL Matrigel (BD Biosciences) were subcutaneously injected into immunodeficient mice to investigate tumour growth.
Response Summary The RP11/hnRNPA2B1/mRNA complex accelerated the mRNA degradation of two E3 ligases, E3 ubiquitin-protein ligase SIAH1 (SIAH1) and Fbxo45, and subsequently prevented the proteasomal degradation of Zeb1. m6A can regulate the expression of RP11, further, RP11 regulated Siah1-Fbxo45/Zeb1 was involved in the development of Colorectal cancer.
Ephrin type-B receptor 2 (ERK/EPHB2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by HNRNPA2B1
Cell Line MDA-MB-231 Homo sapiens
Treatment: HNRNPA2B1 knockdown MDA-MB-231 cells
Control: MDA-MB-231 cells
 GSE70061
Regulation
logFC: 6.38E-01
p-value: 4.72E-02
More Results Click to View More RNA-seq Results
Colon cancer [ICD-11: 2B90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Colon cancer [ICD-11: 2B90]
Target Regulation Up regulation
Pathway Response MAPK signaling hsa04010
Apoptosis hsa04210
Cell Process Arrest cell cycle at G0/G1 phase
Cell apoptosis
In-vitro Model
 HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
In-vivo Model Four-week-old male BALB/c nude mice (purchased from Lingchang company) were randomly divided into three groups, each group has five mice. Each of the mice was injected subcutaneously on the right lateral back with 1 × 106 of each lentivirus infected SW480 cells in which hnRNPA2B1 was knocked out or negative control cells. Mice were killed at day 29, and tumors were then isolated, photographed.
Response Summary hnRNPA2B1 promotes colon cancer progression via the MAPK pathway. hnRNPA2B1 is an upstream regulator of the Ephrin type-B receptor 2 (ERK/EPHB2)/MAPK pathway and inhibition of MAPK signaling blocked the effects of hnRNPA2B1.
Hepatitis A virus cellular receptor 2 (HAVCR2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by HNRNPA2B1
Cell Line Motor neurons Mus musculus
Treatment: hnRNPA2/B1 mutated spinal cord
Control: Mouse spinal cord
 GSE86043
Regulation
logFC: 6.16E-01
p-value: 1.29E-02
More Results Click to View More RNA-seq Results
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
In-vitro Model
 U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
Response Summary HNRNPA2B1 and HNRNPC were extensively expressed in the Glioblastoma multiforme(GBM) microenvironment.m6A regulators promoted the stemness state in GBM cancer cells. Cell communication analysis identified genes in the GALECTIN signaling network in GBM samples, and expression of these genes (LGALS9, CD44, CD45, and Hepatitis A virus cellular receptor 2 (HAVCR2)) correlated with that of m6A regulators.
RAC-gamma serine/threonine-protein kinase (AKT3)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by HNRNPA2B1
Cell Line c2c12 cell line Mus musculus
Treatment: HNRNPA2B1 knockout c2c12 cells
Control: WT c2c12 cells
 GSE152467
Regulation
logFC: -6.81E-01
p-value: 1.74E-03
More Results Click to View More RNA-seq Results
Multiple myeloma [ICD-11: 2A83]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [5]
Responsed Disease Multiple myeloma [ICD-11: 2A83.1]
Target Regulation Up regulation
Pathway Response Apoptosis hsa04210
Cell Process Cell proliferation
Cell apoptosis
In-vitro Model
 NCI-H929 Plasma cell myeloma Homo sapiens CVCL_1600
Response Summary m6A-dependent effect of HNRNPA2B1 on regulating AKT signaling pathway and the correlation between HNRNPA2B1 and multiple myeloma cell growth. HNRNPA2B1 recognized the m6A sites of ILF3 and enhanced the stability of ILF3 mRNA transcripts, while RAC-gamma serine/threonine-protein kinase (AKT3) downregulation by siRNA abrogated the cellular proliferation induced by HNRNPA2B1 overexpression.
Receptor-type tyrosine-protein phosphatase C (CD45)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by HNRNPA2B1
Cell Line MDA-MB-231 Homo sapiens
Treatment: HNRNPA2B1 knockdown MDA-MB-231 cells
Control: MDA-MB-231 cells
 GSE70061
Regulation
logFC: -6.37E-01
p-value: 1.03E-02
More Results Click to View More RNA-seq Results
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
In-vitro Model
 U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
Response Summary HNRNPA2B1 and HNRNPC were extensively expressed in the Glioblastoma multiforme(GBM) microenvironment.m6A regulators promoted the stemness state in GBM cancer cells. Cell communication analysis identified genes in the GALECTIN signaling network in GBM samples, and expression of these genes (LGALS9, CD44, Receptor-type tyrosine-protein phosphatase C (CD45), and HAVCR2) correlated with that of m6A regulators.
Secreted frizzled-related protein 2 (SFRP2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by HNRNPA2B1
Cell Line c2c12 cell line Mus musculus
Treatment: HNRNPA2B1 knockout c2c12 cells
Control: WT c2c12 cells
 GSE152467
Regulation
logFC: 9.22E+00
p-value: 5.06E-12
More Results Click to View More RNA-seq Results
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Down regulation
Pathway Response Wnt signaling pathway hsa04310
In-vitro Model
 NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model A549 cells were transfected with lentivirus-packaged sh-HNRNPA2B1 (lv-sh-HNRNPA2B1) or control (lv-shCtrl). Then, each mouse was injected subcutaneously with A549 cells of indicated transfection group to generate xenografts. The tumor volume ((width2 × length)/2) was evaluated 4 days a time until 28 days.
Response Summary HNRNPA2B1 inhibits Secreted frizzled-related protein 2 (SFRP2) and activates Wnt-Beta/catenin via m6A-mediated maturing of miR-106b-5p to aggravate stemness and LUAD progression.
