General Information of the m6A Regulator (ID: REG00056)
Regulator Name Heterogeneous nuclear ribonucleoprotein D0 (HNRNPD)
Synonyms
AUF1; HNRPD; hnRNP D0; AU-rich element RNA-binding protein 1
    Click to Show/Hide
Gene Name HNRNPD
Sequence
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGS
AESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKF
GEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEP
VKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIM
EKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQ
GYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY
    Click to Show/Hide
Function
Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3'-UTR of many proto-oncogenes and cytokine mRNAs. Also binds to double- and single-stranded DNA sequences in a specific manner and functions a transcription factor. Each of the RNA-binding domains specifically can bind solely to a single-stranded non-monotonous 5'-UUAG-3' sequence and also weaker to the single-stranded 5'-TTAGGG-3' telomeric DNA repeat. Binds RNA oligonucleotides with 5'-UUAGGG-3' repeats more tightly than the telomeric single-stranded DNA 5'-TTAGGG-3' repeats. Binding of RRM1 to DNA inhibits the formation of DNA quadruplex structure which may play a role in telomere elongation. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. May play a role in the regulation of the rhythmic expression of circadian clock core genes. Directly binds to the 3'UTR of CRY1 mRNA and induces CRY1 rhythmic translation. May also be involved in the regulation of PER2 translation.
    Click to Show/Hide
Gene ID 3184
Uniprot ID
HNRPD_HUMAN
Regulator Type WRITER ERASER READER
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
HNRNPD can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Cyclic-AMP-dependent transcription factor ATF-3 (ATF3)
Liver cancer [ICD-11: 2C12]
In total 1 item(s) under this disease
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Liver cancer [ICD-11: 2C12]
Target Regulation Down regulation
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
Non-coding RNA
m6A Target: Cyclic-AMP-dependent transcription factor ATF-3 (ATF3)
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05264
Epigenetic Regulator Circ_STX6
Regulated Target Heterogeneous nuclear ribonucleoprotein D (HNRNPD)
Crosstalk relationship ncRNA → m6A
Disease Liver cancer
References
Ref 1 Analysis of the differential modulation of sulphonylurea block of beta-cell and cardiac ATP-sensitive K+ (K(ATP)) channels by Mg-nucleotides. J Physiol. 2003 Feb 15;547(Pt 1):159-68. doi: 10.1113/jphysiol.2002.031625. Epub 2003 Jan 10.