m6A Regulator Information

General Information of the m6A Regulator (ID: REG00047)
Regulator Name Staphylococcal nuclease domain-containing protein 1 (SND1)
Synonyms
TDRD11; Tudor staphylococcal nuclease
    Click to Show/Hide
Gene Name SND1
Sequence
MATAANTATAAGAAKDAPPAPTKSLSGIVKQVLSGDTVVIRATKGAPPPEKQITFSHVLA
PKLARRPGAGGDETKDEPWAWESREFLRKKLIGVEVTFTFDKPANSNREYGFVWIGKDKE
TGENVVESIVREGLVSVRREGRPTAEQQTLIELEDQARAAGRGKWSPTASAADKVRNIKW
SHENPAHLVDIYGGNPVKAIIEHVRDGSTVRAFLLPDFHYITLMISGIRCPGVKLDADGK
PDLSVKVPFADEARYYVETRLLQRDVEIRLESVNNSNFIGTILYPKGNIAESLLREGLAK
CVDWSMAVMKTGTDKLRAAERFAKEKRLRQWQDYQAKTPAFNSKEKDFSGTVVEVFNGDA
INVRLSNGQVKKVFFSSIRPPRDQRAVVGTDGEEIVKAPPRGKNYRPLYEIPHMFDAREF
LRKKLINKKVQCNLDYISPPRENFPEKYCYTVSIGGQNVAEAMVAKGLATCVRYRQDDDQ
RSSAYDQLIAAEQQAIKGLKGLHAKKDNATLRVNDLTVDHSRIKVQYLPSWQRALRTEAI
VEFVASGSRLRIFVPKDSCLVTFLLAGISCPRSSRPALNGVPAQEGEPFGDEALTFTRER
VLQRDVSVHIDTTDKAGSSVIGWLWTDSGANLSVALVEEGLAEVHFSAEKSEYYRQLKIA
EDRAKAAKKNIWTNYVEEVPKEKTVTEEEKEDKVVAERKVNYENVIVTEITETLTFFAQS
VESGSKLESLMSKLHADFQSNPPIAGSYTPKRGDLVAAQFTLDNQWYRAKVERVQGSNAT
VLYIDYGNKETLPTNRLAALPPAFSSEKPYATEYALALVALPTDNEDKEEALRAFSEDVL
NHKVQLNVELKVTGSPNLATLRDPTTKVDFGKQLVAEGLVLAEQRGERKLKELVDQYKAA
QEAARVAHLAIWKYGDITQDDAPEFR
    Click to Show/Hide
Function
Endonuclease which shows activity towards both DNA and RNA substrates . Has a role in translation regulation throught its association with the with the RNA-induced silencing complex (RISC) . Plays a role in spermatogenesis probably by negatively regulating piwi expression in the germline . Together with piwi, might be involved in transposon repression in the germline .
    Click to Show/Hide
Gene ID 27044
Uniprot ID
SND1_HUMAN
Regulator Type WRITER ERASER READER
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
SND1 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Browse Target Gene related Drug
Cystine/glutamate transporter (SLC7A11)
 Target Gene 
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Liver cancer [ICD-11: 2C12]
Responsed Drug Sorafenib Approved
 Drug Info 
In-vitro Model
 Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model 2 × 107 HepG2 cells transfected with scrambled shRNA or Snhg1 shRNA were injected subcutaneously into nude mice. For evaluating the sensitivity of the formed tumors to sorafenib, 60 mg/kg sorafenib was applied in the tumor-bearing mice via oral administration daily for 14 days.
Nuclear factor erythroid 2-related factor 2 (NFE2L2)
 Target Gene 
Brain cancer [ICD-11: 2A00]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Brain cancer [ICD-11: 2A00]
Target Regulation Up regulation
In-vitro Model
 U-87MG ATCC Glioblastoma Homo sapiens CVCL_0022
U-251MG Astrocytoma Homo sapiens CVCL_0021
A-172 Glioblastoma Homo sapiens CVCL_0131
LN-229 Glioblastoma Homo sapiens CVCL_0393
U-373MG ATCC Astrocytoma Homo sapiens CVCL_2219
T98G Glioblastoma Homo sapiens CVCL_0556
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model A total of 5 × 105 U87MG cells stably expressing firefly luciferase (Fluc) with indicated treatments were injected into the mouse brain at 2 mm lateral, 2 mm posterior to the bregma, and 2 mm depth via a stereotaxic apparatus.
Cystine/glutamate transporter (SLC7A11)
 Target Gene 
Sorafenib [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [1]
Responsed Disease Liver cancer ICD-11: 2C12
 Disease Info 
In-vitro Model Hep-G2 Hepatoblastoma Homo sapiens CVCL_0027
In-vivo Model 2 × 107 HepG2 cells transfected with scrambled shRNA or Snhg1 shRNA were injected subcutaneously into nude mice. For evaluating the sensitivity of the formed tumors to sorafenib, 60 mg/kg sorafenib was applied in the tumor-bearing mice via oral administration daily for 14 days.
Click to View Potential Drug Response of This Regulator
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
Non-coding RNA
m6A Target: Nuclear factor erythroid 2-related factor 2 (NFE2L2)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05108
 Crosstalk Info 
Epigenetic Regulator SNAI3 antisense RNA 1 (SNAI3-AS1)
Regulated Target Staphylococcal nuclease domain-containing protein 1 (SND1)
Crosstalk relationship ncRNA → m6A
Disease Brain cancer
 Disease Info 
m6A Target: Cystine/glutamate transporter (SLC7A11)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05311
 Crosstalk Info 
Epigenetic Regulator Small nucleolar RNA host gene 1 (SNHG1)
Regulated Target Staphylococcal nuclease domain-containing protein 1 (SND1)
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
 Disease Info 
Drug Sorafenib
 Drug Info 
References
Ref 1 Phase I and pharmacokinetic trial of PTC299 in pediatric patients with refractory or recurrent central nervous system tumors: a PBTC study. J Neurooncol. 2015 Jan;121(1):217-24. doi: 10.1007/s11060-014-1665-1. Epub 2014 Nov 19.
Ref 2 Pharmacodynamic and antineoplastic activity of BI 836845, a fully human IGF ligand-neutralizing antibody, and mechanistic rationale for combination with rapamycin. Mol Cancer Ther. 2014 Feb;13(2):399-409. doi: 10.1158/1535-7163.MCT-13-0598. Epub 2013 Dec 2.