Transcription factor 7-like 2 (TCF7L2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by HNRNPA2B1
Cell Line HeLa cell line Homo sapiens
Treatment: HNRNPA2B1 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: 2.87E+00
p-value: 4.26E-02
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Cetuximab Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 VACO 9P Rectal adenocarcinoma Homo sapiens CVCL_5413
T84 Colon adenocarcinoma Homo sapiens CVCL_0555
SW948 Colon adenocarcinoma Homo sapiens CVCL_0632
SW837 Rectal adenocarcinoma Homo sapiens CVCL_1729
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW48 Colon adenocarcinoma Homo sapiens CVCL_1724
SW403 Colon adenocarcinoma Homo sapiens CVCL_0545
SW1116 Colon adenocarcinoma Homo sapiens CVCL_0544
SK-CO-1 Colon adenocarcinoma Homo sapiens CVCL_0626
RKO Colon carcinoma Homo sapiens CVCL_0504
NCI-H716 Cecum adenocarcinoma Homo sapiens CVCL_1581
NCI-H508 Cecum adenocarcinoma Homo sapiens CVCL_1564
LS174T Colon adenocarcinoma Homo sapiens CVCL_1384
LS123 Colon adenocarcinoma Homo sapiens CVCL_1383
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
LIM2405 Cecum adenocarcinoma Homo sapiens CVCL_4437
LIM1215 Colon adenocarcinoma Homo sapiens CVCL_2574
HuTu 80 Duodenal adenocarcinoma Homo sapiens CVCL_1301
HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
HCT 15 Colon adenocarcinoma Homo sapiens CVCL_0292
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
GEO Colon carcinoma Homo sapiens CVCL_0271
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
DiFi Colorectal carcinoma Homo sapiens CVCL_6895
COLO 320DM Colon adenocarcinoma Homo sapiens CVCL_0219
COLO 205 Colon adenocarcinoma Homo sapiens CVCL_0218
Caco-2 Colon adenocarcinoma Homo sapiens CVCL_0025
In-vivo Model Established subcutaneous xenografts in athymic nude mice with MIR100HGKOE4 CC-CR cells transduced with a luciferase-expressing lentiviral vector and then treated the mice with cetuximab.
Response Summary MIR100HG and hnRNPA2B1 interact to control the transcriptional activity of Wnt signaling in CRC via regulation of Transcription factor 7-like 2 (TCF7L2) mRNA stability. These findings identified MIR100HG as a potent EMT inducer in CRC that contribute to cetuximab resistance and metastasis by activation of a MIR100HG/hnRNPA2B1/TCF7L2 feedback loop.
Zinc finger E-box-binding homeobox 1 (ZEB1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by HNRNPA2B1
Cell Line c2c12 cell line Mus musculus
Treatment: HNRNPA2B1 knockout c2c12 cells
Control: WT c2c12 cells
 GSE152467
Regulation
logFC: -7.64E-01
p-value: 1.43E-05
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Proteasome hsa03050
Cell Process Proteasomal degradation
In-vitro Model
 DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCT 15 Colon adenocarcinoma Homo sapiens CVCL_0292
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
RKO Colon carcinoma Homo sapiens CVCL_0504
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
In-vivo Model HCT-15 RP11 stable overexpression or control cells (2 × 106 per mouse) diluted in 100 uL normal medium + 100 uL Matrigel (BD Biosciences) were subcutaneously injected into immunodeficient mice to investigate tumour growth.
Response Summary The RP11/hnRNPA2B1/mRNA complex accelerated the mRNA degradation of two E3 ligases, Siah1 and Fbxo45, and subsequently prevented the proteasomal degradation of Zinc finger E-box-binding homeobox 1 (ZEB1). m6A can regulate the expression of RP11, further, RP11 regulated Siah1-Fbxo45/Zeb1 was involved in the development of Colorectal cancer.
Acetyl-CoA carboxylase 1 (ACC1/ACACA)
 Target Gene 
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Esophageal cancer [ICD-11: 2B70]
Target Regulation Up regulation
Pathway Response Metabolic pathways hsa01100
Cell Process Fatty acid synthesis
In-vitro Model
 TE-10 Esophageal squamous cell carcinoma Homo sapiens CVCL_1760
Eca-109 Esophageal squamous cell carcinoma Homo sapiens CVCL_6898
Response Summary The levels of m6A and its regulator HNRNPA2B1 were significantly increased in cancerous tissues of esophageal cancer(ESCA), and overexpression of HNRNPA2B1 promotes ESCA progression via up-regulation of de novo fatty acid synthetic enzymes ACLY and Acetyl-CoA carboxylase 1 (ACC1/ACACA).
CD44 antigen (CD44)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
In-vitro Model
 U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
Response Summary HNRNPA2B1 and HNRNPC were extensively expressed in the Glioblastoma multiforme(GBM) microenvironment.m6A regulators promoted the stemness state in GBM cancer cells. Cell communication analysis identified genes in the GALECTIN signaling network in GBM samples, and expression of these genes (LGALS9, CD44 antigen (CD44), CD45, and HAVCR2) correlated with that of m6A regulators.
F-box/SPRY domain-containing protein 1 (FBXO45)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Down regulation
Pathway Response Proteasome hsa03050
Cell Process Proteasomal degradation
In-vitro Model
 DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCT 15 Colon adenocarcinoma Homo sapiens CVCL_0292
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
RKO Colon carcinoma Homo sapiens CVCL_0504
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
In-vivo Model HCT-15 RP11 stable overexpression or control cells (2 × 106 per mouse) diluted in 100 uL normal medium + 100 uL Matrigel (BD Biosciences) were subcutaneously injected into immunodeficient mice to investigate tumour growth.
Response Summary The RP11/hnRNPA2B1/mRNA complex accelerated the mRNA degradation of two E3 ligases, Siah1 and F-box/SPRY domain-containing protein 1 (FBXO45), and subsequently prevented the proteasomal degradation of Zeb1. m6A can regulate the expression of RP11, further, RP11 regulated Siah1-Fbxo45/Zeb1 was involved in the development of Colorectal cancer.
