m6A Regulator Information

General Information of the m6A Regulator (ID: REG00034)
Regulator Name Insulin-like growth factor-binding protein 2 (IGFBP2)
Gene Name IGFBP2
Sequence
MLPRVGCPALPLPPPPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPPVAP
PAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSELP
LQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKP
LKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERIST
MRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTI
RGDPECHLFYNEQQEARGVHTQRMQ
    Click to Show/Hide
Function
Inhibits IGF-mediated growth and developmental rates. IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
    Click to Show/Hide
Gene ID 3485
Uniprot ID
IBP2_HUMAN
Regulator Type WRITER ERASER READER
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
IGFBP2 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
NACHT, LRR and PYD domains-containing protein 3 (NLRP3)
 Target Gene 
Intervertebral disc degeneration [ICD-11: FA80]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Intervertebral disc degeneration [ICD-11: FA80]
Target Regulation Up regulation
HOXA transcript antisense RNA, myeloid-specific 1 (HOTAIRM1)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Glioma [ICD-11: 2A00.0]
Target Regulation Up regulation
In-vitro Model
 U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
In-vivo Model BALB/c nude mice (4 weeks old, male) were purchased from Vital River Laboratory Animals and maintained under specific pathogen-free conditions. For in vivo tumor xenograft model establishment, 10 mice were randomly chosen and divided into two groups: the sh-NC and sh-HOTAIRM1 groups. Next, U87 cells (approximately 1 × 106/200 μl PBS) transfected with shRNAs (sh-HOTAIRM1 or sh-NC) were subcutaneously inoculated into the right frontal node of nude mice. Tumor growth was monitored once weekly. Mice were killed by cervical dislocation until the fifth week (35 days), and tumors were resected and measured for weight and volume.
Phospholipid hydroperoxide glutathione peroxidase GPX4 (GPX4)
 Target Gene 
Colon cancer [ICD-11: 2B90]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [3]
Responsed Disease Colon adenocarcinoma [ICD-11: 2B90.Y]
Target Regulation Up regulation
In-vitro Model
 SW480 Colon adenocarcinoma Homo sapiens CVCL_0546
HT29 Colon cancer Mus musculus CVCL_A8EZ
In-vivo Model To develop the syngeneic model, 1 × 106 MC38-Ctrl or MC38-Gpx4KD cells were injected subcutaneously into the right flank of C57BL/6 mice.
Click to View Potential Drug Response of This Regulator
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
RNA modification
m6A Target: Phospholipid hydroperoxide glutathione peroxidase GPX4 (GPX4)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT00015
 Crosstalk Info 
Epigenetic Regulator 28S rRNA (cytosine-C(5))-methyltransferase (NSUN5)
Regulated Target Phospholipid hydroperoxide glutathione peroxidase GPX4 (GPX4)
Crosstalk relationship m5C → m6A
Disease Colon cancer
 Disease Info 
Non-coding RNA
m6A Target: NACHT, LRR and PYD domains-containing protein 3 (NLRP3)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05330
 Crosstalk Info 
Epigenetic Regulator hsa-miR-26a-5p
Regulated Target Methyltransferase-like protein 14 (METTL14)
Crosstalk relationship ncRNA → m6A
Disease Intervertebral disc degeneration
 Disease Info 
References
Ref 1 Clinical pipeline report, company report or official report of Purple Biotech.
Ref 2 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 253).
Ref 3 2014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81. doi: 10.1038/nrd4545.