m6A Regulator Information

General Information of the m6A Regulator (ID: REG00023)

Regulator Name	YTH domain-containing protein 2 (YTHDC2)
Synonyms	3'-5' RNA helicase YTHDC2; hYTHDC2 Click to Show/Hide
Gene Name	YTHDC2
Sequence	MSRPSSVSPRQPAPGGGGGGGPSPCGPGGGGRAKGLKDIRIDEEVKIAVNIALERFRYGD QREMEFPSSLTSTERAFIHRLSQSLGLVSKSKGKGANRYLTVKKKDGSETAHAMMTCNLT HNTKHAVRSLIQRFPVTNKERTELLPKTERGNVFAVEAENREMSKTSGRLNNGIPQIPVK RGESEFDSFRQSLPVFEKQEEIVKIIKENKVVLIVGETGSGKTTQIPQFLLDDCFKNGIP CRIFCTQPRRLAAIAVAERVAAERRERIGQTIGYQIRLESRVSPKTLLTFCTNGVLLRTL MAGDSTLSTVTHVIVDEVHERDRFSDFLLTKLRDLLQKHPTLKLILSSAALDVNLFIRYF GSCPVIYIQGRPFEVKEMFLEDILRTTGYTNKEMLKYKKEKQQEEKQQTTLTEWYSAQEN SFKPESQRQRTVLNVTDEYDLLDDGGDAVFSQLTEKDVNCLEPWLIKEMDACLSDIWLHK DIDAFAQVFHLILTENVSVDYRHSETSATALMVAAGRGFASQVEQLISMGANVHSKASNG WMALDWAKHFGQTEIVDLLESYSATLEFGNLDESSLVQTNGSDLSAEDRELLKAYHHSFD DEKVDLDLIMHLLYNICHSCDAGAVLIFLPGYDEIVGLRDRILFDDKRFADSTHRYQVFM LHSNMQTSDQKKVLKNPPAGVRKIILSTNIAETSITVNDVVFVIDSGKVKEKSFDALNFV TMLKMVWISKASAIQRKGRAGRCRPGICFRLFSRLRFQNMLEFQTPELLRMPLQELCLHT KLLAPVNCPIADFLMKAPEPPPALIVRNAVQMLKTIDAMDTWEDLTELGYHLADLPVEPH LGKMVLCAVVLKCLDPILTIACTLAYRDPFVLPTQASQKRAAMLCRKRFTAGAFSDHMAL LRAFQAWQKARSDGWERAFCEKNFLSQATMEIIIGMRTQLLGQLRASGFVRARGGGDIRD VNTNSENWAVVKAALVAGMYPNLVHVDRENLVLTGPKEKKVRFHPASVLSQPQYKKIPPA NGQAAAIKALPTDWLIYDEMTRAHRIANIRCCSAVTPVTILVFCGPARLASNALQEPSSF RVDGIPNDSSDSEMEDKTTANLAALKLDEWLHFTLEPEAASLLLQLRQKWHSLFLRRMRA PSKPWSQVDEATIRAIIAVLSTEEQSAGLQQPSGIGQRPRPMSSEELPLASSWRSNNSRK SSADTEFSDECTTAERVLMKSPSPALHPPQKYKDRGILHPKRGTEDRSDQSSLKSTDSSS YPSPCASPSPPSSGKGSKSPSPRPNMPVRYFIMKSSNLRNLEISQQKGIWSTTPSNERKL NRAFWESSIVYLVFSVQGSGHFQGFSRMSSEIGREKSQDWGSAGLGGVFKVEWIRKESLP FQFAHHLLNPWNDNKKVQISRDGQELEPLVGEQLLQLWERLPLGEKNTTD Click to Show/Hide
Family	DEAD box helicase family; DEAH subfamily
Function	3'-5' RNA helicase that plays a key role in the male and female germline by promoting transition from mitotic to meiotic divisions in stem cells. Specifically recognizes and binds N6-methyladenosine (m6A)-containing RNAs, a modification present at internal sites of mRNAs and some non-coding RNAs that plays a role in the efficiency of RNA processing and stability. Essential for ensuring a successful progression of the meiotic program in the germline by regulating the level of m6A-containing RNAs (By similarity). Acts by binding and promoting degradation of m6A-containing mRNAs: the 3'-5' RNA helicase activity is required for this process and RNA degradation may be mediated by XRN1 exoribonuclease. Required for both spermatogenesis and oogenesis (By similarity). Click to Show/Hide
Gene ID	64848
Uniprot ID	YTDC2_HUMAN
Regulator Type	WRITER ERASER READER
Mechanism Diagram	Click to View the Original Diagram

Target Genes	Click to View Potential Target Genes of This Regulator

Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)

YTHDC2 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.

Browse Target Gene related Disease

Browse Target Gene related Drug

40S ribosomal protein S6 (S6)

Target Gene

Nasopharyngeal carcinoma [ICD-11: 2B6B]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[1]
Responsed Disease	Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation	Up regulation
In-vitro Model	HK1-IRR (HK1-IRR (HK1-ionizing radiation radioresistent cell line) was derived from HK1 after a prolonged exposure of irradiation.HK1, a generous gift from Prof. Ya Cao (Cancer Research Institute, Central South University), was established from a recurrent nasopharynx carcinoma of a Chinese 17-year-old male patient)
	NPC/HK1	Nasopharyngeal carcinoma	Homo sapiens	CVCL_7084
	CNE2-IRR (CNE2-IRR (CNE2-ionizing radiation radioresistent cell line) was derived from CNE2 after a prolonged exposure of irradiation)
	CNE-2	Nasopharyngeal carcinoma	Homo sapiens	CVCL_6889
In-vivo Model	2 × 10⁶ cells resuspended in 50 uL of Matrigel (Corning) were subcutaneously injected into 4-6 weeks old male nude mice. When tumor volumes reached 150-200 mm³, animals were divided into control group and radiotherapy group. In the radiotherapy group, tumors were treated with a single irradiation (4 Gy) when tumor volumes reached approximately 150-200 mm³. The tumor stopped growing in the next few days and then restarted growth.
Response Summary	YTHDC2 promotes radiotherapy resistance of NPC cells by activating the IGF1R/ATK/40S ribosomal protein S6 (S6) signaling axis and serves as a potential therapeutic target in radiosensitization of NPC cells.