Galectin-9 (LGALS9)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Glioblastoma [ICD-11: 2A00.00]
In-vitro Model
 U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
Response Summary HNRNPA2B1 and HNRNPC were extensively expressed in the Glioblastoma multiforme(GBM) microenvironment.m6A regulators promoted the stemness state in GBM cancer cells. Cell communication analysis identified genes in the GALECTIN signaling network in GBM samples, and expression of these genes (Galectin-9 (LGALS9), CD44, CD45, and HAVCR2) correlated with that of m6A regulators.
GTPase KRas (KRAS)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
Target Regulation Up regulation
Pathway Response Ras signaling pathway hsa04014
In-vitro Model
 HPDE6c7 Normal Homo sapiens CVCL_0P38
HEK293T Normal Homo sapiens CVCL_0063
HPAF-II Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0313
MPanc-96 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_7165
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
PaTu 8902 Pancreatic adenocarcinoma Homo sapiens CVCL_1845
PaTu 8988s Pancreatic adenocarcinoma Homo sapiens CVCL_1846
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
In-vivo Model HPAF-II cells (2.0 × 106 cells/site) stably transfected with sh-EGFP or sh-UCA1 were subcutaneously injected into 4-week-old nude mice to generate xenografts. The tumor volume was measured every week after injection and calculated using the following formula: length × (width2)/2.
Response Summary UCA1 increases GTPase KRas (KRAS) phosphorylation by interacting with hnRNPA2B1 and that UCA1 functions as a molecular sponge for miR-590-3p to promote KRAS expression. the UCA1-KRAS axis plays a crucial role in pancreatic ductal adenocarcinoma progression and that UCA1 serves as a target for new PDAC therapies.
Interleukin enhancer-binding factor 3 (ILF3)
 Target Gene 
Multiple myeloma [ICD-11: 2A83]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [5]
Responsed Disease Multiple myeloma [ICD-11: 2A83.1]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell apoptosis
In-vitro Model
 NCI-H929 Plasma cell myeloma Homo sapiens CVCL_1600
Response Summary m6A-dependent effect of HNRNPA2B1 on regulating AKT signaling pathway and the correlation between HNRNPA2B1 and multiple myeloma cell growth. HNRNPA2B1 recognized the m6A sites of Interleukin enhancer-binding factor 3 (ILF3) and enhanced the stability of ILF3 mRNA transcripts, while AKT3 downregulation by siRNA abrogated the cellular proliferation induced by HNRNPA2B1 overexpression.
Mitogen-activated protein kinase 1 (MAPK/ERK2/MAPK1)
 Target Gene 
Colon cancer [ICD-11: 2B90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Colon cancer [ICD-11: 2B90]
Target Regulation Up regulation
Pathway Response MAPK signaling hsa04010
Cell Process Arrest cell cycle at G0/G1 phase
Cell apoptosis
In-vitro Model
 HCT 116 Colon carcinoma Homo sapiens CVCL_0291
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
In-vivo Model Four-week-old male BALB/c nude mice (purchased from Lingchang company) were randomly divided into three groups, each group has five mice. Each of the mice was injected subcutaneously on the right lateral back with 1 × 106 of each lentivirus infected SW480 cells in which hnRNPA2B1 was knocked out or negative control cells. Mice were killed at day 29, and tumors were then isolated, photographed.
Response Summary hnRNPA2B1 promotes colon cancer progression via the MAPK pathway. hnRNPA2B1 is an upstream regulator of the ERK/Mitogen-activated protein kinase 1 (MAPK/ERK2/MAPK1) pathway and inhibition of MAPK signaling blocked the effects of hnRNPA2B1.
Breast cancer [ICD-11: 2C60]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Fulvestrant Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Cell Process Cell migration and invasion
In-vitro Model
 HCC1806 Breast squamous cell carcinoma Homo sapiens CVCL_1258
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MDA-MB-468 Breast adenocarcinoma Homo sapiens CVCL_0419
T-47D Invasive breast carcinoma Homo sapiens CVCL_0553
Response Summary In breast cancer, modest stable overexpression of A2B1 in MCF-7 cells (MCF-7-A2B1 cells) resulted in tamoxifen and fulvestrant- resistance whereas knockdown of A2B1 in LCC9 and LY2 cells restored tamoxifen and fulvestrant, endocrine-sensitivity. MCF-7-A2B1 cells have increased ER-alpha and reduced miR-222-3p that targets ER-alpha. MCF-7-A2B1 have activated AKT and Mitogen-activated protein kinase 1 (MAPK/ERK2/MAPK1) that depend on A2B1 expression and are growth inhibited by inhibitors of these pathways.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Tamoxifen Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Cell Process Cell migration and invasion
In-vitro Model
 HCC1806 Breast squamous cell carcinoma Homo sapiens CVCL_1258
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MDA-MB-468 Breast adenocarcinoma Homo sapiens CVCL_0419
T-47D Invasive breast carcinoma Homo sapiens CVCL_0553
Response Summary In breast cancer, modest stable overexpression of A2B1 in MCF-7 cells (MCF-7-A2B1 cells) resulted in tamoxifen and fulvestrant - resistance whereas knockdown of A2B1 in LCC9 and LY2 cells restored tamoxifen and fulvestrant, endocrine-sensitivity. MCF-7-A2B1 cells have increased ER-alpha and reduced miR-222-3p that targets ER-alpha. MCF-7-A2B1 have activated AKT and Mitogen-activated protein kinase 1 (MAPK/ERK2/MAPK1) that depend on A2B1 expression and are growth inhibited by inhibitors of these pathways.
Mothers against decapentaplegic homolog 2 (SMAD2)
 Target Gene 
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
In-vitro Model
 SCC-4 Tongue squamous cell carcinoma Homo sapiens CVCL_1684
CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
Response Summary HNRNPA2B1, as an m6A reader, is critical in OSCC development. Its expression is significantly associated with the prognosis of Oral Squamous Cell Carcinoma(OSCC). m6A acts as a proto-oncogene that promotes the OSCC proliferation, migration, and invasion through the EMT progression via the LINE-1/TGF-beta1/Snail/Mothers against decapentaplegic homolog 2 (SMAD2) signaling pathway.
