m6A Regulator Information

General Information of the m6A Regulator (ID: REG00014)
Regulator Name Insulin-like growth factor 2 mRNA-binding protein 3 (IGF2BP3)
Synonyms
IGF2 mRNA-binding protein 3; IMP-3; IGF-II mRNA-binding protein 3; KH domain-containing protein overexpressed in cancer; hKOC; VICKZ family member 3; IMP3; KOC1; VICKZ3
    Click to Show/Hide
Gene Name IGF2BP3
Sequence
MNKLYIGNLSENAAPSDLESIFKDAKIPVSGPFLVKTGYAFVDCPDESWALKAIEALSGK
IELHGKPIEVEHSVPKRQRIRKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDSETA
VVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLGQRGSS
RQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAA
EKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLK
KIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNL
QAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAI
IGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFV
SPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKIT
GHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK
    Click to Show/Hide
Family RRM IMP/VICKZ family
Function
RNA-binding factor that may recruit target transcripts to cytoplasmic protein-RNA complexes (mRNPs). This transcript 'caging' into mRNPs allows mRNA transport and transient storage. It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation. Binds to the 3'-UTR of CD44 mRNA and stabilizes it, hence promotes cell adhesion and invadopodia formation in cancer cells. Binds to beta-actin/ACTB and MYC transcripts. Binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs.
    Click to Show/Hide
Gene ID 10643
Uniprot ID
IF2B3_HUMAN
Regulator Type WRITER ERASER READER
Mechanism Diagram Click to View the Original Diagram
Target Genes Click to View Potential Target Genes of This Regulator
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
IGF2BP3 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Browse Target Gene related Drug
ATP-dependent translocase ABCB1 (ABCB1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP3
Cell Line ES-2 cell line Homo sapiens
Treatment: siIGF2BP3 ES-2 cells
Control: siControl ES-2 cells
 GSE109604
Regulation
logFC: -1.30E+00
p-value: 4.65E-03
More Results Click to View More RNA-seq Results
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Doxil Approved
 Drug Info 
Target Regulation Up regulation
Pathway Response ABC transporters hsa02010
Cell Process RNA stability
In-vitro Model
 DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HCT 15 Colon adenocarcinoma Homo sapiens CVCL_0292
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
HT29 Colon cancer Mus musculus CVCL_A8EZ
SW1463 Rectal adenocarcinoma Homo sapiens CVCL_1718
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model HCT8/T xenografts derived from shNC or shIGF2BP3-1 HCT8/T cells were established through subcutaneous inoculation of cells (6×106) into nude mice.
Response Summary IGF2BP3, directly bound to the m6A-modified region of ATP-dependent translocase ABCB1 (ABCB1) mRNA, thereby promoting the stability and expression of ABCB1 mRNA. The expression of IGF2BP3 and ABCB1 was strongly correlated with DOX sensitivity. Targeting IGF2BP3 was an important chemotherapeutic strategy for preventing MDR development in colorectal cancer.
Bax inhibitor 1 (TMBIM6)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP3
Cell Line ES-2 cell line Homo sapiens
Treatment: siIGF2BP3 ES-2 cells
Control: siControl ES-2 cells
 GSE109604
Regulation
logFC: -8.65E-01
p-value: 2.88E-02
More Results Click to View More RNA-seq Results
Laryngeal cancer [ICD-11: 2C23]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Laryngeal cancer [ICD-11: 2C23]
Target Regulation Up regulation
Cell Process RNA stability
Cell apoptosis
In-vitro Model
 AMC-HN-8 Laryngeal squamous cell carcinoma Homo sapiens CVCL_5966
NHBEC (Normal human bronchial epithelial cell)
Tu 177 Laryngeal squamous cell carcinoma Homo sapiens CVCL_4913
Tu 212 Head and neck squamous cell carcinoma Homo sapiens CVCL_4915
In-vivo Model For tumor growth studies, whether in vivo RBM15 knockdown/overexpression experiments or in vivo rescue experiments, each group included six mice. Each mouse was injected with 100 uL of lentivirus-transfected tumor cells.
Response Summary RBM15-mediated m6A modification of Bax inhibitor 1 (TMBIM6) mRNA enhanced TMBIM6 stability through IGF2BP3-dependent. Laryngeal squamous cell cancer cells were transfected with shRBM15 lentivirus for 48h, and the qRT-PCR data indicated that the mRNA levels of CPNE5, TMBIM6, and ATAD3A decreased after RBM15 knockdown.
Hepatoma-derived growth factor (HDGF)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP3
Cell Line ES-2 cell line Homo sapiens
Treatment: siIGF2BP3 ES-2 cells
Control: siControl ES-2 cells
 GSE109604
Regulation
logFC: -6.81E-01
p-value: 1.47E-02
More Results Click to View More RNA-seq Results
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Pathway Response Glycolysis / Gluconeogenesis hsa00010
Cell Process Glycolysis
In-vitro Model
 HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
NCI-N87 Gastric tubular adenocarcinoma Homo sapiens CVCL_1603
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
In-vivo Model Mice 8 weeks after splenic portal vein injection of BGC823 cells with METTL3 overexpression or vector-transfected cells.
Response Summary Elevated METTL3 expression promotes tumour angiogenesis and glycolysis in Gastric cancer. P300-mediated H3K27 acetylation activation in the promoter of METTL3 induced METTL3 transcription, which stimulated m6A modification of Hepatoma-derived growth factor (HDGF) mRNA, and the m6A reader IGF2BP3 then directly recognised and bound to the m6A site on HDGF mRNA and enhanced HDGF mRNA stability.
MARCKS-related protein (MARCKSL1)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and IGF2BP3
Cell Line HEK293T Homo sapiens
Regulation logFC: 1.28E+00 GSE90639
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Cell Process RNA decay
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, FSCN1, TK1, and MARCKS-related protein (MARCKSL1), exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Cell Process RNA decay
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, FSCN1, TK1, and MARCKS-related protein (MARCKSL1), exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.
Protein RCC2 (RCC2)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and IGF2BP3
Cell Line HEK293T Homo sapiens
Regulation logFC: 1.30E+00 GSE90639
Acute myeloid leukaemia [ICD-11: 2A60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [5]
Responsed Disease Acute myeloid leukaemia [ICD-11: 2A60]
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model
 THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
SUP-B15 B-lymphoblastic leukemia Homo sapiens CVCL_0103
KG-1 Adult acute myeloid leukemia Homo sapiens CVCL_0374
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
HL-60 Adult acute myeloid leukemia Homo sapiens CVCL_0002
Response Summary IGF2BP3 is required for maintaining AML cell survival in an m6A-dependent manner, and knockdown of IGF2BP3 dramatically suppresses the apoptosis, reduces the proliferation, and impairs the leukemic capacity of AML cells in vitro and in vivo.IGF2BP3 interacts with Protein RCC2 (RCC2) mRNA and stabilizes the expression of m6A-modified RNA.
