m6A Regulator Information
General Information of the m6A Regulator (ID: REG00019)
| Regulator Name | NF-kappa-B-activating protein (NKAP) | ||||
|---|---|---|---|---|---|
| Synonyms |
FLJ22626, MRXSHD
Click to Show/Hide
|
||||
| Gene Name | NKAP | ||||
| Sequence |
MAPVSGSRSPDREASGSGGRRRSSSKSPKPSKSARSPRGRRSRSHSCSRSGDRNGLTHQL
GGLSQGSRNQSYRSRSRSRSRERPSAPRGIPFASASSSVYYGSYSRPYGSDKPWPSLLDK EREESLRQKRLSERERIGELGAPEVWGLSPKNPEPDSDEHTPVEDEEPKKSTTSASTSEE EKKKKSSRSKERSKKRRKKKSSKRKHKKYSEDSDSDSDSETDSSDEDNKRRAKKAKKKEK KKKHRSKKYKKKRSKKSRKESSDSSSKESQEEFLENPWKDRTKAEEPSDLIGPEAPKTLT SQDDKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIASFECSGYVMSGSRHR RMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREMVYRKTKGKDDK Click to Show/Hide
|
||||
| Family | NKAP family | ||||
| Function |
Acts as a transcriptional repressor. Plays a role as a transcriptional corepressor of the Notch-mediated signaling required for T-cell development. Also involved in the TNF and IL-1 induced NF-kappa-B activation. Associates with chromatin at the Notch-regulated SKP2 promoter.
Click to Show/Hide
|
||||
| Gene ID | 79576 | ||||
| Uniprot ID | |||||
| Regulator Type | WRITER ERASER READER | ||||
| Mechanism Diagram | Click to View the Original Diagram | ||||
|
|||||
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
NKAP can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Browse Target Gene related Drug
Cystine/glutamate transporter (SLC7A11)
Brain cancer [ICD-11: 2A00]
| In total 1 item(s) under this disease | ||||
| Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene | [1] | |||
| Responsed Disease | Glioblastoma [ICD-11: 2A00.00] | |||
| Target Regulation | Up regulation | |||
| Pathway Response | Ferroptosis | hsa04216 | ||
| Cell Process | Ferroptosis | |||
In-vitro Model |
U87MG (Astroblastoma cells from human brain) | |||
| U251 (Fibroblasts or fibroblast like cells) | ||||
| In-vivo Model | The male BALB/c nude mice were randomized divide into two groups, each group including six 4 weeks old nude mice. Investigators were blinded to the treatment groups during data collection and subsequent data analysis. In the subcutaneous xenograft model, 5 × 105 cells were subcutaneously injected in the right flanks of nude mice. In the orthotopic intracranial mouse model, each mouse was intracranially injected with 1 × 105 luciferase transfected U87MG cells in 10 uL PBS solution. | |||
| Response Summary | This study NKAP knockdown induced cell death in glioblastoma cells. NKAP acted as a new ferroptosis suppressor by binding to m6A and then promoting Cystine/glutamate transporter (SLC7A11) mRNA splicing and maturation. | |||
microRNA let-7b (MIRLET7B)
Lung cancer [ICD-11: 2C25]
| In total 1 item(s) under this disease | ||||
| Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene | [2] | |||
| Responsed Disease | Lung cancer [ICD-11: 2C25] | |||
| Responsed Drug | Metformin | Approved | ||
| Pathway Response | Notch signaling pathway | hsa04330 | ||
In-vitro Model |
NCI-H1975 | Lung adenocarcinoma | Homo sapiens | CVCL_1511 |
| HCC827 | Lung adenocarcinoma | Homo sapiens | CVCL_2063 | |
| H1975OR (Osimertinib resistant H1975 cells) | ||||
| HCC827OR (Osimertinib resistant HCC827 cells) | ||||
| Response Summary | the participation of Metformin decreased the bindings of DNMT3a/b to the METTL3 promoter with the help of the readers of NKAP and HNRNPA2B1.the mediation of m6A formation on pri-Let-7b processing increased the mature microRNA let-7b (MIRLET7B), whose key role is to suppress the Notch signaling and to re-captivate the Osimertinib treatment.The findings open up future drug development, targeting this pathway for lung cancer patients. | |||
microRNA let-7b (MIRLET7B)
Metformin
[Approved]
| In total 1 item(s) under this drug | ||||
| Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene | [2] | |||
| Responsed Disease | Lung cancer | ICD-11: 2C25 | ||
| Pathway Response | Notch signaling pathway | hsa04330 | ||
| In-vitro Model | NCI-H1975 | Lung adenocarcinoma | Homo sapiens | CVCL_1511 |
| HCC827 | Lung adenocarcinoma | Homo sapiens | CVCL_2063 | |
| H1975OR (Osimertinib resistant H1975 cells) | ||||
| HCC827OR (Osimertinib resistant HCC827 cells) | ||||
| Response Summary | the participation of Metformin decreased the bindings of DNMT3a/b to the METTL3 promoter with the help of the readers of NKAP and HNRNPA2B1.the mediation of m6A formation on pri-Let-7b processing increased the mature microRNA let-7b (MIRLET7B), whose key role is to suppress the Notch signaling and to re-captivate the Osimertinib treatment.The findings open up future drug development, targeting this pathway for lung cancer patients. | |||