RAC-alpha serine/threonine-protein kinase (AKT1)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Fulvestrant Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Cell Process Cell migration and invasion
In-vitro Model
 HCC1806 Breast squamous cell carcinoma Homo sapiens CVCL_1258
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MDA-MB-468 Breast adenocarcinoma Homo sapiens CVCL_0419
T-47D Invasive breast carcinoma Homo sapiens CVCL_0553
Response Summary In breast cancer, modest stable overexpression of A2B1 in MCF-7 cells (MCF-7-A2B1 cells) resulted in tamoxifen and fulvestrant- resistance whereas knockdown of A2B1 in LCC9 and LY2 cells restored tamoxifen and fulvestrant, endocrine-sensitivity. MCF-7-A2B1 cells have increased ER-alpha and reduced miR-222-3p that targets ER-alpha. MCF-7-A2B1 have activated RAC-alpha serine/threonine-protein kinase (AKT1) and MAPK that depend on A2B1 expression and are growth inhibited by inhibitors of these pathways.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Tamoxifen Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Cell Process Cell migration and invasion
In-vitro Model
 HCC1806 Breast squamous cell carcinoma Homo sapiens CVCL_1258
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MDA-MB-468 Breast adenocarcinoma Homo sapiens CVCL_0419
T-47D Invasive breast carcinoma Homo sapiens CVCL_0553
Response Summary In breast cancer, modest stable overexpression of A2B1 in MCF-7 cells (MCF-7-A2B1 cells) resulted in tamoxifen and fulvestrant - resistance whereas knockdown of A2B1 in LCC9 and LY2 cells restored tamoxifen and fulvestrant, endocrine-sensitivity. MCF-7-A2B1 cells have increased ER-alpha and reduced miR-222-3p that targets ER-alpha. MCF-7-A2B1 have activated RAC-alpha serine/threonine-protein kinase (AKT1) and MAPK that depend on A2B1 expression and are growth inhibited by inhibitors of these pathways.
Ribonuclease 3 (DROSHA)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Fulvestrant Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model
 MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes Ribonuclease 3 (DROSHA) processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and miR-222 and upregulated miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Tamoxifen Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model
 MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes Ribonuclease 3 (DROSHA) processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and miR-222 and upregulated miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
Transforming growth factor beta-1 proprotein (TGFB1)
 Target Gene 
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
In-vitro Model
 SCC-4 Tongue squamous cell carcinoma Homo sapiens CVCL_1684
CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
Response Summary HNRNPA2B1, as an m6A reader, is critical in OSCC development. Its expression is significantly associated with the prognosis of Oral Squamous Cell Carcinoma(OSCC). m6A acts as a proto-oncogene that promotes the OSCC proliferation, migration, and invasion through the EMT progression via the LINE-1/Transforming growth factor beta-1 proprotein (TGFB1)/Snail/Smad2 signaling pathway.
U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31/RP11)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Proteasome hsa03050
Cell Process Proteasomal degradation
In-vitro Model
 DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCT 15 Colon adenocarcinoma Homo sapiens CVCL_0292
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
RKO Colon carcinoma Homo sapiens CVCL_0504
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
In-vivo Model HCT-15 RP11 stable overexpression or control cells (2 × 106 per mouse) diluted in 100 uL normal medium + 100 uL Matrigel (BD Biosciences) were subcutaneously injected into immunodeficient mice to investigate tumour growth.
Response Summary The U4/U6 small nuclear ribonucleoprotein Prp31 (PRPF31/RP11)/hnRNPA2B1/mRNA complex accelerated the mRNA degradation of two E3 ligases, Siah1 and Fbxo45, and subsequently prevented the proteasomal degradation of Zeb1. m6A can regulate the expression of RP11, further, RP11 regulated Siah1-Fbxo45/Zeb1 was involved in the development of Colorectal cancer.
Zinc finger protein SNAI1 (SNAI1)
 Target Gene 
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
In-vitro Model
 SCC-4 Tongue squamous cell carcinoma Homo sapiens CVCL_1684
CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
Response Summary HNRNPA2B1, as an m6A reader, is critical in OSCC development. Its expression is significantly associated with the prognosis of Oral Squamous Cell Carcinoma(OSCC). m6A acts as a proto-oncogene that promotes the OSCC proliferation, migration, and invasion through the EMT progression via the LINE-1/TGF-beta1/Zinc finger protein SNAI1 (SNAI1)/Smad2 signaling pathway.
Urothelial cancer associated 1 (UCA1)
 Target Gene 
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Pancreatic ductal adenocarcinoma [ICD-11: 2C10.0]
Target Regulation Up regulation
Pathway Response Ras signaling pathway hsa04014
In-vitro Model
 HPDE6c7 Normal Homo sapiens CVCL_0P38
HEK293T Normal Homo sapiens CVCL_0063
HPAF-II Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0313
MPanc-96 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_7165
PANC-1 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0480
PaTu 8902 Pancreatic adenocarcinoma Homo sapiens CVCL_1845
PaTu 8988s Pancreatic adenocarcinoma Homo sapiens CVCL_1846
SW1990 Pancreatic adenocarcinoma Homo sapiens CVCL_1723
In-vivo Model HPAF-II cells (2.0 × 106 cells/site) stably transfected with sh-EGFP or sh-UCA1 were subcutaneously injected into 4-week-old nude mice to generate xenografts. The tumor volume was measured every week after injection and calculated using the following formula: length × (width2)/2.