Y-box-binding protein 1 (YBX1)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and IGF2BP3
Cell Line HEK293T Homo sapiens
Regulation logFC: 2.22E+00 GSE90639
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Myeloid leukaemia [ICD-11: 2B33.1]
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model
 Leukemia stem cell line (Leukemia stem cell line)
Kasumi-1 Myeloid leukemia with maturation Homo sapiens CVCL_0589
MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
BV-173 Chronic myelogenous leukemia Homo sapiens CVCL_0181
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KG-1a Adult acute myeloid leukemia Homo sapiens CVCL_1824
Response Summary Y-box-binding protein 1 (YBX1) selectively functions in regulating survival of myeloid leukemia cells. YBX1 interacts with insulin-like growth factor 2 messenger RNA (mRNA)-binding proteins (IGF2BPs) and stabilizes m6A-tagged RNA. YBX1 deficiency dysregulates the expression of apoptosis-related genes and promotes mRNA decay of MYC and BCL2 in an m6A-dependent manner, which contributes to the defective survival that results from deletion of YBX1.
Metastasis associated lung adenocarcinoma transcript 1 (MALAT1)
 Target Gene 
Representative RIP-seq result supporting the interaction between the target gene and IGF2BP3
Cell Line HEK293T Homo sapiens
Regulation logFC: 2.96E+00 GSE90639
Atopic eczema [ICD-11: EA80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Atopic eczema [ICD-11: EA80]
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
Ubiquitin mediated proteolysis hsa04120
Cell Process Inflammation
Proteasome pathway degradation
In-vitro Model
 RAW 264.7 Mouse leukemia Mus musculus CVCL_0493
In-vivo Model IMQ-induced psoriatic model was constructed by applying 10 mg per ear 5% IMQ for 8 consecutive days, and 6 ug macrophage-specific control or hsa_circ_0004287 plasmid was topically applied every 2 days (5 mice per group per experiment).
Response Summary circRNA hsa_circ_0004287 was upregulated in peripheral blood mononuclear cells of both AD and psoriasis patients. hsa_circ_0004287 reduced the stability of its host gene Metastasis associated lung adenocarcinoma transcript 1 (MALAT1) by competitively binding to IGF2BP3 with MALAT1 in an N6-methyladenosine (m6A)-dependent manner.
Apoptosis regulator Bcl-2 (BCL2)
 Target Gene 
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Myeloid leukaemia [ICD-11: 2B33.1]
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model
 Leukemia stem cell line (Leukemia stem cell line)
Kasumi-1 Myeloid leukemia with maturation Homo sapiens CVCL_0589
MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
BV-173 Chronic myelogenous leukemia Homo sapiens CVCL_0181
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KG-1a Adult acute myeloid leukemia Homo sapiens CVCL_1824
Response Summary YBX1 selectively functions in regulating survival of myeloid leukemia cells. YBX1 interacts with insulin-like growth factor 2 messenger RNA (mRNA)-binding proteins (IGF2BPs) and stabilizes m6A-tagged RNA. YBX1 deficiency dysregulates the expression of apoptosis-related genes and promotes mRNA decay of MYC and Apoptosis regulator Bcl-2 (BCL2) in an m6A-dependent manner, which contributes to the defective survival that results from deletion of YBX1.
Apoptotic chromatin condensation inducer in the nucleus (ACIN1)
 Target Gene 
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [8]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Up regulation
Pathway Response mRNA surveillance pathway hsa03015
RNA degradation hsa03018
Cell Process RNA stability
In-vitro Model
 SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
End1/E6E7 Normal Homo sapiens CVCL_3684
In-vivo Model 2 × 106 stably transfected HeLa cells were subcutaneously inoculated into the left flank of mice.
Response Summary METTL3 interacts with IGF2BP3 to promote the mRNA stability of Apoptotic chromatin condensation inducer in the nucleus (ACIN1), the overexpression of which induces the aggressiveness of CC cells.
Complex I-AGGG (NDUFB2)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [9]
Responsed Disease Non-small-cell lung carcinoma [ICD-11: 2C25.Y]
Target Regulation Down regulation
Pathway Response Ubiquitin mediated proteolysis hsa04120
Cell Process Tumour immunology
Ubiquitination degradation
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
BEAS-2B Normal Homo sapiens CVCL_0168
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
NCI-H1650 Minimally invasive lung adenocarcinoma Homo sapiens CVCL_1483
NCI-H1703 Lung squamous cell carcinoma Homo sapiens CVCL_1490
NCI-H1975 Lung adenocarcinoma Homo sapiens CVCL_1511
NCI-H460 Lung large cell carcinoma Homo sapiens CVCL_0459
HCC827 Lung adenocarcinoma Homo sapiens CVCL_2063
LL/2 (LLC1) Malignant tumors Mus musculus CVCL_4358
In-vivo Model A549 cells were transfected with the pZW1-FCS-circNDUFB2 plasmid or pZW1-FCS-Vector plasmid, and selected with G418 (800 ug/ml) for 4 weeks, and then 2 × 106 A549 cells were subcutaneously injected into the right flank of each mouse.
Response Summary Complex I-AGGG (NDUFB2) interacts with IGF2BP1/2/3 in NSCLC cells. circNDUFB2 participates in the degradation of IGF2BPs and activation of anti-tumor immunity during NSCLC progression via the modulation of both protein ubiquitination and degradation, as well as cellular immune responses.
Cyclin-dependent kinase 4 (CDK4)
 Target Gene 
Renal cell carcinoma [ICD-11: 2C90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease Renal cell carcinoma of kidney [ICD-11: 2C90.0]
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process Accelerating the G1-S transition
Cell invasion and metastasis
In-vitro Model
 769-P Renal cell carcinoma Homo sapiens CVCL_1050
786-O Renal cell carcinoma Homo sapiens CVCL_1051
ACHN Papillary renal cell carcinoma Homo sapiens CVCL_1067
Caki-1 Clear cell renal cell carcinoma Homo sapiens CVCL_0234
In-vivo Model Stable DMDRMR knockdown (KD) and control cell lines were injected subcutaneously (s.c.; 1 × 107 cells/inoculum) into the flanks of recipient NOD/SCID/IL2Rγ-null (NSG) mice.
