General Information of the Epigenetic Target (ID: EPITAR00540)
Target Name Protein S100-A9 (S100A9)
Synonyms
CAGB; CFAG; MRP14: Calgranulin-B; Calprotectin L1H subunit; Leukocyte L1 complex heavy chain; Migration inhibitory factor-related protein 14; MRP-14; p14; S100 calcium-binding protein A9
    Click to Show/Hide
Gene Name S100A9
Sequence
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
    Click to Show/Hide
Family S-100 family
Function
S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response (PubMed:12626582, PubMed:15331440, PubMed:16258195, PubMed:19122197, PubMed:20103766, PubMed:21325622, PubMed:8423249). It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism (PubMed:12626582, PubMed:15331440, PubMed:20103766). Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions (PubMed:16258195, PubMed:19122197, PubMed:8423249). The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase (PubMed:15331440, PubMed:21325622). Also participates in regulatory T-cell differentiation together with CD69 (PubMed:26296369). Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX (PubMed:15642721, PubMed:22808130). The extracellular functions involve pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities (PubMed:19534726, PubMed:8423249). Its pro-inflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration (PubMed:15598812, PubMed:21487906). Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER) (PubMed:19402754). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the pro-inflammatory cascade (PubMed:19402754, PubMed:22804476). Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth (PubMed:19087201). Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3 (PubMed:19935772). Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK (PubMed:22363402). Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants (PubMed:21912088, PubMed:22489132). Can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread (PubMed:16258195). Has transnitrosylase activity; in oxidatively-modified low-densitity lipoprotein (LDL(ox))-induced S-nitrosylation of GAPDH on 'Cys-247' proposed to transfer the NO moiety from NOS2/iNOS to GAPDH via its own S-nitrosylated Cys-3 (PubMed:25417112). The iNOS-S100A8/A9 transnitrosylase complex is proposed to also direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as ANXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif (PubMed:25417112). {ECO:0000269|PubMed:12626582, ECO:0000269|PubMed:15331440, ECO:0000269|PubMed:15598812, ECO:0000269|PubMed:15642721, ECO:0000269|PubMed:16258195, ECO:0000269|PubMed:19087201, ECO:0000269|PubMed:19122197, ECO:0000269|PubMed:19402754, ECO:0000269|PubMed:19534726, ECO:0000269|PubMed:19935772, ECO:0000269|PubMed:20103766, ECO:0000269|PubMed:21325622, ECO:0000269|PubMed:21487906, ECO:0000269|PubMed:22363402, ECO:0000269|PubMed:22804476, ECO:0000269|PubMed:22808130, ECO:0000269|PubMed:25417112, ECO:0000269|PubMed:26296369, ECO:0000269|PubMed:8423249, ECO:0000303|PubMed:21912088, ECO:0000303|PubMed:22489132}.