Response Summary Urothelial cancer associated 1 (UCA1) increases KRAS phosphorylation by interacting with hnRNPA2B1 and that UCA1 functions as a molecular sponge for miR-590-3p to promote KRAS expression. the UCA1-KRAS axis plays a crucial role in pancreatic ductal adenocarcinoma progression and that UCA1 serves as a target for new PDAC therapies.
microRNA 211 (MIR211)
 Target Gene 
Adrenocortical carcinoma [ICD-11: 2D11]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Adrenocortical carcinoma [ICD-11: 2D11]
Response Summary Systematically analyzed 21 m6A regulators in adrenocortical carcinoma samples from The Cancer Genome Atlas (TCGA) and the Gene Expression Omnibus (GEO) database. Taking the intersection of these mRNAs and 21 m6A-related genes as potential functional molecules, these data indicated that 12 lncRNAs can dysregulate the behavior of microRNA 211 (MIR211) so that it promotes the expression of key m6A gene HNRNPA2B1.
microRNA 222 (MIR222)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Fulvestrant Approved
 Drug Info 
Target Regulation Down regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model
 MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and microRNA 222 (MIR222) and upregulated miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Tamoxifen Approved
 Drug Info 
Target Regulation Down regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model
 MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and microRNA 222 (MIR222) and upregulated miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
microRNA let-7b (MIRLET7B)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [13]
Responsed Disease Lung cancer [ICD-11: 2C25]
Responsed Drug Metformin Approved
 Drug Info 
Pathway Response Notch signaling pathway hsa04330
In-vitro Model
 NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
H1975OR (Osimertinib resistant H1975 cells)
HCC827OR (Osimertinib resistant HCC827 cells)
Response Summary the participation of Metformin decreased the bindings of DNMT3a/b to the METTL3 promoter with the help of the readers of NKAP and HNRNPA2B1.the mediation of m6A formation on pri-Let-7b processing increased the mature microRNA let-7b (MIRLET7B), whose key role is to suppress the Notch signaling and to re-captivate the Osimertinib treatment.The findings open up future drug development, targeting this pathway for lung cancer patients.
Mir-100-let-7a-2-mir-125b-1 cluster host gene (MIR100HG)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Cetuximab Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 VACO 9P Rectal adenocarcinoma Homo sapiens CVCL_5413
T84 Colon adenocarcinoma Homo sapiens CVCL_0555
SW948 Colon adenocarcinoma Homo sapiens CVCL_0632
SW837 Rectal adenocarcinoma Homo sapiens CVCL_1729
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW48 Colon adenocarcinoma Homo sapiens CVCL_1724
SW403 Colon adenocarcinoma Homo sapiens CVCL_0545
SW1116 Colon adenocarcinoma Homo sapiens CVCL_0544
SK-CO-1 Colon adenocarcinoma Homo sapiens CVCL_0626
RKO Colon carcinoma Homo sapiens CVCL_0504
NCI-H716 Cecum adenocarcinoma Homo sapiens CVCL_1581
NCI-H508 Cecum adenocarcinoma Homo sapiens CVCL_1564
LS174T Colon adenocarcinoma Homo sapiens CVCL_1384
LS123 Colon adenocarcinoma Homo sapiens CVCL_1383
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
LIM2405 Cecum adenocarcinoma Homo sapiens CVCL_4437
LIM1215 Colon adenocarcinoma Homo sapiens CVCL_2574
HuTu 80 Duodenal adenocarcinoma Homo sapiens CVCL_1301
HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
HCT 15 Colon adenocarcinoma Homo sapiens CVCL_0292
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
GEO Colon carcinoma Homo sapiens CVCL_0271
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
DiFi Colorectal carcinoma Homo sapiens CVCL_6895
COLO 320DM Colon adenocarcinoma Homo sapiens CVCL_0219
COLO 205 Colon adenocarcinoma Homo sapiens CVCL_0218
Caco-2 Colon adenocarcinoma Homo sapiens CVCL_0025
In-vivo Model Established subcutaneous xenografts in athymic nude mice with MIR100HGKOE4 CC-CR cells transduced with a luciferase-expressing lentiviral vector and then treated the mice with cetuximab.
Response Summary Mir-100-let-7a-2-mir-125b-1 cluster host gene (MIR100HG) and hnRNPA2B1 interact to control the transcriptional activity of Wnt signaling in CRC via regulation of TCF7L2 mRNA stability. These findings identified MIR100HG as a potent EMT inducer in CRC that will contribute to cetuximab resistance and metastasis by activation of a MIR100HG/hnRNPA2B1/TCF7L2 feedback loop.
hsa-miR-1266-5p
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Fulvestrant Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model
 MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and miR-222 and upregulated hsa-miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Tamoxifen Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model
 MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and miR-222 and upregulated hsa-miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
hsa-miR-1268a
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Fulvestrant Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model
 MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and miR-222 and upregulated miR-1266-5p, hsa-miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Tamoxifen Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model
 MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and miR-222 and upregulated miR-1266-5p, hsa-miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
hsa-miR-29a-3p
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Fulvestrant Approved
 Drug Info 
Target Regulation Down regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model
 MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated hsa-miR-29a-3p, miR-29b-3p, and miR-222 and upregulated miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Tamoxifen Approved
 Drug Info 
Target Regulation Down regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model
 MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated hsa-miR-29a-3p, miR-29b-3p, and miR-222 and upregulated miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
hsa-miR-29b-3p
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Fulvestrant Approved
 Drug Info 
Target Regulation Down regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model
 MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, hsa-miR-29b-3p, and miR-222 and upregulated miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Tamoxifen Approved
 Drug Info 
Target Regulation Down regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model
 MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, hsa-miR-29b-3p, and miR-222 and upregulated miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
hsa-miR-671-3p
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 2 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Fulvestrant Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model
 MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and miR-222 and upregulated miR-1266-5p, miR-1268a, hsa-miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Breast cancer [ICD-11: 2C60]
Responsed Drug Tamoxifen Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model
 MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and miR-222 and upregulated miR-1266-5p, miR-1268a, hsa-miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
LINE-1 (LINE-1)
 Target Gene 
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
In-vitro Model
 SCC-4 Tongue squamous cell carcinoma Homo sapiens CVCL_1684
CAL-27 Tongue squamous cell carcinoma Homo sapiens CVCL_1107
Response Summary HNRNPA2B1, as an m6A reader, is critical in OSCC development. Its expression is significantly associated with the prognosis of Oral Squamous Cell Carcinoma(OSCC). m6A acts as a proto-oncogene that promotes the OSCC proliferation, migration, and invasion through the EMT progression via the LINE-1 (LINE-1)/TGF-beta1/Snail/Smad2 signaling pathway.
