General Information of the Epigenetic Target (ID: EPITAR00539)
Target Name Protein S100-A8 (S100A8)
Synonyms
CAGA; CFAG; MRP8: Calgranulin-A; Calprotectin L1L subunit; Cystic fibrosis antigen; CFAG; Leukocyte L1 complex light chain; Migration inhibitory factor-related protein 8; MRP-8; p8; S100 calcium-binding protein A8; Urinary stone protein band A
    Click to Show/Hide
Gene Name S100A8
Sequence
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
    Click to Show/Hide
Family S-100 family
Function
S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis and adhesion. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Also participates in regulatory T-cell differentiation together with CD69 (PubMed:26296369). Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The extracellular functions involve pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its pro-inflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the pro-inflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn(2+) which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. Can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread. The iNOS-S100A8/A9 transnitrosylase complex directs selective inflammatory stimulus-dependent S-nitrosylation of GAPDH and probably multiple targets such as ANXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif; S100A8 seems to contribute to S-nitrosylation site selectivity. {ECO:0000269|PubMed:12626582, ECO:0000269|PubMed:15331440, ECO:0000269|PubMed:15598812, ECO:0000269|PubMed:15642721, ECO:0000269|PubMed:16258195, ECO:0000269|PubMed:19087201, ECO:0000269|PubMed:19122197, ECO:0000269|PubMed:19935772, ECO:0000269|PubMed:21487906, ECO:0000269|PubMed:22363402, ECO:0000269|PubMed:22808130, ECO:0000269|PubMed:25417112, ECO:0000269|PubMed:26296369}.; (Microbial infection) Upon infection by human coronavirus SARS-CoV-2, may induce expansion of aberrant immature neutrophils in a TLR4-dependent manner. {ECO:0000305|PubMed:33388094}.
    Click to Show/Hide
Gene ID 6279
HGNC ID HGNC:10498
Ensembl Gene ID ENSG00000143546
KEGG ID hsa:6279
Chromosomal Location 1q21.3
RNA Modification Sequencing Data Associated with the Target (ID: EPITAR00539)
Protein S100-A8 (S100A8)
N6-methyladenosine (m6A)
In total 7 m6A sequence/site(s) in this target gene
mod ID: M6ASITE054951 Click to Show/Hide the Full List
mod site chr1:153390068-153390069:- [1]
Sequence CCCAGAGGCTGGGCCCCTGGACATGTACCTGCAGAATAATA
Motif Score 3.643047619
Cell/Tissue List BGC823; peripheral-blood
Seq Type List m6A-seq
Transcript ID List ENST00000368733.4; ENST00000368732.5
External Link RMBase: m6A_site_54441
mod ID: M6ASITE054952 Click to Show/Hide the Full List
mod site chr1:153390417-153390418:- [1]
Sequence ACCTGAAGAAATTGCTAGAGACCGAGTGTCCTCAGTATATC
Motif Score 2.876744048
Cell/Tissue List BGC823; CD4T; peripheral-blood; endometrial
Seq Type List m6A-seq
Transcript ID List ENST00000477801.1; ENST00000368732.5; ENST00000368733.4
External Link RMBase: m6A_site_54442
mod ID: M6ASITE054953 Click to Show/Hide the Full List
mod site chr1:153390506-153390507:- [1]
Sequence CGAGCTGGAGAAAGCCTTGAACTCTATCATCGACGTCTACC
Motif Score 3.373380952
Cell/Tissue List BGC823; MM6; CD4T; peripheral-blood; endometrial
Seq Type List m6A-seq
Transcript ID List ENST00000368732.5; ENST00000368733.4; ENST00000477801.1
External Link RMBase: m6A_site_54443
mod ID: M6ASITE054954 Click to Show/Hide the Full List
mod site chr1:153390750-153390751:- [2]
Sequence ACATGTCTCTGTGTGAATGGACCCTTCCCCTTCCCACACGT
Motif Score 3.622404762
Cell/Tissue List peripheral-blood
Seq Type List m6A-seq
Transcript ID List ENST00000477801.1; ENST00000368733.4; ENST00000368732.5
External Link RMBase: m6A_site_54444
mod ID: M6ASITE054955 Click to Show/Hide the Full List
mod site chr1:153390828-153390829:- [2]
Sequence CACATTGTCTCCTAGGCTGGACTTTTCTTGAGCAGAGGGTG
Motif Score 4.065041667
Cell/Tissue List peripheral-blood
Seq Type List m6A-seq
Transcript ID List ENST00000368733.4; ENST00000477801.1; ENST00000368732.5
External Link RMBase: m6A_site_54445
mod ID: M6ASITE054956 Click to Show/Hide the Full List
mod site chr1:153391030-153391031:- [3]
Sequence CAGAAGACCTGGTAAGTGGGACTGTCTGGGTTGGCCCCGCA
Motif Score 4.065041667
Cell/Tissue List MM6; peripheral-blood
Seq Type List m6A-seq
Transcript ID List ENST00000477801.1; ENST00000368733.4
External Link RMBase: m6A_site_54446
mod ID: M6ASITE054957 Click to Show/Hide the Full List
mod site chr1:153391044-153391045:- [3]
Sequence TGTCAGCTGTCTTTCAGAAGACCTGGTAAGTGGGACTGTCT
Motif Score 2.876744048
Cell/Tissue List MM6
Seq Type List m6A-seq
Transcript ID List ENST00000477801.1; ENST00000368733.4
External Link RMBase: m6A_site_54447