m6A Regulator Information

General Information of the m6A Regulator (ID: REG00027)
Regulator Name RNA binding protein X (RBMX)
Synonyms
RNA-binding motif protein, X chromosome, Glycoprotein p43; Heterogeneous nuclear ribonucleoprotein G; hnRNP G; HNRPG; RBMXP1
    Click to Show/Hide
Gene Name RBMX
Sequence
MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPA
DAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTR
GPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGR
APVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRD
YTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGP
PPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPP
RDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
    Click to Show/Hide
Function
RNA-binding protein that plays several role in the regulation of pre- and post-transcriptional processes. Implicated in tissue-specific regulation of gene transcription and alternative splicing of several pre-mRNAs. Binds to and stimulates transcription from the tumor suppressor TXNIP gene promoter; may thus be involved in tumor suppression. When associated with SAFB, binds to and stimulates transcription from the SREBF1 promoter. Associates with nascent mRNAs transcribed by RNA polymerase II. Component of the supraspliceosome complex that regulates pre-mRNA alternative splice site selection. Can either activate or suppress exon inclusion; acts additively with TRA2B to promote exon 7 inclusion of the survival motor neuron SMN2. Represses the splicing of MAPT/Tau exon 10. Binds preferentially to single-stranded 5'-CC[A/C]-rich RNA sequence motifs localized in a single-stranded conformation; probably binds RNA as a homodimer. Binds non-specifically to pre-mRNAs. Plays also a role in the cytoplasmic TNFR1 trafficking pathways; promotes both the IL-1-beta-mediated inducible proteolytic cleavage of TNFR1 ectodomains and the release of TNFR1 exosome-like vesicles to the extracellular compartment.
    Click to Show/Hide
Gene ID 27316
Uniprot ID
RBMX_HUMAN
Regulator Type WRITER ERASER READER
Mechanism Diagram Click to View the Original Diagram
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
RBMX can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Browse Target Gene related Drug
Circ_TET2
 Target Gene 
Leukemogenesis [ICD-11: 2A82]
In total 3 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Chronic lymphocytic leukemia [ICD-11: 2A82.0]
Responsed Drug CP028 Investigative
 Drug Info 
Experiment 2 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Chronic lymphocytic leukemia [ICD-11: 2A82.0]
Responsed Drug Dactolisib Investigative
 Drug Info 
Experiment 3 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Chronic lymphocytic leukemia [ICD-11: 2A82.0]
Responsed Drug Perhexiline Approved
 Drug Info 
Circ_TET2
 Target Gene 
CP028 [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [1]
Responsed Disease Chronic lymphocytic leukemia ICD-11: 2A82.0
 Disease Info 
Dactolisib [Investigative]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [1]
Responsed Disease Chronic lymphocytic leukemia ICD-11: 2A82.0
 Disease Info 
Perhexiline [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [1]
Responsed Disease Chronic lymphocytic leukemia ICD-11: 2A82.0
 Disease Info 
Click to View Potential Drug Response of This Regulator
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
Non-coding RNA
m6A Target: Circ_TET2
 Target Gene 
In total 3 item(s) under this m6A target
Crosstalk ID: M6ACROT05722
 Crosstalk Info 
Epigenetic Regulator Circ_TET2
Regulated Target Heterogeneous nuclear ribonucleoprotein C (HNRNPC)
Crosstalk relationship m6A → ncRNA
Disease Chronic lymphocytic leukemia
 Disease Info 
Drug CP028
 Drug Info 
Crosstalk ID: M6ACROT05723
 Crosstalk Info 
Epigenetic Regulator Circ_TET2
Regulated Target Heterogeneous nuclear ribonucleoprotein C (HNRNPC)
Crosstalk relationship m6A → ncRNA
Disease Chronic lymphocytic leukemia
 Disease Info 
Drug dactolisib
 Drug Info 
Crosstalk ID: M6ACROT05724
 Crosstalk Info 
