m6A Regulator Information
General Information of the m6A Regulator (ID: REG00002)
Regulator Name | ELAV-like protein 1 (ELAVL1) | ||||
---|---|---|---|---|---|
Synonyms |
Hu-antigen R; HuR; HUR
Click to Show/Hide
|
||||
Gene Name | ELAVL1 | ||||
Sequence |
MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHS
LGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQK DVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPIT VKFAANPNQNKNVALLSQLYHSPARRFGGPVHHQAQRFRFSPMGVDHMSGLSGVNVPGNA SSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAM AIASLNGYRLGDKILQVSFKTNKSHK Click to Show/Hide
|
||||
Family | RRM elav family | ||||
Function |
RNA-binding protein that binds to the 3'-UTR region of mRNAs and increases their stability. Involved in embryonic stem cells (ESCs) differentiation: preferentially binds mRNAs that are not methylated by N6-methyladenosine (m6A), stabilizing them, promoting ESCs differentiation (By similarity). Binds to poly-U elements and AU-rich elements (AREs) in the 3'-UTR of target mRNAs. Binds avidly to the AU-rich element in FOS and IL3/interleukin-3 mRNAs. In the case of the FOS AU-rich element, binds to a core element of 27 nucleotides that contain AUUUA, AUUUUA, and AUUUUUA motifs. Binds preferentially to the 5'-UUUU[AG]UUU-3' motif in vitro. With ZNF385A, binds the 3'-UTR of p53/TP53 mRNA to control their nuclear export induced by CDKN2A. Hence, may regulate p53/TP53 expression and mediate in part the CDKN2A anti-proliferative activity. May also bind with ZNF385A the CCNB1 mRNA (By similarity). Increases the stability of the leptin mRNA harboring an AU-rich element (ARE) in its 3' UTR.
Click to Show/Hide
|
||||
Gene ID | 1994 | ||||
Uniprot ID | |||||
Regulator Type | WRITER ERASER READER | ||||
Mechanism Diagram | Click to View the Original Diagram | ||||
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
ELAVL1 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Developmentally-regulated GTP-binding protein 1 (DRG1)
Osteosarcoma [ICD-11: 2B51]
In total 1 item(s) under this disease | ||||
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene | [1] | |||
Responsed Disease | Osteosarcoma [ICD-11: 2B51] | |||
Target Regulation | Up regulation | |||
Cell Process | Cell cycle | |||
Cell apoptosis | ||||
In-vitro Model |
143B | Osteosarcoma | Homo sapiens | CVCL_2270 |
hFOB 1.19 | Normal | Homo sapiens | CVCL_3708 | |
MG-63 | Osteosarcoma | Homo sapiens | CVCL_0426 | |
SaOS-2 | Osteosarcoma | Homo sapiens | CVCL_0548 | |
U2OS | Osteosarcoma | Homo sapiens | CVCL_0042 | |
Response Summary | ELAVL1 knockdown impaired the stability of DRG1 mRNA, thereby reducing both the mRNA and protein levels of Developmentally-regulated GTP-binding protein 1 (DRG1). In all, DRG1 exerted tumorigenic effects in osteosarcoma, and the up-regulation of DRG1 in OS was induced by METTL3 and ELAVL1 in an m6A-dependent manner. | |||
Xenobiotics Compound(s) Regulating the m6A Methylation Regulator
Compound Name | 1-(Benzenesulfonyl)-3-phenylindole-4,5-dione | Investigative |
---|---|---|
Synonyms |
CHEMBL4075458; SCHEMBL19737490; BDBM50270003
Click to Show/Hide
|
|
External link | ||
Activity |
Ki = 12.8 nM
|
[2] |
Compound Name | 1-(Benzenesulfonyl)-7-(4-methoxyphenyl)sulfanyl-3-phenylindole-4,5-dione | Investigative |
Synonyms |
CHEMBL4064932; BDBM50269995
Click to Show/Hide
|
|
External link | ||
Activity |
Ki = 15 nM
|
[2] |
Compound Name | 1-(Benzenesulfonyl)-7-(4-methoxyphenyl)-3-phenylindole-4,5-dione | Investigative |