Response Summary DMDRMR is a protumorigenic lncRNA that mediates the stabilization of IGF2BP3 targets in an m6A-dependent manner in clear cell renal cell carcinoma. IGF2BP3 and DMDRMR cooperate to play oncogenic roles. IGF2BP3 cooperates with DMDRMR to regulate Cyclin-dependent kinase 4 (CDK4) by enhancing mRNA stability.
Ephrin type-A receptor 2 (EphA2)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
In-vitro Model
 SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
NCM460 Normal Homo sapiens CVCL_0460
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
In-vivo Model A total of 8 × 106 wild-type (WT) or METTL3-knockdown cells were injected into the dorsal flanks of 6-week-old nude mice. Seven mice were randomly selected to calculate the volume according to the following formula: V = (width2 × length)/2. Mice were euthanized three weeks after injection and tumors removed, weighed, fixed, and embedded for immunohistochemical analysis.
Response Summary Ephrin type-A receptor 2 (EphA2) and VEGFA targeted by METTL3 via different IGF2BP3-dependent mechanisms were found to promote vasculogenic mimicry (VM) formation via PI3K/AKT/mTOR and ERK1/2 signaling in CRC.
Fascin (FSCN1)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Cell Process RNA decay
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, Fascin (FSCN1), TK1, and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Cell Process RNA decay
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, Fascin (FSCN1), TK1, and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.
Glucose transporter type 1 (SLC2A1)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Glycolysis / Gluconeogenesis hsa00010
Cell Process Glucose metabolism
Response Summary METTL3 stabilizes HK2 and Glucose transporter type 1 (SLC2A1) (GLUT1) expression in colorectal cancer through an m6A-IGF2BP2/3- dependent mechanism.
Hexokinase-2 (HK2)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [12]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response Glycolysis / Gluconeogenesis hsa00010
Cell Process Glucose metabolism
Response Summary METTL3 stabilizes Hexokinase-2 (HK2) and SLC2A1 (GLUT1) expression in colorectal cancer through an m6A-IGF2BP2/3- dependent mechanism.
Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [13]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Cell Process Cell migration
In-vitro Model
 MKN45 Gastric adenocarcinoma Homo sapiens CVCL_0434
HUVEC-C Normal Homo sapiens CVCL_2959
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
Response Summary IGF2BP3 positively regulated Hypoxia-inducible factor 1-alpha (HIF-1-Alpha/HIF1A) expression by directly binding to a specific m6A site in the coding region of HIF1A mRNA in gastric cancer cells. IGF2BP3 and HIF1A were highly expressed in GC tissues and hypoxia-treated GC cells.
Myc proto-oncogene protein (MYC)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [14]
Responsed Disease Glioma [ICD-11: 2A00.0]
Target Regulation Up regulation
Pathway Response RNA degradation hsa03018
Cell Process RNA stability
In-vitro Model
 ()
HNP1 (A human neural progenitor cell)
NHA (Normal human astrocytes)
NSC11 (Pluripotent derived neural progenitor cell)
In-vivo Model For in vivo drug treatment studies, intracranial xenografts were generated by implanting 5000 patient-derived GSCs (387 and 4121) into the right cerebral cortex of NSG mice as described above.
Response Summary The m6A reader YTHDF2 stabilized Myc proto-oncogene protein (MYC) mRNA specifically in cancer stem cells. Given the challenge of targeting MYC, YTHDF2 presents a therapeutic target to perturb MYC signaling in glioblastoma. The IGF1/IGF1R inhibitor linsitinib preferentially targeted YTHDF2-expressing cells, inhibiting GSC viability without affecting NSCs and impairing in vivo glioblastoma growth. YTHDF2 links RNA epitranscriptomic modifications and GSC growth, laying the foundation for the YTHDF2-MYC-IGFBP3 axis as a specific and novel therapeutic target in glioblastoma.
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [6]
Responsed Disease Myeloid leukaemia [ICD-11: 2B33.1]
Target Regulation Up regulation
Cell Process Cell apoptosis
In-vitro Model
 Leukemia stem cell line (Leukemia stem cell line)
Kasumi-1 Myeloid leukemia with maturation Homo sapiens CVCL_0589
MOLM-13 Adult acute myeloid leukemia Homo sapiens CVCL_2119
THP-1 Childhood acute monocytic leukemia Homo sapiens CVCL_0006
MV4-11 Childhood acute monocytic leukemia Homo sapiens CVCL_0064
BV-173 Chronic myelogenous leukemia Homo sapiens CVCL_0181
NOMO-1 Adult acute monocytic leukemia Homo sapiens CVCL_1609
K-562 Chronic myelogenous leukemia Homo sapiens CVCL_0004
KG-1a Adult acute myeloid leukemia Homo sapiens CVCL_1824
Response Summary YBX1 selectively functions in regulating survival of myeloid leukemia cells. YBX1 interacts with insulin-like growth factor 2 messenger RNA (mRNA)-binding proteins (IGF2BPs) and stabilizes m6A-tagged RNA. YBX1 deficiency dysregulates the expression of apoptosis-related genes and promotes mRNA decay of Myc proto-oncogene protein (MYC) and BCL2 in an m6A-dependent manner, which contributes to the defective survival that results from deletion of YBX1.
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Cell Process RNA decay
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including Myc proto-oncogene protein (MYC), FSCN1, TK1, and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Cell Process RNA decay
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including Myc proto-oncogene protein (MYC), FSCN1, TK1, and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.
Myt1 kinase (PKMYT1)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [15]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Target Regulation Up regulation
Cell Process Cell invasion
Cell migration
In-vitro Model
 SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
HGC-27 Gastric carcinoma Homo sapiens CVCL_1279
BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
In-vivo Model After randomly assignment and anesthetization, nude mice were injected with 5 × 106 cells suspended in 100 uL PBS into the tail vein (n = 5 per group).
Response Summary Myt1 kinase (PKMYT1), as a downstream target of ALKBH5, promoted invasion and migration in GC. Moreover IGF2BP3 helped stabilize the mRNA stability of PKMYT1 via its m6A modification site.
