m6A Regulator Information

General Information of the m6A Regulator (ID: REG00045)
Regulator Name Far upstream element-binding protein 2 (KHSRP)
Synonyms
FUSE-binding protein 2; KH type-splicing regulatory protein; p75; KSRP
    Click to Show/Hide
Gene Name KHSRP
Sequence
MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQ
PPGGGGPGIRKDAFADAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPES
KKLASQGDSISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQI
SPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIMI
PAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVM
DILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQ
DDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQGNW
GPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGS
PQQIDHAKQLIEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPH
QYPPQGWGNTYPQWQPPAPHDPSKAAAAAADPNAAWAAYYSHYYQQPPGPVPGPAPAPAA
PPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVAT
GGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ
    Click to Show/Hide
Family KHSRP family
Function
Binds to the dendritic targeting element and may play a role in mRNA trafficking (By similarity). Part of a ternary complex that binds to the downstream control sequence (DCS) of the pre-mRNA. Mediates exon inclusion in transcripts that are subject to tissue-specific alternative splicing. May interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression. Also involved in degradation of inherently unstable mRNAs that contain AU-rich elements (AREs) in their 3'-UTR, possibly by recruiting degradation machinery to ARE-containing mRNAs.
    Click to Show/Hide
Gene ID 8570
Uniprot ID
FUBP2_HUMAN
Regulator Type WRITER ERASER READER
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
KHSRP can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Myocardin-related transcription factor A (MKL1)
 Target Gene 
Retinopathy [ICD-11: 9B71]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Diabetic retinopathy [ICD-11: 9B71.0]
Target Regulation Down regulation
Unspecific Target Gene
Prostate cancer [ICD-11: 2C82]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Metastatic prostate cancer [ICD-11: 2C82.Z]
Target Regulation Up regulation
In-vivo Model For tumor growth under ionizing radiation (IR), 6-week- old NSG male mice were injected with 5 × 106 cancer cells infected with lentivirus or shRNAs and/or expression vectors in 100 μl PBS with 100 μl of Matrigel matrix (BD Bioscience) in one side of flanks. After injection of tumor cells into mice, right flank tumors were radiated by 10 Gy X-ray beam for 14 days and monitored until they reached maximum tumor volumes of 1,000 mm3. Subsequently, tumor growth was measured with a caliper every 7 days.
Click to View Potential Drug Response of This Regulator
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
Non-coding RNA
m6A Target: Myocardin-related transcription factor A (MKL1)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05118
 Crosstalk Info 
Epigenetic Regulator Small nucleolar RNA host gene (SNHG7)
Regulated Target KH-type splicing regulatory protein (KHSRP)
Crosstalk relationship ncRNA → m6A
Disease Diabetic retinopathy
 Disease Info 
References
Ref 1 Discovery and Biological Profiling of Potent and Selective mTOR Inhibitor GDC-0349. ACS Med Chem Lett. 2012 Nov 29;4(1):103-7. doi: 10.1021/ml3003132. eCollection 2013 Jan 10.
Ref 2 1-Azakenpaullone is a selective inhibitor of glycogen synthase kinase-3 beta. Bioorg Med Chem Lett. 2004 Jan 19;14(2):413-6. doi: 10.1016/j.bmcl.2003.10.062.