Unspecific Target Gene
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [14]
Responsed Disease Prostate cancer [ICD-11: 2C82]
Cell Process Cell migration
Cell invasion
In-vitro Model
 PC-3 Prostate carcinoma Homo sapiens CVCL_0035
DU145 Prostate carcinoma Homo sapiens CVCL_0105
Response Summary Knockdown of HNRNPA2B1 or FTO prominently inhibited prostate cancer cells migration and invasion in vitro experiment. Determined CBLL1, FTO, YTHDC1, HNRNPA2B1 as crucial m6A regulators of prostate cancer.
Transcription factor 7-like 2 (TCF7L2)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by HNRNPA2B1
Cell Line HeLa cell line Homo sapiens
Treatment: HNRNPA2B1 knockdown HeLa cells
Control: HeLa cells
 GSE70061
Regulation
logFC: 2.87E+00
p-value: 4.26E-02
More Results Click to View More RNA-seq Results
Cetuximab [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [7]
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Epithelial-mesenchymal transition
In-vitro Model VACO 9P Rectal adenocarcinoma Homo sapiens CVCL_5413
T84 Colon adenocarcinoma Homo sapiens CVCL_0555
SW948 Colon adenocarcinoma Homo sapiens CVCL_0632
SW837 Rectal adenocarcinoma Homo sapiens CVCL_1729
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW48 Colon adenocarcinoma Homo sapiens CVCL_1724
SW403 Colon adenocarcinoma Homo sapiens CVCL_0545
SW1116 Colon adenocarcinoma Homo sapiens CVCL_0544
SK-CO-1 Colon adenocarcinoma Homo sapiens CVCL_0626
RKO Colon carcinoma Homo sapiens CVCL_0504
NCI-H716 Cecum adenocarcinoma Homo sapiens CVCL_1581
NCI-H508 Cecum adenocarcinoma Homo sapiens CVCL_1564
LS174T Colon adenocarcinoma Homo sapiens CVCL_1384
LS123 Colon adenocarcinoma Homo sapiens CVCL_1383
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
LIM2405 Cecum adenocarcinoma Homo sapiens CVCL_4437
LIM1215 Colon adenocarcinoma Homo sapiens CVCL_2574
HuTu 80 Duodenal adenocarcinoma Homo sapiens CVCL_1301
HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
HCT 15 Colon adenocarcinoma Homo sapiens CVCL_0292
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
GEO Colon carcinoma Homo sapiens CVCL_0271
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
DiFi Colorectal carcinoma Homo sapiens CVCL_6895
COLO 320DM Colon adenocarcinoma Homo sapiens CVCL_0219
COLO 205 Colon adenocarcinoma Homo sapiens CVCL_0218
Caco-2 Colon adenocarcinoma Homo sapiens CVCL_0025
In-vivo Model Established subcutaneous xenografts in athymic nude mice with MIR100HGKOE4 CC-CR cells transduced with a luciferase-expressing lentiviral vector and then treated the mice with cetuximab.
Response Summary MIR100HG and hnRNPA2B1 interact to control the transcriptional activity of Wnt signaling in CRC via regulation of Transcription factor 7-like 2 (TCF7L2) mRNA stability. These findings identified MIR100HG as a potent EMT inducer in CRC that contribute to cetuximab resistance and metastasis by activation of a MIR100HG/hnRNPA2B1/TCF7L2 feedback loop.
Mitogen-activated protein kinase 1 (MAPK/ERK2/MAPK1)
 Target Gene 
Fulvestrant [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [9]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Cell Process Cell migration and invasion
In-vitro Model HCC1806 Breast squamous cell carcinoma Homo sapiens CVCL_1258
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MDA-MB-468 Breast adenocarcinoma Homo sapiens CVCL_0419
T-47D Invasive breast carcinoma Homo sapiens CVCL_0553
Response Summary In breast cancer, modest stable overexpression of A2B1 in MCF-7 cells (MCF-7-A2B1 cells) resulted in tamoxifen and fulvestrant- resistance whereas knockdown of A2B1 in LCC9 and LY2 cells restored tamoxifen and fulvestrant, endocrine-sensitivity. MCF-7-A2B1 cells have increased ER-alpha and reduced miR-222-3p that targets ER-alpha. MCF-7-A2B1 have activated AKT and Mitogen-activated protein kinase 1 (MAPK/ERK2/MAPK1) that depend on A2B1 expression and are growth inhibited by inhibitors of these pathways.
Tamoxifen [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [9]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Cell Process Cell migration and invasion
In-vitro Model HCC1806 Breast squamous cell carcinoma Homo sapiens CVCL_1258
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MDA-MB-468 Breast adenocarcinoma Homo sapiens CVCL_0419
T-47D Invasive breast carcinoma Homo sapiens CVCL_0553
Response Summary In breast cancer, modest stable overexpression of A2B1 in MCF-7 cells (MCF-7-A2B1 cells) resulted in tamoxifen and fulvestrant - resistance whereas knockdown of A2B1 in LCC9 and LY2 cells restored tamoxifen and fulvestrant, endocrine-sensitivity. MCF-7-A2B1 cells have increased ER-alpha and reduced miR-222-3p that targets ER-alpha. MCF-7-A2B1 have activated AKT and Mitogen-activated protein kinase 1 (MAPK/ERK2/MAPK1) that depend on A2B1 expression and are growth inhibited by inhibitors of these pathways.
RAC-alpha serine/threonine-protein kinase (AKT1)
 Target Gene 
Fulvestrant [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [9]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Cell Process Cell migration and invasion
In-vitro Model HCC1806 Breast squamous cell carcinoma Homo sapiens CVCL_1258
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MDA-MB-468 Breast adenocarcinoma Homo sapiens CVCL_0419
T-47D Invasive breast carcinoma Homo sapiens CVCL_0553
Response Summary In breast cancer, modest stable overexpression of A2B1 in MCF-7 cells (MCF-7-A2B1 cells) resulted in tamoxifen and fulvestrant- resistance whereas knockdown of A2B1 in LCC9 and LY2 cells restored tamoxifen and fulvestrant, endocrine-sensitivity. MCF-7-A2B1 cells have increased ER-alpha and reduced miR-222-3p that targets ER-alpha. MCF-7-A2B1 have activated RAC-alpha serine/threonine-protein kinase (AKT1) and MAPK that depend on A2B1 expression and are growth inhibited by inhibitors of these pathways.
