m6A Regulator Information

General Information of the m6A Regulator (ID: REG00050)
Regulator Name RNA binding protein fox-1 homolog 2 (RBFOX2)
Synonyms
FOX2; HRNBP2; RBM9; RTA; Fox-1 homolog B; Hexaribonucleotide-binding protein 2; RNA-binding motif protein 9; RNA-binding protein 9; Repressor of tamoxifen transcriptional activity
    Click to Show/Hide
Gene Name RBFOX2
Sequence
MQNEPLTPGYHGFPARDSQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDY
AGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTP
KRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKL
HGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAASSFQADVSLG
NDAAVPLSGRGGINTYIPLISLPLVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVP
PTAIPAYPGVVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTAD
PYHALAPAASYGVGAVASLYRGGYSRFAPY
    Click to Show/Hide
Function
RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Prevents binding of U2AF2 to the 3'-splice site. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis (By similarity). RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.
    Click to Show/Hide
Gene ID 23543
Uniprot ID
RFOX2_HUMAN
Regulator Type WRITER ERASER READER
Full List of Target Gene(s) of This m6A Regulator and Corresponding Disease/Drug Response(s)
RBFOX2 can regulate the m6A methylation of following target genes, and result in corresponding disease/drug response(s). You can browse corresponding disease or drug response(s) resulted from the regulation of certain target gene.
Browse Target Gene related Disease
Chromatin-associated RNAs (caRNAs)
 Target Gene 
Malignant haematopoietic neoplasm [ICD-11: 2B33]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [1]
Responsed Disease Myeloid leukaemia [ICD-11: 2B33.1]
Target Regulation Down regulation
Cell Process Cell survival
Cell proliferation
Cell differentiation
Cell invasion
Apoptosis
Unspecific Target Gene
Head and neck squamous carcinoma [ICD-11: 2B6E]
In total 1 item(s) under this disease
 Disease Info 
Experiment 1 Reporting the m6A-centered Disease Response of This Target Gene [2]
Responsed Disease Oral squamous cell carcinoma [ICD-11: 2B6E.0]
In-vitro Model
 SCC-15 Tongue squamous cell carcinoma Homo sapiens CVCL_1681
SCC-25 Tongue squamous cell carcinoma Homo sapiens CVCL_1682
HOK Normal Hexagrammos otakii CVCL_YE19
Click to View Potential Drug Response of This Regulator
Full List of Crosstalk(s) between m6A Modification and Epigenetic Regulation Related to This Regulator
Histone modification
m6A Target: Chromatin-associated RNAs (caRNAs)
 Target Gene 
In total 1 item(s) under this m6A target
Crosstalk ID: M6ACROT05953
 Crosstalk Info 
Epigenetic Regulator Polycomb Repressive Complex 2 (PRC2)
Regulated Target Histone H3 lysine 27 trimethylation (H3K27me3)
Crosstalk relationship m6A → Histone modification
Disease Myeloid leukaemia
 Disease Info 
References
Ref 1 RBFOX2 recognizes N6-methyladenosine to suppress transcription and block myeloid leukaemia differentiation. Nat Cell Biol. 2023 Sep;25(9):1359-1368. doi: 10.1038/s41556-023-01213-w.
Ref 2 Altered drug disposition of the platelet activating factor antagonist apafant in mdr1a knockout mice. Eur J Pharm Sci. 2002 Aug;16(3):119-28.