Xenobiotics Compound(s) Regulating the m6A Methylation Regulator
| Compound Name | Geniposide | Investigative |
|---|---|---|
| Synonyms |
Geniposide; 24512-63-8; Jasminoidin; UNII-145295QLXY; CHEBI:5299; 145295QLXY; 169799-41-1; methyl (1S,4aS,7aS)-7-(hydroxymethyl)-1-[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-1,4a,5,7a-tetrahydrocyclopenta[c]pyran-4-carboxylate; Cyclopenta[c]pyran-4-carboxylic acid, 1-(beta-D-glucopyranosyloxy)-1,4a,5,7a-tetrahydro-7-(hydroxymethyl)-, methyl ester, (1S,4aS,7aS)-; methyl (1S,4aS,7aR)-7-(hydroxymethyl)-1-(((2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl)oxy)-1,4a,5,7a-tetrahydrocyclopenta[c]pyran-4-carboxylate; methyl (1S,4aS,7aS)-7-(hydroxymethyl)-1-(((2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl)oxy)-1,4a,5,7a-tetrahydrocyclopenta[c]pyran-4-carboxylate; (1S,4aS,7aS)-Methyl 7-(hydroxymethyl)-1-(((2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl)oxy)-1,4a,5,7a-tetrahydrocyclopenta[c]pyran-4-carboxylate; Cyclopenta(c)pyran-4-carboxylic acid, 1-(beta-D-glucopyranosyloxy)-1,4a,5,7a-tetrahydro-7-(hydroxymethyl)-, methyl ester, (1S,4aS,7aS)-; Genipin 1-glucoside; CHEMBL462894; Geniposide, >=98% (HPLC); AOB5625; HMS3884F17; ZINC3882101; BDBM50478840; MFCD16036219; s2411; AKOS025311228; CCG-268498; MCULE-3871054229; NCGC00346662-04; NCGC00346662-06; 27745-20-6; N1360; C09781; AB01558902_03; BRD-K57275767-001-03-2; Q27106709; Cyclopenta(c)pyran-4-carboxylic acid, 1-(beta-D-glucopyranosyloxy)-1,4a,5,7a-tetrahydro-7-(hydroxymethyl)-, methyl ester, (1S-(1alpha,4aalpha,7aalpha))-
Click to Show/Hide
|
|
| External link | ||
| Description |
Gardenia jasminoides extracts (GJE) attenuated expression of cytokines (IL-1Beta, IL-6 and TNF-Alpha), NFKB activating protein (NKAP) and TLR4 in ARPE-19 cells.
|
[3] |
| Compound Name | Crocin | Investigative |
| Synonyms |
Crocin; Gardenia Yellow; alpha-Crocin; 42553-65-1; Crocin I; Crocine; 94238-00-3; Crocin 1; Saffron; crocin-1; UNII-877GWI46C2; crocetin di-gentiobiose ester; CHEMBL446785; bis[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-[[(2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxymethyl]oxan-2-yl] (2E,4E,6E,8E,10E,12E,14E)-2,6,11,15-tetramethylhexadeca-2,4,6,8,10,12,14-heptaenedioate; CHEBI:79068; Crocetin digentiobiose ester; 877GWI46C2; 11012-59-2; Crocetin bis(gentiobiosyl) ester; NCGC00160471-01; all-trans-Crocetin di-beta-D-gentiobiosyl ester; Crocin A; CCRIS 678; CCRIS 7705; crocetin digentiobiosyl ester; EINECS 255-881-6; BRN 6473367; .alpha.-crocin; Crocin-I; HSDB 8211; Natural red 1; EINECS 254-465-1; Natural yellow 19; crocetin digentiobioside; trans-Crocetin di(beta-D-gentiobiosyl) ester; DSSTox_CID_1457; DSSTox_RID_81403; DSSTox_GSID_46172; SCHEMBL1463936; DTXSID7046172; bis(beta-D-gentiobiosyl) crocetin; HMS3887O07; Crocetin Di(Beta-Gentiobiosyl)Ester; HY-N0697; crocetin di-beta-D-gentiobiose ester; Tox21_111837; BDBM50260195; s9511; AKOS015896765; ZINC245224178; DB11874; Bis(6-O-beta-D-glucopyranosyl-beta-D-glucopyranosyl) 8,8'-diapo-psi,psi-carotenedioate; NCGC00160471-02; 8,8'-Diapo-psi,psi-carotenedioic acid, bis(6-O-beta-D-glucopyranosyl-beta-D-glucopyranosyl) ester; beta-D-Glucopyranose, 6-O-beta-D-glucopyranosyl-, 1,1'-((2E,4E,6E,8E,10E,12E,14E)-2,6,11,15-tetramethyl-2,4,6,8,10,12,14-hexadecaheptaenedioate); CAS-42553-65-1; C.I. 75100; CS-0009714; N1653; N1661; N1889; trans-crocetin bis(beta-D-gentiobiosyl) ester; C08589; A872860; Q424767; UNII-F32BA2H92Z component SEBIKDIMAPSUBY-RTJKDTQDSA-N; (2E,4E,6E,8E,10E,12E,14E)-Bis((2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-((((2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl)oxy)methyl)tetrahydro-2H-pyran-2-yl) 2,6,11,15-tetramethylhexadeca-2,4,6,8,10,12,14-heptaenedioate; bis(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-({[(2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}methyl)oxan-2-yl (2E,4E,6E,8E,10E,12E,14E)-2,6,11,15-tetramethylhexadeca-2,4,6,8,10,12,14-heptaenedioate; bis[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-({[(2R,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl]oxy}methyl)tetrahydro-2H-pyran-2-yl] (2E,4E,6E,8E,10E,12E,14E)-2,6,11,15-tetramethylhexadeca-2,4,6,8,10,12,14-heptaenedioate
Click to Show/Hide
|
|
| External link | ||
| Description |
Gardenia jasminoides extracts (GJE) attenuated expression of cytokines (IL-1Beta, IL-6 and TNF-Alpha), NFKB activating protein (NKAP) and TLR4 in ARPE-19 cells.
|
[3] |
References