m6A Regulator Information

General Information of the m6A Regulator (ID: REG00053)
Regulator Name RNA-binding protein Musashi homolog 2 (MSI2)
Synonyms
Musashi-2
    Click to Show/Hide
Gene Name MSI2
Sequence
MEANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKR
SRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSAN
TVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMV
ECKKAQPKEVMFPPGTRGRARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQ
FPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPGPVADLYGPASQDSGVGNYIS
AASPQPGSGFGHGIAGPLIATAFTNGYH
    Click to Show/Hide
Family Musashi family
Function
RNA binding protein that regulates the expression of target mRNAs at the translation level. May play a role in the proliferation and maintenance of stem cells in the central nervous system (By similarity).
    Click to Show/Hide
Gene ID 124540
Uniprot ID
MSI2H_HUMAN
Regulator Type WRITER ERASER READER
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
MSI2 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Browse Target Gene related Drug
Myc proto-oncogene protein (MYC)
 Target Gene 
Gastric cancer [ICD-11: 2B72]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Gastric cancer [ICD-11: 2B72]
Responsed Drug Cisplatin Approved
 Drug Info 
Target Regulation Up regulation
In-vitro Model
 BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model 7 × 106 SGC7901 cells stably overexpressed LNC942 or pCDH empty vector (LNC942/NC) were suspended in 125-μl PBS and inoculated into the right dorsal flank of 5-week-old female nude mice (n = 5 per group).
Myc proto-oncogene protein (MYC)
 Target Gene 
Cisplatin [Approved]
In total 1 item(s) under this drug
 Drug Info 
Experiment 1 Reporting the m6A-centered Drug Response of This Target Gene [1]
Responsed Disease Gastric cancer ICD-11: 2B72
 Disease Info 
Target Regulation Up regulation
In-vitro Model BGC-823 Gastric carcinoma Homo sapiens CVCL_3360
HEK293T Normal Homo sapiens CVCL_0063
In-vivo Model 7 × 106 SGC7901 cells stably overexpressed LNC942 or pCDH empty vector (LNC942/NC) were suspended in 125-μl PBS and inoculated into the right dorsal flank of 5-week-old female nude mice (n = 5 per group).
Click to View Potential Drug Response of This Regulator
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
Non-coding RNA
m6A Target: Myc proto-oncogene protein (MYC)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05107
 Crosstalk Info 
Epigenetic Regulator Long intergenic non-protein coding RNA 942 (LINC00942)
Regulated Target Musashi RNA binding protein 2 (MSI2)
Crosstalk relationship ncRNA → m6A
Disease Gastric cancer
 Disease Info 
Drug Cisplatin
 Drug Info 
References
Ref 1 ClinicalTrials.gov (NCT04429542) Study of Safety and Tolerability of BCA101 Alone and in Combination With Pembrolizumab in Patients With EGFR-driven Advanced Solid Tumors. U.S. National Institutes of Health.