Acetyl-CoA carboxylase 1 (ACC1/ACACA)

Target Gene

Non-alcoholic fatty liver disease [ICD-11: DB92]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[2]
Responsed Disease	Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation	Down regulation
Pathway Response	RNA degradation	hsa03018
Cell Process	RNA stability
In-vivo Model	All mice were housed at 21℃ ± 1℃ with a humidity of 55% ± 10% and a 12-hour light/dark cycle. The high-fat diets (HFDs), containing 60% kcal from fat, 20% kcal from carbohydrate, and 20% kcal from protein.
Response Summary	In nonalcoholic fatty liver disease, Ythdc2 could bind to mRNA of lipogenic genes, including sterol regulatory element-binding protein 1c, fatty acid synthase, stearoyl-CoA desaturase 1, and Acetyl-CoA carboxylase 1 (ACC1/ACACA), to decrease their mRNA stability and inhibit gene expression.

Cyclin-dependent kinase inhibitor 1 (CDKN1A)

Target Gene

Oral cavity/oesophagus/stomach in situ carcinoma [ICD-11: 2E60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Esophageal squamous cell carcinoma [ICD-11: 2B70.1]
Target Regulation	Up regulation
Pathway Response	p53 signaling pathway			hsa04115
	NF-kappa B signaling pathway			hsa04064
	JAK-STAT signaling pathway			hsa04630
Cell Process	Genetic variants
In-vitro Model	KYSE-150	Esophageal squamous cell carcinoma	Homo sapiens	CVCL_1348
	KYSE-30	Esophageal squamous cell carcinoma	Homo sapiens	CVCL_1351
Response Summary	Knockdown of YTHDC2 substantially promoted the proliferation rate of esophageal squamous cell carcinoma cells by affecting several cancer-related signaling pathways.

Cystine/glutamate transporter (SLC7A11)

Target Gene

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[4]
Responsed Disease	Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation	Down regulation
In-vitro Model	PC-9	Lung adenocarcinoma	Homo sapiens	CVCL_B260
	NCI-H441	Lung papillary adenocarcinoma	Homo sapiens	CVCL_1561
	NCI-H292	Lung mucoepidermoid carcinoma	Homo sapiens	CVCL_0455
	NCI-H1975	Lung adenocarcinoma	Homo sapiens	CVCL_1511
	NCI-H1650	Minimally invasive lung adenocarcinoma	Homo sapiens	CVCL_1483
	NCI-H1299	Lung large cell carcinoma	Homo sapiens	CVCL_0060
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HCC827	Lung adenocarcinoma	Homo sapiens	CVCL_2063
	Calu-1	Lung squamous cell carcinoma	Homo sapiens	CVCL_0608
	BEAS-2B	Normal	Homo sapiens	CVCL_0168
	A-549	Lung adenocarcinoma	Homo sapiens	CVCL_0023
Response Summary	YTHDC2 destabilized Cystine/glutamate transporter (SLC7A11) mRNA in an m6A-dependent manner because YTHDC2 preferentially bound to m6A-modified SLC7A11 mRNA and thereafter promoted its decay. the promotion of cystine uptake via the suppression of YTHDC2 is critical for LUAD tumorigenesis

Cytochrome P450 2C8 (CYP2C8)

Target Gene

Liver cancer [ICD-11: 2C12]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[5]
Responsed Disease	Hepatocellular carcinoma [ICD-11: 2C12.02]
Target Regulation	Down regulation
Pathway Response	Drug metabolism - cytochrome P450			hsa00982
Cell Process	Drug-metabolizing
In-vitro Model	HepaRG	Hepatitis C infection	Homo sapiens	CVCL_9720
In-vitro Model	Huh-7	Adult hepatocellular carcinoma	Homo sapiens	CVCL_0336
Response Summary	In the Hepatocellular carcinoma cells YTHDC2 promotes CYP2C8 mRNA degradation via recognizing the m6A in CYP2C8 mRNA, which is installed by METTL3/14 and removed by FTO.

G1/S-specific cyclin-D2 (CCND2)

Target Gene

Oral cavity/oesophagus/stomach in situ carcinoma [ICD-11: 2E60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Esophageal squamous cell carcinoma [ICD-11: 2B70.1]
Target Regulation	Up regulation
Pathway Response	p53 signaling pathway			hsa04115
	NF-kappa B signaling pathway			hsa04064
	JAK-STAT signaling pathway			hsa04630
Cell Process	Genetic variants
In-vitro Model	KYSE-150	Esophageal squamous cell carcinoma	Homo sapiens	CVCL_1348
	KYSE-30	Esophageal squamous cell carcinoma	Homo sapiens	CVCL_1351
Response Summary	Knockdown of YTHDC2 substantially promoted the proliferation rate of esophageal squamous cell carcinoma cells by affecting several cancer-related signaling pathways.

G2/mitotic-specific cyclin-B2 (CCNB2)

Target Gene

Male infertility [ICD-11: GB04]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[6]
Responsed Disease	Male infertility [ICD-11: GB04]
Target Regulation	Up regulation
Pathway Response	Cell cycle			hsa04110
Cell Process	Block the G2/M phase
In-vitro Model	GC-1 spg	Normal	Mus musculus	CVCL_8872
In-vivo Model	Mice in the control group received an i.p. injections of 0.9% NaCl. Mice in the low, medium, and high Mn groups received i.p. injections of 12.5, 25, and 50 mg/kg MnCl₂. The volume of administration was 5 mL/kg body weight. The injection was given daily for 2 weeks.
Response Summary	Over-expression (OE) of YTHDC2 increased G2/mitotic-specific cyclin-B2 (CCNB2) levels, reduced cell cycle arrest, and improved reproductive toxicity after Mn exposure.

Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A)

Target Gene

Colon cancer [ICD-11: 2B90]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[7]
Responsed Disease	Colon cancer [ICD-11: 2B90]
Target Regulation	Up regulation
Pathway Response	HIF-1 signaling pathway			hsa04066
Cell Process	Biological regulation
In-vitro Model	COS (From the African green monkey cell line (CV-1).)
	HCT 116	Colon carcinoma	Homo sapiens	CVCL_0291
	HT29	Colon cancer	Mus musculus	CVCL_A8EZ
In-vivo Model	HCT116, Y2KD-116 and con-116 cells were resuspended at 1 × 10⁶ cells per 50 ul of PBS. Cells were injected into the exteriorized spleen after abdominal incision.
Response Summary	YTHDC2 contributes to colon tumor metastasis by promoting translation of Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A) and that YTHDC2 is potentially a diagnostic marker and target gene for treating colon cancer patients.

Insulin-like growth factor 1 receptor (IGF1R)

Target Gene

Nasopharyngeal carcinoma [ICD-11: 2B6B]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[1]
Responsed Disease	Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation	Up regulation
In-vitro Model	HK1-IRR (HK1-IRR (HK1-ionizing radiation radioresistent cell line) was derived from HK1 after a prolonged exposure of irradiation.HK1, a generous gift from Prof. Ya Cao (Cancer Research Institute, Central South University), was established from a recurrent nasopharynx carcinoma of a Chinese 17-year-old male patient)
	NPC/HK1	Nasopharyngeal carcinoma	Homo sapiens	CVCL_7084
	CNE2-IRR (CNE2-IRR (CNE2-ionizing radiation radioresistent cell line) was derived from CNE2 after a prolonged exposure of irradiation)
	CNE-2	Nasopharyngeal carcinoma	Homo sapiens	CVCL_6889
In-vivo Model	2 × 10⁶ cells resuspended in 50 uL of Matrigel (Corning) were subcutaneously injected into 4-6 weeks old male nude mice. When tumor volumes reached 150-200 mm³, animals were divided into control group and radiotherapy group. In the radiotherapy group, tumors were treated with a single irradiation (4 Gy) when tumor volumes reached approximately 150-200 mm³. The tumor stopped growing in the next few days and then restarted growth.
Response Summary	YTHDC2 promotes radiotherapy resistance of NPC cells by activating the Insulin-like growth factor 1 receptor (IGF1R)/ATK/S6 signaling axis and serves as a potential therapeutic target in radiosensitization of NPC cells.

Interleukin-6 (IL-6)

Target Gene

Kaposi's sarcoma [ICD-11: 2B57]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[8]
Responsed Disease	Kaposi's sarcoma [ICD-11: 2B57]
In-vitro Model	iSLK.219	Clear cell renal cell carcinoma	Homo sapiens	CVCL_B6YV
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HEK293	Normal	Homo sapiens	CVCL_0045
Response Summary	This modification recruits the m6A reader YTHDC2 and found that YTHDC2 is necessary for the escape of the IL-6 transcript. m6A modification is essential to confer SOX resistance to the Interleukin-6 (IL-6) mRNA. These results shed light on how the host cell has evolved to use RNA modifications to circumvent viral manipulation of RNA fate during KSHV infection Kaposi's sarcoma.

Nuclear factor erythroid 2-related factor 2 (NFE2L2)

Target Gene

Male reproductive disorders [ICD-11: VV5Z]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[9]
Responsed Disease	Male reproductive disorders [ICD-11: VV5Z]
Cell Process	Oxidative stress
	Cell apoptosis
In-vivo Model	Exposed Sprague-Dawley rats to 0, 250, and 500 mg DEHP per kg body weight per day at the prepuberty stage from postnatal day 22 (PND 22) to PND 35 by oral gavage.
Response Summary	DEHP worsened testicular histology, decreased testosterone concentrations, downregulated expression of spermatogenesis inducers, enhanced oxidative stress, inhibited the Nuclear factor erythroid 2-related factor 2 (NFE2L2)-mediated antioxidant pathway, and increased apoptosis in testes. DEHP is a common environmental endocrine disrupting chemical that induces male reproductive disorders. Additionally, DEHP increased global levels of m6A RNA modification and altered the expression of two important RNA methylation modulator genes, FTO and YTHDC2.

RAC-alpha serine/threonine-protein kinase (AKT1)

Target Gene

Nasopharyngeal carcinoma [ICD-11: 2B6B]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[1]
Responsed Disease	Nasopharyngeal carcinoma [ICD-11: 2B6B]
Target Regulation	Up regulation
In-vitro Model	HK1-IRR (HK1-IRR (HK1-ionizing radiation radioresistent cell line) was derived from HK1 after a prolonged exposure of irradiation.HK1, a generous gift from Prof. Ya Cao (Cancer Research Institute, Central South University), was established from a recurrent nasopharynx carcinoma of a Chinese 17-year-old male patient)
	NPC/HK1	Nasopharyngeal carcinoma	Homo sapiens	CVCL_7084
	CNE2-IRR (CNE2-IRR (CNE2-ionizing radiation radioresistent cell line) was derived from CNE2 after a prolonged exposure of irradiation)
	CNE-2	Nasopharyngeal carcinoma	Homo sapiens	CVCL_6889
In-vivo Model	2 × 10⁶ cells resuspended in 50 uL of Matrigel (Corning) were subcutaneously injected into 4-6 weeks old male nude mice. When tumor volumes reached 150-200 mm³, animals were divided into control group and radiotherapy group. In the radiotherapy group, tumors were treated with a single irradiation (4 Gy) when tumor volumes reached approximately 150-200 mm³. The tumor stopped growing in the next few days and then restarted growth.
Response Summary	YTHDC2 promotes radiotherapy resistance of NPC cells by activating the IGF1R/RAC-alpha serine/threonine-protein kinase (AKT1)/S6 signaling axis and serves as a potential therapeutic target in radiosensitization of NPC cells.