Programmed cell death 1 ligand 1 (CD274/PD-L1)
 Target Gene 
Breast cancer [ICD-11: 2C60]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [16]
Responsed Disease Breast cancer [ICD-11: 2C60]
Target Regulation Up regulation
Pathway Response PD-L1 expression and PD-1 checkpoint pathway in cancer hsa05235
Cell Process Tumor immune escape
In-vitro Model
 SK-BR-3 Breast adenocarcinoma Homo sapiens CVCL_0033
MDA-MB-231 Breast adenocarcinoma Homo sapiens CVCL_0062
MCF-10A Normal Homo sapiens CVCL_0598
HCC38 Breast ductal carcinoma Homo sapiens CVCL_1267
4T1 Normal Mus musculus CVCL_0125
In-vivo Model For subcutaneous xenograft experiments in B-NDG mice, approximately 1 × 106 MDA-MB-231 and there was subcutaneous injection of the cells that resuspended in 100 uL PBS into the left flank of the mice and were divided into 11 groups randomly (each containing 5 mice). After the treatment Atezolizumab (Selleck, Shanghai, China) or corresponding iso control antibody (Selleck, Shanghai, China) was injected intratumorally on day 3, 6, 9, 12, 15 post-MDA-MB-231 inoculations, and 5 × 106 cytokine-induced killer (CIK) cells were injected in the tail vein on day 7, 14, 21.
Response Summary Programmed cell death 1 ligand 1 (CD274/PD-L1) was a downstream target of METTL3-mediated m6A modification in breast cancer cells. METTL3-mediated PD-L1 mRNA activation was m6A-IGF2BP3-dependent. PD-L1 expression was also positively correlated with METTL3 and IGF2BP3 expression in breast cancer tissues.
Thymidine kinase, cytosolic (TK1)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Hepatocellular carcinoma [ICD-11: 2C12.02]
Cell Process RNA decay
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, FSCN1, Thymidine kinase, cytosolic (TK1), and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Cell Process RNA decay
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
HEK293T Normal Homo sapiens CVCL_0063
HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
Response Summary In contrast to the mRNA-decay-promoting function of YTH domain-containing family protein 2, IGF2BPs promote the stability and storage of their target mRNAs (for example, MYC) in an m6A-dependent manner under normal and stress conditions and therefore affect gene expression output. Four representative high confidence targets, including MYC, FSCN1, Thymidine kinase, cytosolic (TK1), and MARCKSL1, exhibit strong binding with IGF2BPs around their m6A motifs in control cells. Knocking down of each individual IGF2BPs in Hela (cervical cancer) and HepG2 (liver cancer) cells significantly repressed MYC expression.
Vang-like protein 1 (VANGL1)
 Target Gene 
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [17]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Target Regulation Up regulation
Pathway Response Nucleotide excision repair hsa03420
Cell Process DNA repair
In-vitro Model
 A-549 Lung adenocarcinoma Homo sapiens CVCL_0023
NCI-H1299 Lung large cell carcinoma Homo sapiens CVCL_0060
In-vivo Model Two hundred milliliters of A549 cells (1 × 106) were injected into the left flank of the back of each mouse.
Response Summary Up-regulation of Vang-like protein 1 (VANGL1) by IGF2BPs and miR-29b-3p attenuates the detrimental effect of irradiation on lung adenocarcinoma. Increased m6A level of VANGL1 and reduced miR-29b-3p took the responsibility of VANGL1 overexpression upon irradiation.
Vascular endothelial growth factor A (VEGFA)
 Target Gene 
Colon cancer [ICD-11: 2B90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [18]
Responsed Disease Colon cancer [ICD-11: 2B90]
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
VEGF signaling pathway hsa04370
Cell Process Arrest cell cycle at S phase
In-vitro Model
 SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW1116 Colon adenocarcinoma Homo sapiens CVCL_0544
RKO Colon carcinoma Homo sapiens CVCL_0504
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
In-vivo Model All the mice (n = 12) were equally and randomly divided into the HCT-scr and HCT-shMETTL3 group. 3 × 106 HCT-scr or HCT-shIGF2BP3 cells suspended in 100 uL PBS were injected subcutaneously from the axilla of each nude mice. After 1 weeks, the long (L) and short (S) diameter of the tumors were measured with vernier caliper every 3 days (tumor volume = L*S2/2). The growth curve of subcutaneous tumors was drawn on the basis of the measured tumor volume. All mice were killed after 17 days since injection of colon cancer cells and subcutaneous tumors were removed completely.
Response Summary Knockdown of IGF2BP3 repressed DNA replication in the S phase of cell cycle and angiogenesis via reading m6A modification of CCND1 and Vascular endothelial growth factor A (VEGFA) respectively. Knockdown of IGF2BP3 repressed angiogenesis in colon cancer via regulating VEGF.
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [11]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Target Regulation Up regulation
Pathway Response PI3K-Akt signaling pathway hsa04151
In-vitro Model
 SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
NCM460 Normal Homo sapiens CVCL_0460
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
HT29 Colon cancer Mus musculus CVCL_A8EZ
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
In-vivo Model A total of 8 × 106 wild-type (WT) or METTL3-knockdown cells were injected into the dorsal flanks of 6-week-old nude mice. Seven mice were randomly selected to calculate the volume according to the following formula: V = (width2 × length)/2. Mice were euthanized three weeks after injection and tumors removed, weighed, fixed, and embedded for immunohistochemical analysis.
Response Summary EphA2 and Vascular endothelial growth factor A (VEGFA) targeted by METTL3 via different IGF2BP3-dependent mechanisms were found to promote vasculogenic mimicry (VM) formation via PI3K/AKT/mTOR and ERK1/2 signaling in CRC.
CDR1 antisense RNA (CDR1-AS)
 Target Gene 
Melanoma [ICD-11: 2C30]
In total 3 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Melanoma [ICD-11: 2C30]
Responsed Drug ML-210 Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 451Lu Cutaneous melanoma Homo sapiens CVCL_6357
501-mel Melanoma Homo sapiens CVCL_4633
A-375 Amelanotic melanoma Homo sapiens CVCL_0132
SK-MEL-147 Melanoma Homo sapiens CVCL_3876
SK-MEL-173 Melanoma Homo sapiens CVCL_6090
SK-MEL-2 Melanoma Homo sapiens CVCL_0069
SK-MEL-239 Melanoma Homo sapiens CVCL_6122
SK-MEL-28 Cutaneous melanoma Homo sapiens CVCL_0526
WM115 Melanoma Homo sapiens CVCL_0040
WM1361A Cutaneous melanoma Homo sapiens CVCL_6788
WM1552C Cutaneous melanoma Homo sapiens CVCL_6472
WM266-4 Melanoma Homo sapiens CVCL_2765
WM278 Cutaneous melanoma Homo sapiens CVCL_6473
WM35 Melanoma Homo sapiens CVCL_0580
WM793b (Immunodeficient mice Cell Type melanocyte)
WM902B Melanoma Homo sapiens CVCL_6807
In-vivo Model 4-6 weeks old NOD/Shi-scid/IL-2Rgamma null (NOD.Cg-PrkdcscidIl2rgtm1Wjl/SzJ (NSG)) mice (female).
