General Information of the m6A Regulator (ID: REG00051)
Regulator Name RNA-binding protein FXR1 (FXR1)
Synonyms
FMR1 autosomal homolog 1; hFXR1p;
    Click to Show/Hide
Gene Name FXR1
Sequence
MAELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEIS
EGDEVEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKT
VKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKR
VNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFHEEFVVREDLMGLAIGTHGSN
IQQARKVPGVTAIELDEDTGTFRIYGESADAVKKARGFLEFVEDFIQVPRNLVGKVIGKN
GKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVLLEYHIAYLKE
VEQLRMERLQIDEQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELS
DWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVLKDPDSNPYSLL
DNTESDQTADTDASESHHSTNRRRRSRRRRTDEDAVLMDGMTESDTASVNENGLVTVADY
ISRAESQSRQRNLPRETLAKNKKEMAKDVIEEHGPSEKAINGPTSASGDDISKLQRTPGE
EKINTLKEENTQEAAVLNGVS
    Click to Show/Hide
Family FMR1 family
Function
mRNA-binding protein that acts as a regulator of mRNAs translation and/or stability, and which is required for various processes, such as neurogenesis, muscle development and spermatogenesis. Promotes formation of some phase-separated membraneless compartment by undergoing liquid-liquid phase separation upon binding to AREs-containing mRNAs, leading to assemble mRNAs into cytoplasmic ribonucleoprotein granules that concentrate mRNAs with associated regulatory factors (By similarity). Required to activate translation of stored mRNAs during late spermatogenesis: acts by undergoing liquid-liquid phase separation to assemble target mRNAs into cytoplasmic ribonucleoprotein granules that recruit translation initiation factor EIF4G3 to activate translation of stored mRNAs in late spermatids (By similarity). Promotes translation of MYC transcripts by recruiting the eIF4F complex to the translation start site . Acts as a negative regulator of inflammation in response to IL19 by promoting destabilization of pro-inflammatory transcripts. Also acts as an inhibitor of inflammation by binding to TNF mRNA, decreasing TNF protein production (By similarity). Acts as a negative regulator of AMPA receptor GRIA2/GluA2 synthesis during long-lasting synaptic potentiation of hippocampal neurons by binding to GRIA2/GluA2 mRNA, thereby inhibiting its translation (By similarity). Regulates proliferation of adult neural stem cells by binding to CDKN1A mRNA and promoting its expression (By similarity). Acts as a regulator of sleep and synaptic homeostasis by regulating translation of transcripts in neurons (By similarity). Required for embryonic and postnatal development of muscle tissue by undergoing liquid-liquid phase separation to assemble target mRNAs into cytoplasmic ribonucleoprotein granules. Involved in the nuclear pore complex localization to the nuclear envelope by preventing cytoplasmic aggregation of nucleoporins: acts by preventing ectopic phase separation of nucleoporins in the cytoplasm via a microtubule-dependent mechanism.
    Click to Show/Hide
Gene ID 8087
Uniprot ID
FXR1_HUMAN
Regulator Type WRITER ERASER READER
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
FXR1 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
B-cell lymphoma 6 protein (BCL6)
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
Cell Process Transcription
Cell proliferation
Cell migration
Cell invasion
DNA-binding protein SATB2 (SATB2)
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
Cell Process Transcription
Cell proliferation
Cell migration
Cell invasion
MIR670 host gene (MIR670HG)
Liver metastases [ICD-11: 2D80]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Liver metastases [ICD-11: 2D80]
Mitotic spindle assembly checkpoint protein MAD2A (MAD2L1)
Soft tissue sarcoma [ICD-11: XH4UM7]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Soft tissue sarcoma [ICD-11: XH4UM7]
In-vitro Model
HT-1080 Fibrosarcoma Homo sapiens CVCL_0317
SK-LMS-1 Vulvar leiomyosarcoma Homo sapiens CVCL_0628
U-2197 Undifferentiated pleomorphic sarcoma Homo sapiens CVCL_0043
SW872 Liposarcoma Homo sapiens CVCL_1730
RD Embryonal rhabdomyosarcoma Homo sapiens CVCL_1649
Rh30 Alveolar rhabdomyosarcoma Homo sapiens CVCL_0041
Ribose-5-phosphate isomerase (RPIA)
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
Cell Process Transcription