Stearoyl-CoA desaturase (SCD)

Target Gene

Non-alcoholic fatty liver disease [ICD-11: DB92]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[2]
Responsed Disease	Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation	Down regulation
Pathway Response	RNA degradation	hsa03018
Cell Process	RNA stability
In-vivo Model	All mice were housed at 21℃ ± 1℃ with a humidity of 55% ± 10% and a 12-hour light/dark cycle. The high-fat diets (HFDs), containing 60% kcal from fat, 20% kcal from carbohydrate, and 20% kcal from protein.
Response Summary	In nonalcoholic fatty liver disease, Ythdc2 could bind to mRNA of lipogenic genes, including sterol regulatory element-binding protein 1c, fatty acid synthase, Stearoyl-CoA desaturase (SCD), and acetyl-CoA carboxylase 1, to decrease their mRNA stability and inhibit gene expression.

Sterol regulatory element-binding protein 1 (SREBF1)

Target Gene

Non-alcoholic fatty liver disease [ICD-11: DB92]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[2]
Responsed Disease	Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation	Down regulation
Pathway Response	RNA degradation	hsa03018
Cell Process	RNA stability
In-vivo Model	All mice were housed at 21℃ ± 1℃ with a humidity of 55% ± 10% and a 12-hour light/dark cycle. The high-fat diets (HFDs), containing 60% kcal from fat, 20% kcal from carbohydrate, and 20% kcal from protein.
Response Summary	In nonalcoholic fatty liver disease, Ythdc2 could bind to mRNA of lipogenic genes, including Sterol regulatory element-binding protein 1 (SREBF1), fatty acid synthase, stearoyl-CoA desaturase 1, and acetyl-CoA carboxylase 1, to decrease their mRNA stability and inhibit gene expression.

Transcriptional coactivator YAP1 (YAP1)

Target Gene

Gastric cancer [ICD-11: 2B72]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[10]
Responsed Disease	Gastric cancer [ICD-11: 2B72]
Target Regulation	Up regulation
In-vitro Model	HGC-27	Gastric carcinoma	Homo sapiens	CVCL_1279
In-vitro Model	AGS	Gastric adenocarcinoma	Homo sapiens	CVCL_0139
In-vivo Model	They were subcutaneously and caudal vein injected with YTHDC2 knockout AGS cells, respectively. After 7 weeks, the mice were sacrificed and tumor size and lung metastasis nodules were recorded.
Response Summary	High YTHDC2 was strongly positively correlated with high Transcriptional coactivator YAP1 (YAP1) in clinical GC tissues, YTHDC2 is a novel oncogene in GC, which provides the theoretical basis for the strategy of targeting YTHDC2 for GC patients.

Transforming growth factor beta-2 proprotein (TGFB2)

Target Gene

Oral cavity/oesophagus/stomach in situ carcinoma [ICD-11: 2E60]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[3]
Responsed Disease	Esophageal squamous cell carcinoma [ICD-11: 2B70.1]
Target Regulation	Up regulation
Pathway Response	p53 signaling pathway			hsa04115
	NF-kappa B signaling pathway			hsa04064
	JAK-STAT signaling pathway			hsa04630
Cell Process	Genetic variants
In-vitro Model	KYSE-150	Esophageal squamous cell carcinoma	Homo sapiens	CVCL_1348
	KYSE-30	Esophageal squamous cell carcinoma	Homo sapiens	CVCL_1351
Response Summary	Knockdown of YTHDC2 substantially promoted the proliferation rate of esophageal squamous cell carcinoma cells by affecting several cancer-related signaling pathways.

Tumor necrosis factor receptor superfamily member 6 (FAS)

Target Gene

Non-alcoholic fatty liver disease [ICD-11: DB92]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[2]
Responsed Disease	Non-alcoholic fatty liver disease [ICD-11: DB92]
Target Regulation	Down regulation
Pathway Response	RNA degradation	hsa03018
Cell Process	RNA stability
In-vivo Model	All mice were housed at 21℃ ± 1℃ with a humidity of 55% ± 10% and a 12-hour light/dark cycle. The high-fat diets (HFDs), containing 60% kcal from fat, 20% kcal from carbohydrate, and 20% kcal from protein.
Response Summary	In nonalcoholic fatty liver disease, Ythdc2 could bind to mRNA of lipogenic genes, including sterol regulatory element-binding protein 1c, Tumor necrosis factor receptor superfamily member 6 (FAS), stearoyl-CoA desaturase 1, and acetyl-CoA carboxylase 1, to decrease their mRNA stability and inhibit gene expression.

Ubiquitin carboxyl-terminal hydrolase CYLD (CYLD)

Target Gene

Lung cancer [ICD-11: 2C25]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[11]
Responsed Disease	Lung cancer [ICD-11: 2C25]
Target Regulation	Up regulation
Pathway Response	NF-kappa B signaling pathway			hsa04064
In-vitro Model	NCI-H1299	Lung large cell carcinoma	Homo sapiens	CVCL_0060
In-vitro Model	BEAS-2B	Normal	Homo sapiens	CVCL_0168
In-vivo Model	Approximately 5×10⁶ normal H1299 cells or stable YTHDC2-overexpressing H1299 cells were implanted subcutaneously into the right flank of the animals (n=8 mice per group). Animals were euthanized by cervical dislocation ~30 days after implantation, and tumors were collected and photographed.
Response Summary	Smoking-related downregulation of YTHDC2 was associated with enhanced proliferation and migration in lung cancer cells, YTHDC2 functions as a tumor suppressor through the Ubiquitin carboxyl-terminal hydrolase CYLD (CYLD)/NF-Kappa-B signaling pathway, which is mediated by m6A modification.

