m6A Regulator Information

General Information of the m6A Regulator (ID: REG00048)
Regulator Name Heterogeneous nuclear ribonucleoprotein A1 (hnRNPA1)
Synonyms
HNRPA1; hnRNP A1; Helix-destabilizing protein; Single-strand RNA-binding protein; hnRNP core protein A1
    Click to Show/Hide
Gene Name hnRNPA1
Sequence
MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFV
TYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHH
LRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKA
LSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGS
GDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGG
GSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGS
SSSSSYGSGRRF
    Click to Show/Hide
Function
Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and modulation of splice site selection. Plays a role in the splicing of pyruvate kinase PKM by binding repressively to sequences flanking PKM exon 9, inhibiting exon 9 inclusion and resulting in exon 10 inclusion and production of the PKM M2 isoform. Binds to the IRES and thereby inhibits the translation of the apoptosis protease activating factor APAF1. May bind to specific miRNA hairpins.
    Click to Show/Hide
Gene ID 3178
Uniprot ID
ROA1_HUMAN
Regulator Type WRITER ERASER READER
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
hnRNPA1 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Browse Target Gene related Drug
Glucose-6-phosphate dehydrogenase (G6PD)
 Target Gene 
Colorectal cancer [ICD-11: 2B91]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Colorectal cancer [ICD-11: 2B91]
Responsed Drug Oxaliplatin Approved
 Drug Info 
Target Regulation Down regulation
In-vitro Model
 SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
HT29 Colon cancer Mus musculus CVCL_A8EZ
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
Monocarboxylate transporter 1 (SLC16A1)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Liver cancer [ICD-11: 2C12]
Target Regulation Up regulation
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
MHCC97-H Adult hepatocellular carcinoma Homo sapiens CVCL_4972
MIHA
 N.A. Homo sapiens CVCL_SA11
In-vivo Model For the subcutaneous tumor growth assay, 6-8 weeks old nude mice were sorted into six groups (n = 5 per group) at random. Each group received one of the following treatments bilaterally into the subcutaneous tissue of the flank: MHCC97H cells alone (1×10^6), exosomes from M0 macrophages incubated with MHCC97H cells (1×10^6), MHCC97H with AS1-KD exosome-treated M0 macrophages (1×10^6), and MHCC97H coupled with exosomes from siNC treated M2 macrophages (1×10^6) or siIL-6 treated M2 macrophages (1×10^6).
NAD-dependent protein deacetylase sirtuin-2 (SIRT2)
 Target Gene 
Traumatic brain injury induced by controlled cortical impact injury [ICD-11: NA07]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Traumatic brain injury induced by controlled cortical impact injury [ICD-11: NA07]
Target Regulation Up regulation
In-vitro Model
 HT22 Normal Mus musculus CVCL_0321
Ubiquitin carboxyl-terminal hydrolase isozyme L5 (UCHL5)
 Target Gene 
Neurological disorders due to toxicity [ICD-11: 8D43]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Delayed encephalopathy [ICD-11: 8D43.0Y]
In-vitro Model
 HEK293T Normal Homo sapiens CVCL_0063
Unspecific Target Gene
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [5]
Responsed Disease Gastric cancer [ICD-11: 2B72]
In-vitro Model
 GES-1 Normal Homo sapiens CVCL_EQ22
MGC-803 Gastric mucinous adenocarcinoma Homo sapiens CVCL_5334
BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
SGC-7901 Gastric carcinoma Homo sapiens CVCL_0520
AGS Gastric adenocarcinoma Homo sapiens CVCL_0139
In-vivo Model When the xenografted tumors grew up to 50 mm3, 18 mice were randomly divided into three groups (n = 6 mice /group): NC group (mice have systematically injected NC lentivirus through the lateral tail vein), sh-OIP5-AS1-1 group (mice have systematically injected sh-OIP5-AS1-1 lentivirus through the lateral tail vein), sh-OIP5-AS1-2 group (mice have systematically injected sh-OIP5-AS1-2 lentivirus through the lateral tail vein).A total of 18 6-week-old healthy male NOD/SCID mice (weighing 20 ± 2 g) were randomly assigned to one of the three groups (n = 6 mice /group) and injected through the tail vein with 1 × 106 NC, sh-OIP5-AS1-1, or sh-OIP5-AS1-2 stable AGS cells or Ctrl or OIP5-AS1 stable MGC823 cells co-transfected with lentiviruses carrying the luciferase reporter gene.
Glucose-6-phosphate dehydrogenase (G6PD)
 Target Gene 
Oxaliplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [1]
Responsed Disease Colorectal cancer ICD-11: 2B91
 Disease Info 
Target Regulation Down regulation
In-vitro Model SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
HT29 Colon cancer Mus musculus CVCL_A8EZ
SW620 Colon adenocarcinoma Homo sapiens CVCL_0547
DLD-1 Colon adenocarcinoma Homo sapiens CVCL_0248
HCT 116 Colon carcinoma Homo sapiens CVCL_0291
LoVo Colon adenocarcinoma Homo sapiens CVCL_0399
Click to View Potential Drug Response of This Regulator
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
Non-coding RNA
m6A Target: NAD-dependent protein deacetylase sirtuin-2 (SIRT2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05082
 Crosstalk Info 
Epigenetic Regulator Maternally expressed 3 (MEG3)
Regulated Target Heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1)
Crosstalk relationship ncRNA → m6A
Disease Traumatic brain injury induced by controlled cortical impact injury
 Disease Info 
m6A Target: Monocarboxylate transporter 1 (SLC16A1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05085
 Crosstalk Info 
Epigenetic Regulator SLC16A1 antisense RNA 1 (SLC16A1-AS1)
Regulated Target Heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1)
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
 Disease Info 
m6A Target: Glucose-6-phosphate dehydrogenase (G6PD)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05220
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 1615 (LINC01615)
Regulated Target Heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1)
Crosstalk relationship ncRNA → m6A
Disease Colorectal cancer
 Disease Info 
Drug Oxaliplatin
 Drug Info 
m6A Target: Ubiquitin carboxyl-terminal hydrolase isozyme L5 (UCHL5)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05303
 Crosstalk Info 
Epigenetic Regulator Colorectal neoplasia differentially expressed (CRNDE)
Regulated Target Heterogeneous nuclear ribonucleoprotein A1 (HNRNPA1)
Crosstalk relationship ncRNA → m6A
Disease Delayed encephalopathy
 Disease Info 
m6A Target: ribonuclease P RNA component H1 (RPPH1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05877
 Crosstalk Info 
Epigenetic Regulator Ribonuclease P RNA component H1 (RPPH1)
Regulated Target Insulin like growth factor 2 mRNA binding protein 2 (IGF2BP2)
Crosstalk relationship m6A → ncRNA
Disease Breast cancer
 Disease Info 
References
Ref 1 CA-170 - A Potent Small-Molecule PD-L1 Inhibitor or Not?. Molecules. 2019 Aug 1;24(15):2804. doi: 10.3390/molecules24152804.
Ref 2 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1822).
Ref 3 The anti-inflammatory mechanism of sulfasalazine is related to adenosine release at inflamed sites. J Immunol. 1996 Mar 1;156(5):1937-41.
Ref 4 ClinicalTrials.gov (NCT02713984) A Clinical Research of CAR T Cells Targeting HER2 Positive Cancer
Ref 5 National Cancer Institute Drug Dictionary (drug name ML2118).