Response Summary CDR1 antisense RNA (CDR1-AS) a regulator of miR-7, as a hallmark of melanoma progression. CDR1as depletion results from epigenetic silencing of LINC00632, its originating long non-coding RNA (lncRNA) and promotes invasion in vitro and metastasis in vivo through a miR-7-independent, IGF2BP3-mediated mechanism. IGF2BP3 interacts with CDR1as and mediates invasion induced by CDR1as depletion. CDR1asHigh melanoma cell lines were strikingly more sensitive to three different GPX4 inhibitors, which are known to elicit ferroptotic cell death.
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Melanoma [ICD-11: 2C30]
Responsed Drug ML162 Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 451Lu Cutaneous melanoma Homo sapiens CVCL_6357
501-mel Melanoma Homo sapiens CVCL_4633
A-375 Amelanotic melanoma Homo sapiens CVCL_0132
SK-MEL-147 Melanoma Homo sapiens CVCL_3876
SK-MEL-173 Melanoma Homo sapiens CVCL_6090
SK-MEL-2 Melanoma Homo sapiens CVCL_0069
SK-MEL-239 Melanoma Homo sapiens CVCL_6122
SK-MEL-28 Cutaneous melanoma Homo sapiens CVCL_0526
WM115 Melanoma Homo sapiens CVCL_0040
WM1361A Cutaneous melanoma Homo sapiens CVCL_6788
WM1552C Cutaneous melanoma Homo sapiens CVCL_6472
WM266-4 Melanoma Homo sapiens CVCL_2765
WM278 Cutaneous melanoma Homo sapiens CVCL_6473
WM35 Melanoma Homo sapiens CVCL_0580
WM793b (Immunodeficient mice Cell Type melanocyte)
WM902B Melanoma Homo sapiens CVCL_6807
In-vivo Model 4-6 weeks old NOD/Shi-scid/IL-2Rgamma null (NOD.Cg-PrkdcscidIl2rgtm1Wjl/SzJ (NSG)) mice (female).
Response Summary CDR1 antisense RNA (CDR1-AS) a regulator of miR-7, as a hallmark of melanoma progression. CDR1as depletion results from epigenetic silencing of LINC00632, its originating long non-coding RNA (lncRNA) and promotes invasion in vitro and metastasis in vivo through a miR-7-independent, IGF2BP3-mediated mechanism. IGF2BP3 interacts with CDR1as and mediates invasion induced by CDR1as depletion. CDR1asHigh melanoma cell lines were strikingly more sensitive to three different GPX4 inhibitors, which are known to elicit ferroptotic cell death.
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [19]
Responsed Disease Melanoma [ICD-11: 2C30]
Responsed Drug RSL3 Investigative
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 451Lu Cutaneous melanoma Homo sapiens CVCL_6357
501-mel Melanoma Homo sapiens CVCL_4633
A-375 Amelanotic melanoma Homo sapiens CVCL_0132
SK-MEL-147 Melanoma Homo sapiens CVCL_3876
SK-MEL-173 Melanoma Homo sapiens CVCL_6090
SK-MEL-2 Melanoma Homo sapiens CVCL_0069
SK-MEL-239 Melanoma Homo sapiens CVCL_6122
SK-MEL-28 Cutaneous melanoma Homo sapiens CVCL_0526
WM115 Melanoma Homo sapiens CVCL_0040
WM1361A Cutaneous melanoma Homo sapiens CVCL_6788
WM1552C Cutaneous melanoma Homo sapiens CVCL_6472
WM266-4 Melanoma Homo sapiens CVCL_2765
WM278 Cutaneous melanoma Homo sapiens CVCL_6473
WM35 Melanoma Homo sapiens CVCL_0580
WM793b (Immunodeficient mice Cell Type melanocyte)
WM902B Melanoma Homo sapiens CVCL_6807
In-vivo Model 4-6 weeks old NOD/Shi-scid/IL-2Rgamma null (NOD.Cg-PrkdcscidIl2rgtm1Wjl/SzJ (NSG)) mice (female).
Response Summary CDR1 antisense RNA (CDR1-AS) a regulator of miR-7, as a hallmark of melanoma progression. CDR1as depletion results from epigenetic silencing of LINC00632, its originating long non-coding RNA (lncRNA) and promotes invasion in vitro and metastasis in vivo through a miR-7-independent, IGF2BP3-mediated mechanism. IGF2BP3 interacts with CDR1as and mediates invasion induced by CDR1as depletion. CDR1asHigh melanoma cell lines were strikingly more sensitive to three different GPX4 inhibitors, which are known to elicit ferroptotic cell death.
KCNMB2 antisense RNA 1 (KCNMB2-AS1)
 Target Gene 
Cervical cancer [ICD-11: 2C77]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [20]
Responsed Disease Cervical cancer [ICD-11: 2C77]
Target Regulation Up regulation
Cell Process Cell proliferation
Cell apoptosis
In-vitro Model
 HeLa Endocervical adenocarcinoma Homo sapiens CVCL_0030
SiHa Cervical squamous cell carcinoma Homo sapiens CVCL_0032
In-vivo Model A total of 1 × 107 control or KCNMB2-AS1-depleted SiHa cells were resuspended in 0.1 ml phosphate-buffered saline and inoculated into the armpit of 5-week-old male BALB/c nude mice.
Response Summary KCNMB2 antisense RNA 1 (KCNMB2-AS1) and IGF2BP3 formed a positive regulatory circuit that enlarged the tumorigenic effect of KCNMB2-AS1 in cervical cancer.
hsa_circ_0004287
 Target Gene 
Atopic eczema [ICD-11: EA80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [7]
Responsed Disease Atopic eczema [ICD-11: EA80]
Target Regulation Up regulation
Pathway Response MAPK signaling pathway hsa04010
Ubiquitin mediated proteolysis hsa04120
Cell Process Inflammation
Proteasome pathway degradation
In-vitro Model
 RAW 264.7 Mouse leukemia Mus musculus CVCL_0493
In-vivo Model IMQ-induced psoriatic model was constructed by applying 10 mg per ear 5% IMQ for 8 consecutive days, and 6 ug macrophage-specific control or hsa_circ_0004287 plasmid was topically applied every 2 days (5 mice per group per experiment).
Response Summary hsa_circ_0004287 was upregulated in peripheral blood mononuclear cells of both AD and psoriasis patients. hsa_circ_0004287 reduced the stability of its host gene metastasis associated lung adenocarcinoma transcript 1 (MALAT1) by competitively binding to IGF2BP3 with MALAT1 in an N6-methyladenosine (m6A)-dependent manner.