Circ_YTHDC2

Target Gene

Hematological disorders [ICD-11: 3C0Z]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[12]
Responsed Disease	Hematological disorders [ICD-11: 3C0Z]
Target Regulation	Up regulation
In-vitro Model	A7r5	Normal	Rattus norvegicus	CVCL_0137
Response Summary	YTHDC2/Circ_YTHDC2/TET2 pathway is an important target of metformin in preventing the progression of VSMCs dysfunction under high glucose.

SOX (SOX)

Target Gene

Kaposi's sarcoma [ICD-11: 2B57]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[8]
Responsed Disease	Kaposi's sarcoma [ICD-11: 2B57]
In-vitro Model	iSLK.219	Clear cell renal cell carcinoma	Homo sapiens	CVCL_B6YV
	HEK293T	Normal	Homo sapiens	CVCL_0063
	HEK293	Normal	Homo sapiens	CVCL_0045
Response Summary	This modification recruits the m6A reader YTHDC2 and found that YTHDC2 is necessary for the escape of the IL-6 transcript. m6A modification is essential to confer SOX (SOX) resistance to the IL-6 mRNA. These results shed light on how the host cell has evolved to use RNA modifications to circumvent viral manipulation of RNA fate during KSHV infection Kaposi's sarcoma.

Unspecific Target Gene

Head and neck squamous carcinoma [ICD-11: 2B6E]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[13]
Responsed Disease	Head and neck squamous carcinoma [ICD-11: 2B6E]
Pathway Response	Ubiquitin mediated proteolysis	hsa04120
Cell Process	Ubiquitin-mediated proteolysis
	Cell apoptosis
Response Summary	In head and neck squamous cell carcinoma patients, a majority of highly expressed m6A regulatory genes is associated with poor OS, in particular ALKBH5, whereas YTHDC2 was associated with better prognosis.

Rectum cancer [ICD-11: 2B92]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[14]
Responsed Disease	Rectum cancer [ICD-11: 2B92]
Target Regulation	Down regulation
Pathway Response	Nucleotide excision repair	hsa03420
Cell Process	DNA repair
	Epithelial-mesenchymal transition
Response Summary	The m6A RNA methylation regulators, specifically YTHDC2 and METTL14, were significantly down-regulated and were potential prognostic biomarkers in rectal cancer.

Diseases of the musculoskeletal system [ICD-11: FC0Z]

In total 1 item(s) under this disease		Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene		[15]
Responsed Disease	Diseases of the musculoskeletal system [ICD-11: FC0Z]
Pathway Response	Ribosome biogenesis in eukaryotes	hsa03008), mRNA surveillance pathway
Cell Process	Adipogenic differentiation
Response Summary	YTHDC2 knockdown can promote the osteogenic differentiation of hBMSCs and inhibit the adipogenic differentiation. YTHDC2 knockdown cause changes in ribosome function.

Menopausal disorder [ICD-11: GA30]

In total 1 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[16]
Responsed Disease	Premature ovarian failure [ICD-11: GA30.6]
Pathway Response	Oocyte meiosis			hsa04114
Cell Process	Meiosis
In-vitro Model	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
Response Summary	YTHDC2 is a key regulator of meiosis in humans and pathogenic variants within this gene are associated with POI.

Male infertility [ICD-11: GB04]

In total 2 item(s) under this disease				Disease Info
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene				[17]
Responsed Disease	Male infertility [ICD-11: GB04]
Responsed Drug	Ethyl ester form of meclofenamic acid		Approved	Drug Info
Cell Process	Cell cycle
	Cell proliferation
In-vitro Model	GC-1 spg	Normal	Mus musculus	CVCL_8872
	HEK293T	Normal	Homo sapiens	CVCL_0063
In-vivo Model	Mouse GC-1 spg cells were treated with the ester form of meclofenamic acid (MA2) to inhibit the demethylase activity of FTO.
Response Summary	METTL3, METTL14, ALKBH5 and YTHDC2 are involved in the regulation of spermatogenesis and oogenesis. MA2 affected CDKs expression through the m6A-dependent mRNA degradation pathway, and thus repressed spermatogonial proliferation. Additionally, mutation of the predicted m6A sites in the Cdk2-3'UTR could mitigated the degradation of CDK2 mRNA after MA2 treatment.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene				[18]
Responsed Disease	Male infertility [ICD-11: GB04]
Cell Process	RNA stability
	RNA degradation (hsa03018)
In-vitro Model	HeLa	Endocervical adenocarcinoma	Homo sapiens	CVCL_0030
In-vivo Model	Mixture of Cas9 mRNA (20 ng/uL) and two sgRNAs (5 ng/uL each) were injected into the cytoplasm and male pronucleus of the zygote, obtained by CBF1 mating.
Response Summary	Ythdc2 knockout mice are infertile; males have significantly smaller testes and females have significantly smaller ovaries compared to those of littermates.

Unspecific Target Gene

Ethyl ester form of meclofenamic acid [Approved]

In total 1 item(s) under this drug				Drug Info
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene				[17]
Responsed Disease	Male infertility		ICD-11: GB04	Disease Info
Cell Process	Cell cycle
	Cell proliferation
In-vitro Model	GC-1 spg	Normal	Mus musculus	CVCL_8872
	HEK293T	Normal	Homo sapiens	CVCL_0063
In-vivo Model	Mouse GC-1 spg cells were treated with the ester form of meclofenamic acid (MA2) to inhibit the demethylase activity of FTO.
Response Summary	METTL3, METTL14, ALKBH5 and YTHDC2 are involved in the regulation of spermatogenesis and oogenesis. MA2 affected CDKs expression through the m6A-dependent mRNA degradation pathway, and thus repressed spermatogonial proliferation. Additionally, mutation of the predicted m6A sites in the Cdk2-3'UTR could mitigated the degradation of CDK2 mRNA after MA2 treatment.