Synonyms |
CHEMBL4095060; SCHEMBL22130724; BDBM50269992
Click to Show/Hide
|
|
External link | ||
Activity |
Ki = 41 nM
|
[2] |
Compound Name | 1-(4-Fluorophenyl)sulfonyl-3-phenylindole-4,5-dione | Investigative |
Synonyms |
CHEMBL4100171; SCHEMBL21222486; BDBM50269999
Click to Show/Hide
|
|
External link | ||
Activity |
Ki = 48 nM
|
[2] |
Compound Name | Dihydrotanshinone I | Investigative |
Synonyms |
Dihydrotanshinone I; 87205-99-0; 15,16-dihydrotanshinone I; UNII-562G9360V6; (-)-Dihydrotanshinone I; (1R)-1,6-dimethyl-1,2-dihydronaphtho[1,2-g][1]benzofuran-10,11-dione; DIHYDROTANSHINONE; 562G9360V6; DihydrotanshinoneI; Dihydrotanshinone-I; Tanshinone I, dihydro-; SR-05000002191; HSDB 8105; DHTS; 4m0e; CHEMBL227075; SCHEMBL13049977; DTXSID20236187; CHEBI:149872; HY-N0360; ZINC2585546; BDBM50423877; MFCD28016070; s9020; AKOS032962078; CCG-208567; Dihydrotanshinone I, >=98% (HPLC); NCGC00163651-01; NCGC00163651-06; D5379; N1844; A862726; SR-05000002191-2; SR-05000002191-3; Q21099654; (1R)-1,6-dimethyl-1,2-dihydrophenanthro[1,2-b]furan-10,11-dione; (R)-1,6-dimethyl-1,2-dihydrophenanthro[1,2-b]furan-10,11-dione; (-)-1,2-Dihydro-1,6-dimethylphenanthro[1,2-b]furan-10,11-dione;1,6-Dimethyl-1,2,10,11-tetrahydrophenanthro[1,2-b]furan-10,11-dione;4,17-Dimethyl-15-oxagona-1,3,5(10),6,8,13-hexene-11,12-dione;15,16-Dihydrotanshine I;1,6-DiMethyl-1,2-dihydrophenanthro[1,2-b]furan-10,11-dione
Click to Show/Hide
|
|
External link | ||
Activity |
Ki = 50 nM
|
[2] |
Compound Name | 1-(Benzenesulfonyl)-7-(3-methoxyphenyl)-3-phenylindole-4,5-dione | Investigative |
Synonyms |
CHEMBL4105230; BDBM50269991
Click to Show/Hide
|
|
External link | ||
Activity |
Ki = 55 nM
|
[2] |
Compound Name | 1-Methylsulfonyl-3-phenylindole-4,5-dione | Investigative |
Synonyms |
CHEMBL4073526; SCHEMBL19737481; BDBM50270012
Click to Show/Hide
|
|
External link | ||
Activity |
Ki = 56 nM
|
[2] |
Compound Name | N-[4-(4,5-dioxo-3-phenylindol-1-yl)sulfonylphenyl]acetamide | Investigative |
Synonyms |
CHEMBL4094161; SCHEMBL22130699; BDBM50269996
Click to Show/Hide
|
|
External link | ||
Activity |
Ki = 81 nM
|
[2] |
Compound Name | 1-(3-Nitrophenyl)sulfonyl-3-phenylindole-4,5-dione | Investigative |
Synonyms |
CHEMBL4081086; SCHEMBL19737379; BDBM50270013
Click to Show/Hide
|
|
External link | ||
Activity |
Ki > 100 nM
|
[2] |
Compound Name | 1-(Benzenesulfonyl)-7-(4-nitrophenyl)-3-phenylindole-4,5-dione | Investigative |
Synonyms |
CHEMBL4067653; BDBM50270007
Click to Show/Hide
|
|
External link | ||
Activity |
Ki > 100 nM
|
[2] |
Compound Name | 1-(3-Fluorophenyl)sulfonyl-3-phenylindole-4,5-dione | Investigative |
Synonyms |
CHEMBL4092808; SCHEMBL19737426; BDBM50269997
Click to Show/Hide
|
|
External link | ||
Activity |
Ki > 100 nM
|
[2] |
Compound Name | 1-(Benzenesulfonyl)-3-[4-(dimethylamino)phenyl]indole-4,5-dione | Investigative |
Synonyms |
CHEMBL4076484; SCHEMBL19737562; BDBM50270014
Click to Show/Hide
|
|
External link | ||
Activity |
Ki > 100 nM
|
[2] |
Compound Name | 1-(Benzenesulfonyl)-3,7-diphenylindole-4,5-dione | Investigative |
Synonyms |
CHEMBL4102819; SCHEMBL21222570; BDBM50269994
Click to Show/Hide
|
|
External link | ||
Activity |
Ki > 100 nM
|
[2] |
Compound Name | 1-(Benzenesulfonyl)-7-methyl-3-phenylindole-4,5-dione | Investigative |
Synonyms |
CHEMBL4070465; SCHEMBL22130661; BDBM50269990
Click to Show/Hide
|
|
External link | ||
Activity |
Ki > 200 nM
|
[2] |
Compound Name | 1-(Benzenesulfonyl)-3-(3-methoxyphenyl)indole-4,5-dione | Investigative |