DMDRMR
 Target Gene 
Renal cell carcinoma [ICD-11: 2C90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [10]
Responsed Disease Renal cell carcinoma of kidney [ICD-11: 2C90.0]
Target Regulation Up regulation
Pathway Response Cell cycle hsa04110
Cell Process Accelerating the G1-S transition
Cell invasion and metastasis
In-vitro Model
 769-P Renal cell carcinoma Homo sapiens CVCL_1050
786-O Renal cell carcinoma Homo sapiens CVCL_1051
ACHN Papillary renal cell carcinoma Homo sapiens CVCL_1067
Caki-1 Clear cell renal cell carcinoma Homo sapiens CVCL_0234
In-vivo Model Stable DMDRMR knockdown (KD) and control cell lines were injected subcutaneously (s.c.; 1 × 107 cells/inoculum) into the flanks of recipient NOD/SCID/IL2Rγ-null (NSG) mice.
Response Summary DMDRMR is a protumorigenic lncRNA that mediates the stabilization of IGF2BP3 targets in an m6A-dependent manner in clear cell renal cell carcinoma. IGF2BP3 and DMDRMR cooperate to play oncogenic roles. IGF2BP3 cooperates with DMDRMR to regulate CDK4 by enhancing mRNA stability.
Unspecific Target Gene
Pancreatic cancer [ICD-11: 2C10]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [21]
Responsed Disease Pancreatic cancer [ICD-11: 2C10]
Responsed Drug Gemcitabine Approved
 Drug Info 
Pathway Response Adipocytokine signaling pathway hsa04920
Cell Process Epithelial-mesenchymal transition
In-vitro Model
 BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
HDE-CT cell line (A normal human pancreatic cell line)
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response Summary Lasso regression identified a six-m6A-regulator-signature prognostic model (KIAA1429, HNRNPC, METTL3, YTHDF1, IGF2BP2, and IGF2BP3). Gene set enrichment analysis revealed m6A regulators (KIAA1429, HNRNPC, and IGF2BP2) were related to multiple biological behaviors in pancreatic cancer, including adipocytokine signaling, the well vs. poorly differentiated tumor pathway, tumor metastasis pathway, epithelial mesenchymal transition pathway, gemcitabine resistance pathway, and stemness pathway.
Lung cancer [ICD-11: 2C25]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [22]
Responsed Disease Lung adenocarcinoma [ICD-11: 2C25.0]
Response Summary IGF2BP3 is an oncogene and potential prognostic biomarker of LUAD.
ATP-dependent translocase ABCB1 (ABCB1)
 Target Gene 
Representative RNA-seq result indicating the expression of this target gene regulated by IGF2BP3
Cell Line ES-2 cell line Homo sapiens
Treatment: siIGF2BP3 ES-2 cells
Control: siControl ES-2 cells
 GSE109604
Regulation
logFC: -1.30E+00
p-value: 4.65E-03
More Results Click to View More RNA-seq Results
Doxil [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [1]
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Target Regulation Up regulation
Pathway Response ABC transporters hsa02010
Cell Process RNA stability
In-vitro Model DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
HCT 15 Colon adenocarcinoma Homo sapiens CVCL_0292
HCT 8 Colon adenocarcinoma Homo sapiens CVCL_2478
HT29 Colon cancer Mus musculus CVCL_A8EZ
SW1463 Rectal adenocarcinoma Homo sapiens CVCL_1718
SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
In-vivo Model HCT8/T xenografts derived from shNC or shIGF2BP3-1 HCT8/T cells were established through subcutaneous inoculation of cells (6×106) into nude mice.
Response Summary IGF2BP3, directly bound to the m6A-modified region of ATP-dependent translocase ABCB1 (ABCB1) mRNA, thereby promoting the stability and expression of ABCB1 mRNA. The expression of IGF2BP3 and ABCB1 was strongly correlated with DOX sensitivity. Targeting IGF2BP3 was an important chemotherapeutic strategy for preventing MDR development in colorectal cancer.
CDR1 antisense RNA (CDR1-AS)
 Target Gene 
ML-210 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [19]
Responsed Disease Melanoma ICD-11: 2C30
 Disease Info 
Target Regulation Up regulation
In-vitro Model 451Lu Cutaneous melanoma Homo sapiens CVCL_6357
501-mel Melanoma Homo sapiens CVCL_4633
A-375 Amelanotic melanoma Homo sapiens CVCL_0132
SK-MEL-147 Melanoma Homo sapiens CVCL_3876
SK-MEL-173 Melanoma Homo sapiens CVCL_6090
SK-MEL-2 Melanoma Homo sapiens CVCL_0069
SK-MEL-239 Melanoma Homo sapiens CVCL_6122
SK-MEL-28 Cutaneous melanoma Homo sapiens CVCL_0526
WM115 Melanoma Homo sapiens CVCL_0040
WM1361A Cutaneous melanoma Homo sapiens CVCL_6788
WM1552C Cutaneous melanoma Homo sapiens CVCL_6472
WM266-4 Melanoma Homo sapiens CVCL_2765
WM278 Cutaneous melanoma Homo sapiens CVCL_6473
WM35 Melanoma Homo sapiens CVCL_0580
WM793b (Immunodeficient mice Cell Type melanocyte)
WM902B Melanoma Homo sapiens CVCL_6807
In-vivo Model 4-6 weeks old NOD/Shi-scid/IL-2Rgamma null (NOD.Cg-PrkdcscidIl2rgtm1Wjl/SzJ (NSG)) mice (female).
Response Summary CDR1 antisense RNA (CDR1-AS) a regulator of miR-7, as a hallmark of melanoma progression. CDR1as depletion results from epigenetic silencing of LINC00632, its originating long non-coding RNA (lncRNA) and promotes invasion in vitro and metastasis in vivo through a miR-7-independent, IGF2BP3-mediated mechanism. IGF2BP3 interacts with CDR1as and mediates invasion induced by CDR1as depletion. CDR1asHigh melanoma cell lines were strikingly more sensitive to three different GPX4 inhibitors, which are known to elicit ferroptotic cell death.