Click to View Potential Drug Response of This Regulator

Xenobiotics Compound(s) Regulating the m6A Methylation Regulator

Compound Name	DEHP	Investigative
Synonyms	DEHP; 117-81-7; BIS(2-ETHYLHEXYL)PHTHALATE; Di(2-ethylhexyl)phthalate; Di(2-ethylhexyl) phthalate; Diethylhexyl phthalate; 2-Ethylhexyl phthalate; Di-sec-octyl phthalate; Octyl phthalate; Fleximel; Octoil; Ethylhexyl phthalate; Palatinol AH; Celluflex DOP; Vestinol AH; Bisoflex DOP; Kodaflex DOP; Staflex DOP; Truflex DOP; Flexol DOP; Vinicizer 80; Bisoflex 81; Eviplast 80; Eviplast 81; Hercoflex 260; RC plasticizer DOP; Compound 889; Witcizer 312; Platinol dop; Di-2-ethylhexyl phthalate; Nuoplaz dop; Platinol ah; Hatcol dop; Reomol dop; Pittsburgh PX-138; Sansocizer DOP; Ergoplast FDO; Monocizer DOP; Plasthall DOP; Flexol plasticizer DOP; Mollan O; Jayflex DOP; Sicol 150; Ergoplast FDO-S; Di(2-ethylhexyl)orthophthalate; Good-rite gp 264; Reomol D 79P; Bis(2-ethylhexyl) benzene-1,2-dicarboxylate; Di(ethylhexyl) phthalate; Bis(ethylhexyl) phthalate; Rcra waste number U028; Px-138; Phthalic acid dioctyl ester; NCI-C52733; Di(2-ethylhexyl) o-phthalate; Phthalic acid di(2-ethylhexyl) ester; 1,2-Benzenedicarboxylic acid, bis(2-ethylhexyl) ester; DOP; Bis(2-ethylhexyl) 1,2-benzenedicarboxylate; UNII-C42K0PH13C; Bis(2-ethylhexyl) o-phthalate; Phthalic acid, bis(2-ethylhexyl) ester; CHEBI:17747; 1,2-Benzenedicarboxylic acid bis(2-ethylhexyl) ester; Benzenedicarboxylic acid, bis(2-ethylhexyl) ester; Phthalic Acid Bis(2-ethylhexyl) Ester; Bis-(2-ethylhexyl)ester kyseliny ftalove; C42K0PH13C; 1,2-Benzenedicarboxylic acid, 1,2-bis(2-ethylhexyl) ester; DTXSID5020607; Etalon; Bis-(2-ethylhexyl)ester kyseliny ftalove [Czech]; Di-(2-ethylhexyl) phthalate; BIS-(2-ETHYLHEXYL) PHTHALATE; NCGC00091499-05; Sconamoll DOP; Diacizer DOP; Kodaflex DEHP; 15495-94-0; Etalon (plasticizer); Sansocizer R 8000; Caswell No. 392K; Dioctylphthalate; Behp; Di-2-ethylhexylphthalate; Diplast O; ESBO-D 82; Ergoplast FDO; Ergoplast FDO-S; Etalon; Phthalic acid, bis-2-ethylhexyl ester; DOF [Russian plasticizer]; SMR000777878; CCRIS 237; Ethyl hexyl phthalate; HSDB 339; Di(2-ethylhexyl) orthophthalate; Bis-(2-ethylhexyl)ester kyseliny ftalove (czech); EINECS 204-211-0; NSC 17069; Diethylhexylphthalate (Bis-(2-ethylhexyl) Phthalate); RCRA waste no. U028; Union carbide flexol 380; EPA Pesticide Chemical Code 295200; BRN 1890696; AI3-04273; DAF 68; Palatinol DOP; Polycizer DOP; Merrol DOP; Palatinol AH-L; Hatco DOP; Vinycizer 80; Di(2-ethylhexyl)phthalate (DEHP); N-Dioctyl phthalate; MFCD00009493; Corflex 400; Dioctyl phthalate, 99%; DSSTox_CID_607; 1, bis(ethylhexyl) ester; Epitope ID:140107; EC 204-211-0; WLN: 8OVR BVO8; Di(2-Ethylhexyl phthalate); DSSTox_RID_75688; DSSTox_GSID_20607; SCHEMBL20271; 14C -DEHP; 8033-53-2; MLS001333173; MLS001333174; MLS002454397; Dioctyl phthalate, >=99.5%; 1,2-Benzenedicarboxylic acid, bis-(1-ethylhexyl) ester; CHEMBL1242017; SCHEMBL21733281; HMS2233C15; HMS3374J09; AMY40790; HY-B1945; NSC17069; Tox21_400084; Bis(2-ethylhexyl)ester phthalic acid; NSC-17069; s3360; AKOS024318875; Bis(2-ethylhexyl) phthalate-[13C6]; Phthalic acid bis(2-ethylhexyl ester); MCULE-4692716107; NCGC00091499-01; NCGC00091499-02; NCGC00091499-04; NCGC00091499-06; NCGC00091499-07; CAS-117-81-7; I887; Bis(2-ethylhexyl) 1, 2-benzenedicarboxylate; CS-0014050; FT-0624576; FT-0663286; P0297; WLN: 4Y2 & 1OVR BVO1Y4 & 2; Bis(2-ethylhexyl) phthalate, Selectophore(TM); C03690; A937603; Q418492; 1,2-Benzenedicarboxylic acid bis-(1-ethylhexyl) ester; benzene-1,2-dicarboxylic acid bis(2-ethylhexyl) ester; BRD-A89471977-001-05-2; Bis(2-ethylhexyl) phthalate 100 microg/mL in Methanol; Bis(2-ethylhexyl) phthalate 5000 microg/mL in Methanol; F0001-0292; Bis(2-ethylhexyl) phthalate, SAJ first grade, >=98.0%; Bis(2-ethylhexyl) phthalate, PESTANAL(R), analytical standard; Phthalic acid, bis-2-ethylhexyl ester 10 microg/mL in Cyclohexane; Plastic additive 01, European Pharmacopoeia (EP) Reference Standard; Bis(2-ethylhexyl) phthalate, certified reference material, TraceCERT(R); Plastic additive 14, United States Pharmacopeia (USP) Reference Standard; 1,2-Benzenedicarboxylic acid, bis(2-ethylhexyl) ester, labeled with carbon-14; 50885-87-5; 82208-43-3 Click to Show/Hide