Tamoxifen [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [9]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
PI3K-Akt signaling pathway hsa04151
Cell Process Cell migration and invasion
In-vitro Model HCC1806 Breast squamous cell carcinoma Homo sapiens CVCL_1258
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MDA-MB-468 Breast adenocarcinoma Homo sapiens CVCL_0419
T-47D Invasive breast carcinoma Homo sapiens CVCL_0553
Response Summary In breast cancer, modest stable overexpression of A2B1 in MCF-7 cells (MCF-7-A2B1 cells) resulted in tamoxifen and fulvestrant - resistance whereas knockdown of A2B1 in LCC9 and LY2 cells restored tamoxifen and fulvestrant, endocrine-sensitivity. MCF-7-A2B1 cells have increased ER-alpha and reduced miR-222-3p that targets ER-alpha. MCF-7-A2B1 have activated RAC-alpha serine/threonine-protein kinase (AKT1) and MAPK that depend on A2B1 expression and are growth inhibited by inhibitors of these pathways.
Ribonuclease 3 (DROSHA)
 Target Gene 
Fulvestrant [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [11]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes Ribonuclease 3 (DROSHA) processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and miR-222 and upregulated miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
Tamoxifen [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [11]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes Ribonuclease 3 (DROSHA) processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and miR-222 and upregulated miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
microRNA 222 (MIR222)
 Target Gene 
Fulvestrant [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [11]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Down regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and microRNA 222 (MIR222) and upregulated miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
Tamoxifen [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [11]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Down regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and microRNA 222 (MIR222) and upregulated miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
microRNA let-7b (MIRLET7B)
 Target Gene 
Metformin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [13]
Responsed Disease Lung cancer ICD-11: 2C25
 Disease Info 
Pathway Response Notch signaling pathway hsa04330
In-vitro Model NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
H1975OR (Osimertinib resistant H1975 cells)
HCC827OR (Osimertinib resistant HCC827 cells)
Response Summary the participation of Metformin decreased the bindings of DNMT3a/b to the METTL3 promoter with the help of the readers of NKAP and HNRNPA2B1.the mediation of m6A formation on pri-Let-7b processing increased the mature microRNA let-7b (MIRLET7B), whose key role is to suppress the Notch signaling and to re-captivate the Osimertinib treatment.The findings open up future drug development, targeting this pathway for lung cancer patients.
Mir-100-let-7a-2-mir-125b-1 cluster host gene (MIR100HG)
 Target Gene 
Cetuximab [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [7]
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Target Regulation Up regulation
Pathway Response Wnt signaling pathway hsa04310
Cell Process Epithelial-mesenchymal transition
In-vitro Model VACO 9P Rectal adenocarcinoma Homo sapiens CVCL_5413
T84 Colon adenocarcinoma Homo sapiens CVCL_0555
SW948 Colon adenocarcinoma Homo sapiens CVCL_0632
SW837 Rectal adenocarcinoma Homo sapiens CVCL_1729
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW48 Colon adenocarcinoma Homo sapiens CVCL_1724
SW403 Colon adenocarcinoma Homo sapiens CVCL_0545
SW1116 Colon adenocarcinoma Homo sapiens CVCL_0544
SK-CO-1 Colon adenocarcinoma Homo sapiens CVCL_0626
RKO Colon carcinoma Homo sapiens CVCL_0504
NCI-H716 Cecum adenocarcinoma Homo sapiens CVCL_1581
NCI-H508 Cecum adenocarcinoma Homo sapiens CVCL_1564
LS174T Colon adenocarcinoma Homo sapiens CVCL_1384
LS123 Colon adenocarcinoma Homo sapiens CVCL_1383
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
LIM2405 Cecum adenocarcinoma Homo sapiens CVCL_4437
LIM1215 Colon adenocarcinoma Homo sapiens CVCL_2574
HuTu 80 Duodenal adenocarcinoma Homo sapiens CVCL_1301
HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
HCT 15 Colon adenocarcinoma Homo sapiens CVCL_0292
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
GEO Colon carcinoma Homo sapiens CVCL_0271
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
DiFi Colorectal carcinoma Homo sapiens CVCL_6895
COLO 320DM Colon adenocarcinoma Homo sapiens CVCL_0219
COLO 205 Colon adenocarcinoma Homo sapiens CVCL_0218
Caco-2 Colon adenocarcinoma Homo sapiens CVCL_0025
In-vivo Model Established subcutaneous xenografts in athymic nude mice with MIR100HGKOE4 CC-CR cells transduced with a luciferase-expressing lentiviral vector and then treated the mice with cetuximab.
Response Summary Mir-100-let-7a-2-mir-125b-1 cluster host gene (MIR100HG) and hnRNPA2B1 interact to control the transcriptional activity of Wnt signaling in CRC via regulation of TCF7L2 mRNA stability. These findings identified MIR100HG as a potent EMT inducer in CRC that will contribute to cetuximab resistance and metastasis by activation of a MIR100HG/hnRNPA2B1/TCF7L2 feedback loop.