Epigenetic Regulator Circ_TET2
Regulated Target Heterogeneous nuclear ribonucleoprotein C (HNRNPC)
Crosstalk relationship m6A → ncRNA
Disease Chronic lymphocytic leukemia
 Disease Info 
Drug perhexiline
 Drug Info 
Xenobiotics Compound(s) Regulating the m6A Methylation Regulator
Compound Name Vemurafenib Investigative
Synonyms
Vemurafenib; 918504-65-1; PLX4032; Zelboraf; 1029872-54-5; PLX-4032; N-(3-(5-(4-Chlorophenyl)-1H-pyrrolo[2,3-b]pyridine-3-carbonyl)-2,4-difluorophenyl)propane-1-sulfonamide; RG7204; PLX 4032; RG 7204; Vemurafenib (PLX4032, RG7204); Vemurafenib (PLX4032); RO5185426; RO 5185426; N-(3-{[5-(4-chlorophenyl)-1H-pyrrolo[2,3-b]pyridin-3-yl]carbonyl}-2,4-difluorophenyl)propane-1-sulfonamide; UNII-207SMY3FQT; RG-7204; 207SMY3FQT; CHEBI:63637; MFCD18074504; NSC761431; Vemurafenib;PLX-4032; RO-5185426; C23H18ClF2N3O3S; 1-PROPANESULFONAMIDE, N-[3-[[5-(4-CHLOROPHENYL)-1H-PYRROLO[2,3-B]PYRIDIN-3-YL]CARBONYL]-2,4-DIFLUOROPHENYL]-; N-(3-((5-(4-Chlorophenyl)-1H-pyrrolo(2,3-b)pyridin-3-yl)carbonyl)-2,4- difluorophenyl)propane-1-sulfonamide; N-[3-[[5-(4-Chlorophenyl)-1H-pyrrolo[2,3-b]pyridin-3-yl]carbonyl]-2,4-difluorophenyl]-1-PropanesulfonaMide; N-[3-[5-(4-chlorophenyl)-1H-pyrrolo[2,3-b]pyridine-3-carbonyl]-2,4-difluorophenyl]propane-1-sulfonamide; N-{3-[5-(4-chlorophenyl)-1H-pyrrolo[2,3-b]pyridine-3-carbonyl]-2,4-difluorophenyl}propane-1-sulfonamide; Zelboraf (TN); 1-Propanesulfonamide, N-(3-((5-(4-chlorophenyl)-1H-pyrrolo(2,3-b)pyridin-3-yl)carbonyl)-2,4-difluorophenyl)-; n-(3-((5-(4-chlorophenyl)-1h-pyrrolo(2,3-b)pyridin-3-yl)carbonyl)-2,4-difluorophenyl)-1-propanesulfonamide; Vemurafenib [USAN:INN]; vemurafenibum; Ro 51-85426; HSDB 8143; N-(3-{(5-(4-chlorophenyl)-1H-pyrrolo(2,3-b)pyridin-3-yl)carbonyl}-2,4- difluorophenyl)propane-1-sulfonamide; 3og7; Vemurafenib; PLX4032; PLX4032 - Vemurafenib; SCHEMBL298931; Vemurafenib (JAN/USAN/INN); GTPL5893; QCR-44; CHEMBL1229517; DTXSID50238710; EX-A053; SYN1161; HMS3265M03; HMS3265M04; HMS3265N03; HMS3265N04; HMS3654P09; HMS3748G15; AOB87705; BCP25783; EX-A1335; BDBM50396483; NSC800964; s1267; ZINC52509366; AKOS007930804; ACN-030372; AM81259; CCG-264883; CS-0216; DB08881; MCULE-7244406627; ME-0096; NSC-761431; NSC-800964; PB11741; NCGC00250399-01; NCGC00250399-05; NCGC00250399-08; Vemurafenib, RG7204, RO5185426; 1-Propanesulfonamide, N-(3-((5-(4-chlorophenyl)-1H-pyrrolo(2,3-b)pyridin-3- yl)carbonyl)-2,4-difluorophenyl)-; AC-25010; HY-12057; N-[3-[5-(4-chlorophenyl)-1H-pyrrolo[2,3-b]pyridine-3-carbonyl]-2,4-difluoro-phenyl]propane-1-sulfonamide; SY067868; FT-0660388; FT-0675792; FT-0689782; SW218095-2; Y0473; RO-51-85426; A25476; A25742; D09996; R-7204; AB01273970-01; AB01273970_03; Q423111; SR-01000941568; carbonyl]-2,4-difluorophenyl}propane-1-sulfonamide; J-522975; J-690009; SR-01000941568-1; BRD-K56343971-001-02-3; BRD-K56343971-001-05-6; PLX4032,Vemurafenib, RG7204, RO5185426, Zelboraf; N-{3-[5-(4-chlorophenyl)-1H-pyrrolo[2,3-b]pyridine-3-; [(2S,5R)-2,5-Dimethyl-4-[(tetrahydro-2H-pyran-4-yl)methyl]-1-piperazinyl][3-[(5-fluoro-2-methyl-4-pyrimidinyl)amino]-4,6-dihydro-6,6 -dimethylpyrrolo[3,4-c]pyrazol-5(1H)-yl]methanone; 1415041-85-8; N-(3-(5-(4-chlorophenyl)-1H-pyrrolo[2,3-b]pyridine-3-carbonyl)-2,4-difluorophenyl)-propane-1-sulfonamide; propane-1-sulfonic acid {3-[5-(4-chloro-phenyl)-1h-pyrrolo[2,3-b]pyridine-3-carbonyl]-2,4-difluoro-phenyl}-amide
    Click to Show/Hide
External link
CID: 42611257
Activity
IC50=5000 nM
 [2]
References
Ref 1 Wilms' tumor protein 1 (WT1) peptide vaccination in AML patients: predominant TCR CDR3Beta sequence associated with remission in one patient is detectable in other vaccinated patients. Cancer Immunol Immunother. 2012 Mar;61(3):313-22. doi: 10.1007/s00262-011-1099-y. Epub 2011 Sep 7.
Ref 2 Vemurafenib-resistance via de novo RBM genes mutations and chromosome 5 aberrations is overcome by combined therapy with palbociclib in thyroid carcinoma with BRAF(V600E). Oncotarget. 2017 Sep 24;8(49):84743-84760. doi: 10.18632/oncotarget.21262. eCollection 2017 Oct 17.