External link	CID: 8343
Description	DEHP worsened testicular histology, decreased testosterone concentrations, downregulated expression of spermatogenesis inducers, enhanced oxidative stress, inhibited theNrf2-mediated antioxidant pathway, and increased apoptosis in testes. DEHP is a common environmental endocrine disrupting chemical that inducesmale reproductive disorders. Additionally, DEHP increased global levels of m6A RNA modification and altered the expression of two important RNA methylation modulator genes, FTO and YTHDC2.	[9]
Compound Name	Trichostatin A	Investigative
Synonyms	trichostatin A; 58880-19-6; Trichostatin; TSA; Trichostatin A (TSA); (2E,4E,6R)-7-[4-(Dimethylamino)phenyl]-N-hydroxy-4,6-dimethyl-7-oxohepta-2,4-dienamide; UNII-3X2S926L3Z; Antibiotic A-300; CHEBI:46024; C17H22N2O3; GNF-PF-1011; 3X2S926L3Z; 58880-19-6 (R-isomer); 2,4-Heptadienamide, 7-(4-(dimethylamino)phenyl)-N-hydroxy-4,6-dimethyl-7-oxo-; 7-(4-(Dimethylamino)phenyl)-N-hydroxy-4,6-dimethyl-7-oxo-2,4-heptadienamide; MFCD03848392; (R,2E,4E)-7-(4-(dimethylamino)phenyl)-N-hydroxy-4,6-dimethyl-7-oxohepta-2,4-dienamide; A-300-I; (2E,4E,6R)-7-(4-(dimethylamino)phenyl)-N-hydroxy-4,6-dimethyl-7-oxo-2,4-heptadienamide; [R-(E,E)]-7-[4-(Dimethylamino)phenyl]-N-hydroxy-4,6-dimethyl-7-oxo-2,4-heptadienamide; 2,4-Heptadienamide, 7-[4-(dimethylamino)phenyl]-N-hydroxy-4,6-dimethyl-7-oxo-, (2E,4E,6R)-; Trichostatin-A; Tricostatin A; 7-[4-(DIMETHYLAMINO)PHENYL]-N-HYDROXY-4,6-DIMETHYL-7-OXO-2,4-HEPTADIENAMIDE; 2,4-Heptadienamide, 7-(4-(dimethylamino)phenyl)-N-hydroxy-4,6-dimethyl-7-oxo-, (2E,4E,6R)-; TSN; Trichostatina; trichostatine a; Trichlostatin A; Trichostatin(s); (2E,4E,6R)-7-(4-dimethylaminophenyl)-4,6-dimethyl-7-oxo-hepta-2,4-dienehydroxamic acid; (2E,4E,6R)-7-(4-Dimethylaminophenyl)-N-hydroxy-4,6-dimethyl-7-oxo-hepta-2,4-dienamide; Trichostatin A,TSA; (R)-Trichostatin A; NCGC_TSA; 1c3r; 3f0r; Trichostatin-A - TSA; SCHEMBL19886; MLS006011095; SGCTO-002; SCHEMBL675951; GTPL7005; DTXSID6037063; CHEBI:93196; BCPP000035; HMS1362L09; HMS1792L09; HMS1990L09; HMS3403L09; HMS3649O20; BCP01776; EX-A1665; Trichostatin A, Ready Made Solution; BDBM50005711; LMPK01000055; s1045; Trichostatin A from Streptomyces sp.; AKOS015899840; ZINC100014731; CCG-208142; CCG-208681; CS-0499; DB04297; NSC 311042; NCGC00162453-01; NCGC00162453-02; NCGC00162453-03; NCGC00162453-04; NCGC00162453-05; NCGC00162453-15; 3C10; AS-74315; HY-15144; M984; SMR004702883; A8183; SW219664-1; T2477; A25618; M02571; 880T196; Q425894; SR-05000013796; Q-201864; SR-05000013796-3; BRD-K68202742-001-04-1; BRD-K68202742-001-05-8; Trichostatin A, >=98% (HPLC), from Streptomyces sp.; Trichostatin A, Streptomyces sp. - CAS 58880-19-6; UNII-30RHG284Z4 component RTKIYFITIVXBLE-QEQCGCAPSA-N; Trichostatin A??, Vetec(TM) reagent grade, from Streptomyces sp., >=98%; (2E,4E,6R)-7-(4-(Dimethylamino)phen yl)-N-hydroxy-4,6-dimethyl-7-oxo-2,4-heptadienamid e; (6R)-N-Hydroxy-4,6-dimethyl-7-oxo-7-[4-(dimethylamino)phenyl]-2,4-heptadienamide; 7-[4-(Dimethylamino)phenyl]-N-hydroxy-4,6R-dimethyl-7-oxo-2E,4E-heptadienamide; 2,4-Heptadienamide, 7-[4-(dimethylamino)phenyl]-N-hydroxy-4,6-dimethyl-7-oxo-, (2E,4E,6R)- (9CI); 2,4-Heptadienamide, 7-[4-(dimethylamino)phenyl]-N-hydroxy-4,6-dimethyl-7-oxo-, [R-(E,E)]-; 2,4-Heptadienamide,7-[4-(dimethylamino)phenyl]-N-hydroxy-4,6-dimethyl-7-oxo-, (2E,4E,6R)- Click to Show/Hide
External link	CID: 444732
Description	Treatment with the HDAC inhibitor, trichostatin A (TSA), reduces YTHDC2 expression in Huh7 and in TNF-Alpha-stimulated hepatocytes.	[19]

