m6A Regulator Information

General Information of the m6A Regulator (ID: REG00054)
Regulator Name Thiol S-methyltransferase TMT1A (METTL7A)
Synonyms
TMT1A; Methyltransferase-like protein 7A; N6-adenosine-methyltransferase TMT1A; Protein AAM-B; Thiol methyltransferase 1A
    Click to Show/Hide
Gene Name METTL7A
Sequence
MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFS
NLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFE
RFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAEC
STWNYFWQQVLDPAWHLLFDGCNLTRESWKALERASFSKLKLQHIQAPLSWELVRPHIYG
YAVK
    Click to Show/Hide
Family methyltransferase superfamily
Function
Thiol S-methyltransferase that catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to alkyl and phenolic thiol-containing acceptor substrates. Together with TMT1B accounts for most of S-thiol methylation activity in the endoplasmic reticulum of hepatocytes. Able to methylate the N6 position of adenosine residues in long non-coding RNAs (lncRNAs). May facilitate lncRNAs transfer into exosomes at the tumor-stroma interface. Promotes osteogenic and odontogenic differentiation by regulating the expression of genes involved in stem cell differentiation and survival. Targeted from the endoplasmic reticulum to lipid droplets, where it recruits cellular proteins to form functional organelles.
    Click to Show/Hide
Gene ID 25840
Uniprot ID
TMT1A_HUMAN
Regulator Type WRITER ERASER READER
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
METTL7A can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Cell death activator CIDE-3 (CIDEC)
 Target Gene 
Chronic kidney disease [ICD-11: GB61]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Diabetic nephropathy [ICD-11: GB61.Z]
In-vitro Model
 HK2 Normal Acipenser baerii CVCL_YE28
NRK-52E Normal Rattus norvegicus CVCL_0468
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model Experiment 1:Eighteen rats were allocated to Control, DN, and DN + NAC (an inhibitor of ROS) groups (n = 6/group) at random. Rats in the DN and DN + NAC groups were subjected to high-fat diets (45% kcal fat), whereas control rats were normally bred with 10% kcal fat. Experiment 2:Twelve rats were randomly divided into DN + PBS and DN + Exo groups (n = 6/group). Experiment 3:Twenty-four rats were randomly assigned to DN, DN + Exo, DN + Exo-mimic NC, and DN + Exo-miR-204 mimic groups (n = 6/group).
Click to View Potential Drug Response of This Regulator
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
Non-coding RNA
m6A Target: Cell death activator CIDE-3 (CIDEC)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05128
 Crosstalk Info 
Epigenetic Regulator hsa-miR-204
Regulated Target Thiol methyltransferase 1A (TMT1A)
Crosstalk relationship ncRNA → m6A
Disease Diabetic nephropathy
 Disease Info 
References
Ref 1 Clinical pipeline report, company report or official report of BeiGene.