Synonyms |
CHEMBL4075620; SCHEMBL19737487; BDBM50270001
Click to Show/Hide
|
|
External link | ||
Activity |
Ki > 200 nM
|
[2] |
Compound Name | 1-(Benzenesulfonyl)-3-(4-methoxyphenyl)indole-4,5-dione | Investigative |
Synonyms |
CHEMBL4077265; SCHEMBL19737482; BDBM50270002
Click to Show/Hide
|
|
External link | ||
Activity |
Ki > 200 nM
|
[2] |
Compound Name | 4-(Benzenesulfonyl)-6-phenyl-4-azatetracyclo[9.2.2.02,10.03,7]pentadeca-2(10),3(7),5,12-tetraene-8,9-dione | Investigative |
Synonyms |
CHEMBL4073683; SCHEMBL19737542; BDBM50270004
Click to Show/Hide
|
|
External link | ||
Activity |
Ki > 300 nM
|
[2] |
Compound Name | CMLD-2 | Investigative |
Synonyms |
958843-91-9; 5,7-dimethoxy-8-(1-(4-methoxyphenyl)-3-oxo-3-(pyrrolidin-1-yl)propyl)-4-phenyl-2H-chromen-2-one; CMLD-2; MLS000879470; SMR000465530; 5,7-dimethoxy-8-[1-(4-methoxyphenyl)-3-oxo-3-pyrrolidin-1-ylpropyl]-4-phenylchromen-2-one; KUC101379N; 5,7-dimethoxy-8-[1-(4-methoxyphenyl)-3-oxo-3-(pyrrolidin-1-yl)propyl]-4-phenyl-2H-chromen-2-one; CHEMBL1499653; SCHEMBL20928323; BDBM50746; cid_16746438; HMS2210J15; AKOS037647737; NCGC00166452-01; AS-74611; HY-124828; CS-0087821; W15560; 8-[3-keto-1-(4-methoxyphenyl)-3-pyrrolidino-propyl]-5,7-dimethoxy-4-phenyl-coumarin; 5,7-dimethoxy-8-[1-(4-methoxyphenyl)-3-oxidanylidene-3-pyrrolidin-1-yl-propyl]-4-phenyl-chromen-2-one; 5,7-dimethoxy-8-[1-(4-methoxyphenyl)-3-oxo-3-(1-pyrrolidinyl)propyl]-4-phenyl-1-benzopyran-2-one
Click to Show/Hide
|
|
External link | ||
Activity |
Ki = 350 nM
|
[3] |
Compound Name | 2-Amino-6-[2-(3,4-dihydroxyphenyl)-2-oxoethyl]sulfanyl-4-[4-(phenoxymethyl)phenyl]pyridine-3,5-dicarbonitrile | Investigative |
Synonyms |
CHEMBL4061748
Click to Show/Hide
|
|
External link | ||
Activity |
IC50 = 380 nM
|
[3] |
Compound Name | 3-(5,7-dimethoxy-2-oxo-4-phenylchromen-8-yl)-N,N-diethyl-3-(4-methoxyphenyl)propanamide | Investigative |
Synonyms |
CHEMBL1522581; NCGC00166661-01
Click to Show/Hide
|
|
External link | ||
Activity |
Ki = 570 nM
|
[3] |
Compound Name | 3-(5,7-dimethoxy-2-oxo-4-phenylchromen-8-yl)-N,N-diethyl-3-(3,4,5-trimethoxyphenyl)propanamide | Investigative |
Synonyms |
MLS000879482; SMR000465537; KUC101391N; CHEMBL1330249; SCHEMBL20928107; BDBM50745; cid_16746297; HMS2220E05; HMS3331O06; NCGC00166568-01; 3-(5,7-dimethoxy-2-oxidanylidene-4-phenyl-chromen-8-yl)-N,N-diethyl-3-(3,4,5-trimethoxyphenyl)propanamide; 3-(5,7-dimethoxy-2-oxo-4-phenyl-1-benzopyran-8-yl)-N,N-diethyl-3-(3,4,5-trimethoxyphenyl)propanamide; 3-(5,7-dimethoxy-2-oxo-4-phenylchromen-8-yl)-N,N-diethyl-3-(3,4,5-trimethoxyphenyl)propanamide; N,N-diethyl-3-(2-keto-5,7-dimethoxy-4-phenyl-chromen-8-yl)-3-(3,4,5-trimethoxyphenyl)propionamide
Click to Show/Hide
|
|
External link | ||
Activity |
Ki = 590 nM
|
[3] |
Compound Name | 8-[3-Keto-1-(4-methoxyphenyl)-3-morpholino-propyl]-5,7-dimethoxy-4-phenyl-coumarin | Investigative |
Synonyms |
MLS000879474; SMR000465528; KUC101375N; CHEMBL1390568; BDBM51309; cid_16746461; HMS2212O19; HMS3348C12; NCGC00166769-01; 5,7-dimethoxy-8-[1-(4-methoxyphenyl)-3-morpholin-4-yl-3-oxopropyl]-4-phenylchromen-2-one; 8-[3-keto-1-(4-methoxyphenyl)-3-morpholino-propyl]-5,7-dimethoxy-4-phenyl-coumarin; 5,7-dimethoxy-8-[1-(4-methoxyphenyl)-3-(4-morpholinyl)-3-oxopropyl]-4-phenyl-1-benzopyran-2-one; 5,7-dimethoxy-8-[1-(4-methoxyphenyl)-3-morpholin-4-yl-3-oxidanylidene-propyl]-4-phenyl-chromen-2-one
Click to Show/Hide
|
|
External link | ||
Activity |
Ki = 800 nM
|
[3] |
References