Cell proliferation
Cell migration
Cell invasion
SREBF2 antisense RNA 1 (SREBF2-AS1)
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [4]
Responsed Disease Liver cancer [ICD-11: 2C12]
In-vitro Model
Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
SNU-398 Adult hepatocellular carcinoma Homo sapiens CVCL_0077
THLE-2 Normal Homo sapiens CVCL_3803
Huh-7 Adult hepatocellular carcinoma Homo sapiens CVCL_0336
Sterile alpha motif domain-containing protein 9-like (SAMD9L)
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
Cell Process Transcription
Cell proliferation
Cell migration
Cell invasion
Wnt family member 7B (WNT7B)
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
Cell Process Transcription
Cell proliferation
Cell migration
Cell invasion
Unspecific Target Gene
Esophageal cancer [ICD-11: 2B70]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [5]
Responsed Disease Esophageal Squamous Cell Carcinoma [ICD-11: 2B70.1]
In-vitro Model
HEK293T Normal Homo sapiens CVCL_0063
KYSE-30 Esophageal squamous cell carcinoma Homo sapiens CVCL_1351
KYSE-510 Esophageal squamous cell carcinoma Homo sapiens CVCL_1354
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
DNA modification
m6A Target: DNA-binding protein SATB2 (SATB2)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02009
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target DNA-binding protein SATB2 (SATB2)
Crosstalk relationship m6A → DNA modification
Disease Esophageal Squamous Cell Carcinoma
m6A Target: SREBF2 antisense RNA 1 (SREBF2-AS1)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02100
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Sterol regulatory element binding transcription factor 2 (SREBF2)
Crosstalk relationship m6A → DNA modification
Disease Liver cancer
m6A Target: MIR670 host gene (MIR670HG)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT02109
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target CD24 molecule (CD24)
Crosstalk relationship m6A → DNA modification
Disease Liver metastases
m6A Target: Ribose-5-phosphate isomerase (RPIA)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT06004
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Ribose-5-phosphate isomerase (RPIA)
Crosstalk relationship m6A → DNA modification
Disease Esophageal Squamous Cell Carcinoma
m6A Target: Wnt family member 7B (WNT7B)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT06006
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Wnt family member 7B (WNT7B)
Crosstalk relationship m6A → DNA modification
Disease Esophageal Squamous Cell Carcinoma
m6A Target: B-cell lymphoma 6 protein (BCL6)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT06008
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target B-cell lymphoma 6 protein (BCL6)
Crosstalk relationship m6A → DNA modification
Disease Esophageal Squamous Cell Carcinoma
m6A Target: Protocadherin Fat 4 (FAT4)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT06010
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Protocadherin Fat 4 (FAT4)
Crosstalk relationship m6A → DNA modification
Disease Esophageal Squamous Cell Carcinoma
m6A Target: Sterile alpha motif domain-containing protein 9-like (SAMD9L)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT06012
Epigenetic Regulator Methylcytosine dioxygenase TET1 (TET1)
Regulated Target Sterile alpha motif domain-containing protein 9-like (SAMD9L)
Crosstalk relationship m6A → DNA modification
Disease Esophageal Squamous Cell Carcinoma
References
Ref 1 RNA m(6)A regulates transcription via DNA demethylation and chromatin accessibility. Nat Genet. 2022 Sep;54(9):1427-1437. doi: 10.1038/s41588-022-01173-1. Epub 2022 Sep 7.
Ref 2 CombinatoRx Drug Candidate CRx-191 Demonstrates Positive Phase 2 Results In Psoriasis. CombinatoRx. 2008.
Ref 3 The beta-carboline alkaloid harmine inhibits BCRP and can reverse resistance to the anticancer drugs mitoxantrone and camptothecin in breast cancer cells. Phytother Res. 2010 Jan;24(1):146-9.
Ref 4 The Ryanodine Receptor Stabilizer S44121 / Arm036 Improves Peripheral and Respiratory Muscle Function in a Mouse Model of Heart Failure. Circulation. 2014; 130: A13726.
Ref 5 2005 approvals: Safety first. Nature Reviews Drug Discovery 5, 92-93 (February 2006).