References

Ref 1	m(6)A Reader YTHDC2 Promotes Radiotherapy Resistance of Nasopharyngeal Carcinoma via Activating IGF1R/AKT/S6 Signaling Axis. Front Oncol. 2020 Jul 31;10:1166. doi: 10.3389/fonc.2020.01166. eCollection 2020.
Ref 2	N(6) -Methyladenosine Reader Protein YT521-B Homology Domain-Containing 2 Suppresses Liver Steatosis by Regulation of mRNA Stability of Lipogenic Genes. Hepatology. 2021 Jan;73(1):91-103. doi: 10.1002/hep.31220. Epub 2020 Oct 25.
Ref 3	Genetic variants in m6A modification genes are associated with esophageal squamous-cell carcinoma in the Chinese population. Carcinogenesis. 2020 Jul 10;41(6):761-768. doi: 10.1093/carcin/bgaa012.
Ref 4	The m(6)A reader YTHDC2 inhibits lung adenocarcinoma tumorigenesis by suppressing SLC7A11-dependent antioxidant function. Redox Biol. 2021 Jan;38:101801. doi: 10.1016/j.redox.2020.101801. Epub 2020 Nov 18.
Ref 5	Methylation of adenosine at the N(6) position post-transcriptionally regulates hepatic P450s expression. Biochem Pharmacol. 2020 Jan;171:113697. doi: 10.1016/j.bcp.2019.113697. Epub 2019 Nov 7.
Ref 6	Protective role of m(6)A binding protein YTHDC2 on CCNB2 in manganese-induced spermatogenesis dysfunction. Chem Biol Interact. 2022 Jan 5;351:109754. doi: 10.1016/j.cbi.2021.109754. Epub 2021 Nov 22.
Ref 7	RNA helicase YTHDC2 promotes cancer metastasis via the enhancement of the efficiency by which HIF-1Alpha mRNA is translated. Cancer Lett. 2016 Jun 28;376(1):34-42. doi: 10.1016/j.canlet.2016.02.022. Epub 2016 Mar 17.
Ref 8	The m(6)A reader YTHDC2 is essential for escape from KSHV SOX-induced RNA decay. Proc Natl Acad Sci U S A. 2022 Feb 22;119(8):e2116662119. doi: 10.1073/pnas.2116662119.
Ref 9	Increased m6A RNA modification is related to the inhibition of the Nrf2-mediated antioxidant response in di-(2-ethylhexyl) phthalate-induced prepubertal testicular injury. Environ Pollut. 2020 Apr;259:113911. doi: 10.1016/j.envpol.2020.113911. Epub 2020 Jan 6.
Ref 10	The N6-methyladenosine reader protein YTHDC2 promotes gastric cancer progression via enhancing YAP mRNA translation. Transl Oncol. 2022 Feb;16:101308. doi: 10.1016/j.tranon.2021.101308. Epub 2021 Dec 12.
Ref 11	Downregulation of m(6)A Reader YTHDC2 Promotes the Proliferation and Migration of Malignant Lung Cells via CYLD/NF-KappaB Pathway. Int J Biol Sci. 2021 Jun 22;17(10):2633-2651. doi: 10.7150/ijbs.58514. eCollection 2021.
Ref 12	YTHDC2-Mediated circYTHDC2 N6-Methyladenosine Modification Promotes Vascular Smooth Muscle Cells Dysfunction Through Inhibiting Ten-Eleven Translocation 2. Front Cardiovasc Med. 2021 Oct 1;8:686293. doi: 10.3389/fcvm.2021.686293. eCollection 2021.
Ref 13	Analysis of Genetic Alteration Signatures and Prognostic Values of m6A Regulatory Genes in Head and Neck Squamous Cell Carcinoma. Front Oncol. 2020 May 29;10:718. doi: 10.3389/fonc.2020.00718. eCollection 2020.
Ref 14	Prognostic Implication of the m(6)A RNA Methylation Regulators in Rectal Cancer. Front Genet. 2021 Jun 3;12:604229. doi: 10.3389/fgene.2021.604229. eCollection 2021.
Ref 15	[Role of m (6)A Reader YTHDC2 in Differentiation of Human Bone Marrow Mesenchymal Stem Cells]. Sichuan Da Xue Xue Bao Yi Xue Ban. 2021 May;52(3):402-408. doi: 10.12182/20210560204.
Ref 16	Pathogenic variants in the human m6A reader YTHDC2 are associated with primary ovarian insufficiency. JCI Insight. 2022 Mar 8;7(5):e154671. doi: 10.1172/jci.insight.154671.
Ref 17	Meclofenamic acid represses spermatogonial proliferation through modulating m(6)A RNA modification. J Anim Sci Biotechnol. 2019 Jul 11;10:63. doi: 10.1186/s40104-019-0361-6. eCollection 2019.
Ref 18	Ythdc2 is an N(6)-methyladenosine binding protein that regulates mammalian spermatogenesis. Cell Res. 2017 Sep;27(9):1115-1127. doi: 10.1038/cr.2017.99. Epub 2017 Aug 15.
Ref 19	Transcriptional machinery of TNF-Alpha-inducible YTH domain containing 2 (YTHDC2) gene. Gene. 2014 Feb 1;535(1):24-32. doi: 10.1016/j.gene.2013.11.005. Epub 2013 Nov 21.

m6A Regulator Information

Cite M6AREG

Correspondence

Prof. Feng ZHU

Prof. Shuiping Liu

Visitor Map