ML162 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [19]
Responsed Disease Melanoma ICD-11: 2C30
 Disease Info 
Target Regulation Up regulation
In-vitro Model 451Lu Cutaneous melanoma Homo sapiens CVCL_6357
501-mel Melanoma Homo sapiens CVCL_4633
A-375 Amelanotic melanoma Homo sapiens CVCL_0132
SK-MEL-147 Melanoma Homo sapiens CVCL_3876
SK-MEL-173 Melanoma Homo sapiens CVCL_6090
SK-MEL-2 Melanoma Homo sapiens CVCL_0069
SK-MEL-239 Melanoma Homo sapiens CVCL_6122
SK-MEL-28 Cutaneous melanoma Homo sapiens CVCL_0526
WM115 Melanoma Homo sapiens CVCL_0040
WM1361A Cutaneous melanoma Homo sapiens CVCL_6788
WM1552C Cutaneous melanoma Homo sapiens CVCL_6472
WM266-4 Melanoma Homo sapiens CVCL_2765
WM278 Cutaneous melanoma Homo sapiens CVCL_6473
WM35 Melanoma Homo sapiens CVCL_0580
WM793b (Immunodeficient mice Cell Type melanocyte)
WM902B Melanoma Homo sapiens CVCL_6807
In-vivo Model 4-6 weeks old NOD/Shi-scid/IL-2Rgamma null (NOD.Cg-PrkdcscidIl2rgtm1Wjl/SzJ (NSG)) mice (female).
Response Summary CDR1 antisense RNA (CDR1-AS) a regulator of miR-7, as a hallmark of melanoma progression. CDR1as depletion results from epigenetic silencing of LINC00632, its originating long non-coding RNA (lncRNA) and promotes invasion in vitro and metastasis in vivo through a miR-7-independent, IGF2BP3-mediated mechanism. IGF2BP3 interacts with CDR1as and mediates invasion induced by CDR1as depletion. CDR1asHigh melanoma cell lines were strikingly more sensitive to three different GPX4 inhibitors, which are known to elicit ferroptotic cell death.
RSL3 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [19]
Responsed Disease Melanoma ICD-11: 2C30
 Disease Info 
Target Regulation Up regulation
In-vitro Model 451Lu Cutaneous melanoma Homo sapiens CVCL_6357
501-mel Melanoma Homo sapiens CVCL_4633
A-375 Amelanotic melanoma Homo sapiens CVCL_0132
SK-MEL-147 Melanoma Homo sapiens CVCL_3876
SK-MEL-173 Melanoma Homo sapiens CVCL_6090
SK-MEL-2 Melanoma Homo sapiens CVCL_0069
SK-MEL-239 Melanoma Homo sapiens CVCL_6122
SK-MEL-28 Cutaneous melanoma Homo sapiens CVCL_0526
WM115 Melanoma Homo sapiens CVCL_0040
WM1361A Cutaneous melanoma Homo sapiens CVCL_6788
WM1552C Cutaneous melanoma Homo sapiens CVCL_6472
WM266-4 Melanoma Homo sapiens CVCL_2765
WM278 Cutaneous melanoma Homo sapiens CVCL_6473
WM35 Melanoma Homo sapiens CVCL_0580
WM793b (Immunodeficient mice Cell Type melanocyte)
WM902B Melanoma Homo sapiens CVCL_6807
In-vivo Model 4-6 weeks old NOD/Shi-scid/IL-2Rgamma null (NOD.Cg-PrkdcscidIl2rgtm1Wjl/SzJ (NSG)) mice (female).
Response Summary CDR1 antisense RNA (CDR1-AS) a regulator of miR-7, as a hallmark of melanoma progression. CDR1as depletion results from epigenetic silencing of LINC00632, its originating long non-coding RNA (lncRNA) and promotes invasion in vitro and metastasis in vivo through a miR-7-independent, IGF2BP3-mediated mechanism. IGF2BP3 interacts with CDR1as and mediates invasion induced by CDR1as depletion. CDR1asHigh melanoma cell lines were strikingly more sensitive to three different GPX4 inhibitors, which are known to elicit ferroptotic cell death.
Unspecific Target Gene
Gemcitabine [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [21]
Responsed Disease Pancreatic cancer ICD-11: 2C10
 Disease Info 
Pathway Response Adipocytokine signaling pathway hsa04920
Cell Process Epithelial-mesenchymal transition
In-vitro Model BxPC-3 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0186
HDE-CT cell line (A normal human pancreatic cell line)
MIA PaCa-2 Pancreatic ductal adenocarcinoma Homo sapiens CVCL_0428
Response Summary Lasso regression identified a six-m6A-regulator-signature prognostic model (KIAA1429, HNRNPC, METTL3, YTHDF1, IGF2BP2, and IGF2BP3). Gene set enrichment analysis revealed m6A regulators (KIAA1429, HNRNPC, and IGF2BP2) were related to multiple biological behaviors in pancreatic cancer, including adipocytokine signaling, the well vs. poorly differentiated tumor pathway, tumor metastasis pathway, epithelial mesenchymal transition pathway, gemcitabine resistance pathway, and stemness pathway.
Click to View Potential Drug Response of This Regulator
Xenobiotics Compound(s) Regulating the m6A Methylation Regulator
Compound Name Linsitinib Phase 3
Synonyms
Linsitinib; 867160-71-2; OSI-906; Linsitinib(OSI-906); OSI906; OSI 906; OSI-906AA; OSI-906 (Linsitinib); UNII-15A52GPT8T; Kinome_3532; ASP-7487; 3-[8-amino-1-(2-phenylquinolin-7-yl)imidazo[1,5-a]pyrazin-3-yl]-1-methylcyclobutan-1-ol; 15A52GPT8T; CHEMBL1091644; MMV676605; cis-3-[8-Amino-1-(2-phenyl-7-quinolinyl)imidazo[1,5-a]pyrazin-3-yl]-1-methylcyclobutanol; C26H23N5O; cis-3-(8-amino-1-(2-phenyl-7-quinolinyl)imidazo(1,5-a)pyrazin-3-yl)-1-methylcyclobutanol; Linsitinib [USAN:INN]; OSI906/Linsitinib/; Linsitinib; OSI-906
    Click to Show/Hide
External link
CID: 11640390
TTD: D01GFX
DrugBank: DB06075
Description
The m6A reader YTHDF2 stabilizedMYC mRNA specifically in cancer stem cells. Given the challenge of targeting MYC, YTHDF2 presents a therapeutic target to perturb MYC signaling in glioblastoma. The IGF1/IGF1R inhibitor linsitinib preferentially targeted YTHDF2-expressing cells, inhibiting GSC viability without affecting NSCs and impairing in vivoglioblastoma growth. YTHDF2 links RNA epitranscriptomic modifications and GSC growth, laying the foundation for the YTHDF2-MYC-IGFBP3 axis as a specific and novel therapeutic target in glioblastoma.