    Click to Show/Hide
Gene ID 6280
HGNC ID HGNC:10499
Ensembl Gene ID ENSG00000163220
KEGG ID hsa:6280
Chromosomal Location 1q21.3
RNA Modification Sequencing Data Associated with the Target (ID: EPITAR00540)
Protein S100-A9 (S100A9)
N6-methyladenosine (m6A)
In total 9 m6A sequence/site(s) in this target gene
mod ID: M6ASITE054942 Click to Show/Hide the Full List
mod site chr1:153357855-153357856:+ [1]
Sequence AGCCTGCACAGCTCTGGCAAACACTCTGTGTGGCTCCTCGG
Motif Score 2.20572619
Cell/Tissue List A549; BGC823; MM6; Huh7; CD4T; peripheral-blood; TREX; endometrial
Seq Type List MeRIP-seq; m6A-seq
Transcript ID List ENST00000368738.4
External Link RMBase: m6A_site_54428
mod ID: M6ASITE054943 Click to Show/Hide the Full List
mod site chr1:153358322-153358323:+ [1]
Sequence AGCTGGAACGCAACATAGAGACCATCATCAACACCTTCCAC
Motif Score 2.876744048
Cell/Tissue List A549; BGC823; MM6; Huh7; CD4T; peripheral-blood; TREX; endometrial
Seq Type List MeRIP-seq; m6A-seq
Transcript ID List ENST00000368738.4
External Link RMBase: m6A_site_54429
mod ID: M6ASITE054944 Click to Show/Hide the Full List
mod site chr1:153358371-153358372:+ [1]
Sequence TGTGAAGCTGGGGCACCCAGACACCCTGAACCAGGGGGAAT
Motif Score 2.897386905
Cell/Tissue List A549; BGC823; MM6; Huh7; CD4T; peripheral-blood; TREX; endometrial
Seq Type List MeRIP-seq; m6A-seq
Transcript ID List ENST00000368738.4
External Link RMBase: m6A_site_54430
mod ID: M6ASITE054945 Click to Show/Hide the Full List
mod site chr1:153358380-153358381:+ [1]
Sequence GGGGCACCCAGACACCCTGAACCAGGGGGAATTCAAAGAGC
Motif Score 2.930744048
Cell/Tissue List A549; BGC823; MM6; Huh7; CD4T; peripheral-blood; TREX; endometrial
Seq Type List MeRIP-seq; m6A-seq
Transcript ID List ENST00000368738.4
External Link RMBase: m6A_site_54431
mod ID: M6ASITE054946 Click to Show/Hide the Full List
mod site chr1:153360672-153360673:+ [2]
Sequence AAGAATGAAAAGGTCATAGAACACATCATGGAGGACCTGGA
Motif Score 2.951386905
Cell/Tissue List BGC823; MM6; Huh7; CD4T; peripheral-blood; endometrial
Seq Type List m6A-seq; MeRIP-seq
Transcript ID List ENST00000368738.4
External Link RMBase: m6A_site_54432
mod ID: M6ASITE054947 Click to Show/Hide the Full List
mod site chr1:153360686-153360687:+ [2]
Sequence CATAGAACACATCATGGAGGACCTGGACACAAATGCAGACA
Motif Score 3.622404762
Cell/Tissue List BGC823; MM6; Huh7; CD4T; peripheral-blood; endometrial
Seq Type List m6A-seq; MeRIP-seq
Transcript ID List ENST00000368738.4
External Link RMBase: m6A_site_54433
mod ID: M6ASITE054948 Click to Show/Hide the Full List
mod site chr1:153360692-153360693:+ [2]
Sequence ACACATCATGGAGGACCTGGACACAAATGCAGACAAGCAGC
Motif Score 3.643047619
Cell/Tissue List BGC823; MM6; Huh7; CD4T; peripheral-blood; endometrial
Seq Type List m6A-seq; MeRIP-seq
Transcript ID List ENST00000368738.4
External Link RMBase: m6A_site_54434
mod ID: M6ASITE054949 Click to Show/Hide the Full List
mod site chr1:153360704-153360705:+ [2]
Sequence GGACCTGGACACAAATGCAGACAAGCAGCTGAGCTTCGAGG
Motif Score 2.897386905
Cell/Tissue List BGC823; MM6; Huh7; CD4T; peripheral-blood; endometrial
Seq Type List m6A-seq; MeRIP-seq
Transcript ID List ENST00000368738.4
External Link RMBase: m6A_site_54435
mod ID: M6ASITE054950 Click to Show/Hide the Full List
mod site chr1:153360839-153360840:+ [2]
Sequence CGGGGAGGGCACCCCCTAAGACCACAGTGGCCAAGATCACA
Motif Score 2.876744048
Cell/Tissue List BGC823; MM6; Huh7; peripheral-blood; endometrial
Seq Type List m6A-seq; MeRIP-seq
Transcript ID List ENST00000368738.4
External Link RMBase: m6A_site_54436