hsa-miR-1266-5p
 Target Gene 
Fulvestrant [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [11]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and miR-222 and upregulated hsa-miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
Tamoxifen [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [11]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and miR-222 and upregulated hsa-miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
hsa-miR-1268a
 Target Gene 
Fulvestrant [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [11]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and miR-222 and upregulated miR-1266-5p, hsa-miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
Tamoxifen [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [11]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and miR-222 and upregulated miR-1266-5p, hsa-miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
hsa-miR-29a-3p
 Target Gene 
Fulvestrant [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [11]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Down regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated hsa-miR-29a-3p, miR-29b-3p, and miR-222 and upregulated miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
Tamoxifen [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [11]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Down regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated hsa-miR-29a-3p, miR-29b-3p, and miR-222 and upregulated miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
hsa-miR-29b-3p
 Target Gene 
Fulvestrant [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [11]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Down regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, hsa-miR-29b-3p, and miR-222 and upregulated miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
Tamoxifen [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [11]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Down regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, hsa-miR-29b-3p, and miR-222 and upregulated miR-1266-5p, miR-1268a, miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
hsa-miR-671-3p
 Target Gene 
Fulvestrant [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [11]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and miR-222 and upregulated miR-1266-5p, miR-1268a, hsa-miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
Tamoxifen [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [11]
Responsed Disease Breast cancer ICD-11: 2C60
 Disease Info 
Target Regulation Up regulation
Pathway Response TGF-beta signaling pathway hsa04350
Cell Process Endocrine-resistance
In-vitro Model MCF7/LCC9 Invasive breast carcinoma Homo sapiens CVCL_DP52
MCF-7 Invasive breast carcinoma Homo sapiens CVCL_0031
Response Summary HNRNPA2B1 is a reader of the N(6)-methyladenosine mark in primary-miRNAs and promotes DROSHA processing to precursor-miRNAs. HNRNPA2B1 downregulated miR-29a-3p, miR-29b-3p, and miR-222 and upregulated miR-1266-5p, miR-1268a, hsa-miR-671-3p. Transient overexpression of HNRNPA2/B1 reduced breast cancer cellMCF-7 sensitivity to 4-hydroxytamoxifen and fulvestrant, suggesting a role for HNRNPA2/B1 in endocrine-resistance.
Click to View Potential Drug Response of This Regulator
Xenobiotics Compound(s) Regulating the m6A Methylation Regulator
Compound Name TL13-68 Investigative
Synonyms
TL13-68; CHEMBL4129274; BDBM50269622; HY-136849; CS-0134015
    Click to Show/Hide
External link
CID: 145963683
Activity
IC50=33 nM
 [15]
References
Ref 1 m(6)A Reader HNRNPA2B1 Promotes Esophageal Cancer Progression via Up-Regulation of ACLY and ACC1. Front Oncol. 2020 Sep 29;10:553045. doi: 10.3389/fonc.2020.553045. eCollection 2020.
Ref 2 m(6)A-induced lncRNA RP11 triggers the dissemination of colorectal cancer cells via upregulation of Zeb1. Mol Cancer. 2019 Apr 13;18(1):87. doi: 10.1186/s12943-019-1014-2.
Ref 3 hnRNPA2B1 Promotes Colon Cancer Progression via the MAPK Pathway. Front Genet. 2021 Sep 22;12:666451. doi: 10.3389/fgene.2021.666451. eCollection 2021.
Ref 4 Roles of the m(6)A Modification of RNA in the Glioblastoma Microenvironment as Revealed by Single-Cell Analyses. Front Immunol. 2022 Apr 26;13:798583. doi: 10.3389/fimmu.2022.798583. eCollection 2022.
Ref 5 HNRNPA2B1 promotes multiple myeloma progression by increasing AKT3 expression via m6A-dependent stabilization of ILF3 mRNA. J Hematol Oncol. 2021 Apr 1;14(1):54. doi: 10.1186/s13045-021-01066-6.
Ref 6 HNRNPA2B1 inhibited SFRP2 and activated Wnt-Beta/catenin via m6A-mediated miR-106b-5p processing to aggravate stemness in lung adenocarcinoma. Pathol Res Pract. 2022 May;233:153794. doi: 10.1016/j.prp.2022.153794. Epub 2022 Feb 10.
Ref 7 Interaction of lncRNA MIR100HG with hnRNPA2B1 facilitates m(6)A-dependent stabilization of TCF7L2 mRNA and colorectal cancer progression. Mol Cancer. 2022 Mar 12;21(1):74. doi: 10.1186/s12943-022-01555-3.
Ref 8 The UCA1/KRAS axis promotes human pancreatic ductal adenocarcinoma stem cell properties and tumor growth. Am J Cancer Res. 2019 Mar 1;9(3):496-510. eCollection 2019.
Ref 9 HNRNPA2B1 regulates tamoxifen- and fulvestrant-sensitivity and hallmarks of endocrine resistance in breast cancer cells. Cancer Lett. 2021 Oct 10;518:152-168. doi: 10.1016/j.canlet.2021.07.015. Epub 2021 Jul 14.
Ref 10 HNRNPA2B1, as a m(6)A Reader, Promotes Tumorigenesis and Metastasis of Oral Squamous Cell Carcinoma. Front Oncol. 2021 Sep 23;11:716921. doi: 10.3389/fonc.2021.716921. eCollection 2021.
Ref 11 HNRNPA2/B1 is upregulated in endocrine-resistant LCC9 breast cancer cells and alters the miRNA transcriptome when overexpressed in MCF-7 cells. Sci Rep. 2019 Jul 1;9(1):9430. doi: 10.1038/s41598-019-45636-8.
Ref 12 Analysis of m6A-Related Signatures in the Tumor Immune Microenvironment and Identification of Clinical Prognostic Regulators in Adrenocortical Carcinoma. Front Immunol. 2021 Mar 3;12:637933. doi: 10.3389/fimmu.2021.637933. eCollection 2021.
Ref 13 Stimulation of Let-7 Maturation by Metformin Improved the Response to Tyrosine Kinase Inhibitor Therapy in an m6A Dependent Manner. Front Oncol. 2022 Jan 6;11:731561. doi: 10.3389/fonc.2021.731561. eCollection 2021.
Ref 14 RNA m6A Methylation Regulators Multi-Omics Analysis in Prostate Cancer. Front Genet. 2021 Nov 26;12:768041. doi: 10.3389/fgene.2021.768041. eCollection 2021.
Ref 15 Studies of TAK1-centered polypharmacology with novel covalent TAK1 inhibitors. Bioorg Med Chem. 2017 Feb 15;25(4):1320-1328. doi: 10.1016/j.bmc.2016.11.034. Epub 2016 Dec 7.