 [14]
Compound Name PMID29703820-Compound-JQ1 Investigative
Description
The bromodomain and extraterminal domain inhibitor (BETi) JQ1 decreased IGF2BP3 expression.
 [23]
References
Ref 1 Binding of RNA m6A by IGF2BP3 triggers chemoresistance of HCT8 cells via upregulation of ABCB1. Am J Cancer Res. 2021 Apr 15;11(4):1428-1445. eCollection 2021.
Ref 2 RBM15 facilitates laryngeal squamous cell carcinoma progression by regulating TMBIM6 stability through IGF2BP3 dependent. J Exp Clin Cancer Res. 2021 Feb 26;40(1):80. doi: 10.1186/s13046-021-01871-4.
Ref 3 METTL3-mediated m(6)A modification of HDGF mRNA promotes gastric cancer progression and has prognostic significance. Gut. 2020 Jul;69(7):1193-1205. doi: 10.1136/gutjnl-2019-319639. Epub 2019 Oct 3.
Ref 4 Recognition of RNA N(6)-methyladenosine by IGF2BP proteins enhances mRNA stability and translation. Nat Cell Biol. 2018 Mar;20(3):285-295. doi: 10.1038/s41556-018-0045-z. Epub 2018 Feb 23.
Ref 5 The m6A reader IGF2BP3 promotes acute myeloid leukemia progression by enhancing RCC2 stability. Exp Mol Med. 2022 Feb;54(2):194-205. doi: 10.1038/s12276-022-00735-x. Epub 2022 Feb 25.
Ref 6 YBX1 is required for maintaining myeloid leukemia cell survival by regulating BCL2 stability in an m6A-dependent manner. Blood. 2021 Jul 8;138(1):71-85. doi: 10.1182/blood.2020009676.
Ref 7 Hsa_circ_0004287 inhibits macrophage-mediated inflammation in an N(6)-methyladenosine-dependent manner in atopic dermatitis and psoriasis. J Allergy Clin Immunol. 2022 Jun;149(6):2021-2033. doi: 10.1016/j.jaci.2021.11.024. Epub 2021 Dec 23.
Ref 8 Methyltransferase-like 3 induces the development of cervical cancer by enhancing insulin-like growth factor 2 mRNA-binding proteins 3-mediated apoptotic chromatin condensation inducer 1 mRNA stability. Bioengineered. 2022 Mar;13(3):7034-7048. doi: 10.1080/21655979.2022.2044261.
Ref 9 circNDUFB2 inhibits non-small cell lung cancer progression via destabilizing IGF2BPs and activating anti-tumor immunity. Nat Commun. 2021 Jan 12;12(1):295. doi: 10.1038/s41467-020-20527-z.
Ref 10 DMDRMR-Mediated Regulation of m(6)A-Modified CDK4 by m(6)A Reader IGF2BP3 Drives ccRCC Progression. Cancer Res. 2021 Feb 15;81(4):923-934. doi: 10.1158/0008-5472.CAN-20-1619. Epub 2020 Dec 8.
Ref 11 m6A methylated EphA2 and VEGFA through IGF2BP2/3 regulation promotes vasculogenic mimicry in colorectal cancer via PI3K/AKT and ERK1/2 signaling. Cell Death Dis. 2022 May 21;13(5):483. doi: 10.1038/s41419-022-04950-2.
Ref 12 m(6)A-dependent glycolysis enhances colorectal cancer progression. Mol Cancer. 2020 Apr 3;19(1):72. doi: 10.1186/s12943-020-01190-w.
Ref 13 Knockdown of m6A Reader IGF2BP3 Inhibited Hypoxia-Induced Cell Migration and Angiogenesis by Regulating Hypoxia Inducible Factor-1Alpha in Stomach Cancer. Front Oncol. 2021 Sep 21;11:711207. doi: 10.3389/fonc.2021.711207. eCollection 2021.
Ref 14 The RNA m6A Reader YTHDF2 Maintains Oncogene Expression and Is a Targetable Dependency in Glioblastoma Stem Cells. Cancer Discov. 2021 Feb;11(2):480-499. doi: 10.1158/2159-8290.CD-20-0331. Epub 2020 Oct 6.
Ref 15 Demethylase ALKBH5 suppresses invasion of gastric cancer via PKMYT1 m6A modification. Mol Cancer. 2022 Feb 3;21(1):34. doi: 10.1186/s12943-022-01522-y.
Ref 16 METTL3/IGF2BP3 axis inhibits tumor immune surveillance by upregulating N(6)-methyladenosine modification of PD-L1 mRNA in breast cancer. Mol Cancer. 2022 Feb 23;21(1):60. doi: 10.1186/s12943-021-01447-y.
Ref 17 Up-regulation of VANGL1 by IGF2BPs and miR-29b-3p attenuates the detrimental effect of irradiation on lung adenocarcinoma. J Exp Clin Cancer Res. 2020 Nov 23;39(1):256. doi: 10.1186/s13046-020-01772-y.
Ref 18 RNA N6-methyladenosine reader IGF2BP3 regulates cell cycle and angiogenesis in colon cancer. J Exp Clin Cancer Res. 2020 Sep 29;39(1):203. doi: 10.1186/s13046-020-01714-8.
Ref 19 Epigenetic Silencing of CDR1as Drives IGF2BP3-Mediated Melanoma Invasion and Metastasis. Cancer Cell. 2020 Jan 13;37(1):55-70.e15. doi: 10.1016/j.ccell.2019.12.007.
Ref 20 Long Noncoding RNA KCNMB2-AS1 Stabilized by N(6)-Methyladenosine Modification Promotes Cervical Cancer Growth Through Acting as a Competing Endogenous RNA. Cell Transplant. 2020 Jan-Dec;29:963689720964382. doi: 10.1177/0963689720964382.
Ref 21 Gene Signature and Identification of Clinical Trait-Related m(6) A Regulators in Pancreatic Cancer. Front Genet. 2020 Jul 10;11:522. doi: 10.3389/fgene.2020.00522. eCollection 2020.
Ref 22 Prognostic Impact of IGF2BP3 Expression in Patients with Surgically Resected Lung Adenocarcinoma. DNA Cell Biol. 2021 Feb;40(2):316-331. doi: 10.1089/dna.2020.6136. Epub 2021 Jan 25.
Ref 23 Insulin-Like Growth Factor 2 mRNA-Binding Protein 3 is a Novel Post-Transcriptional Regulator of Ewing Sarcoma Malignancy. Clin Cancer Res. 2018 Aug 1;24(15):3704-3716. doi: 10.1158/1078-0432.CCR-17-2602. Epub 2018 Apr 27.