Epigenetic Target Information

General Information of the Epigenetic Target (ID: EPITAR00495)

Target Name	TIMP metallopeptidase inhibitor 1 (TIMP1)
Synonyms	EPO; TIMP; CLGI; tissue inhibitor of metalloproteinase 1 (erythroid potentiating activity, collagenase inhibitor) Click to Show/Hide
Gene Name	TIMP1
Sequence	MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA Click to Show/Hide
Family	Protease inhibitor I35 (TIMP) family
Function	Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Mediates erythropoiesis in vitro; but, unlike IL3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors. Click to Show/Hide
Gene ID	7076
HGNC ID	HGNC:11820
Ensembl Gene ID	ENSG00000102265
KEGG ID	hsa:7076
Chromosomal Location	Xp11.3

RNA Modification Sequencing Data Associated with the Target (ID: EPITAR00495)

TIMP metallopeptidase inhibitor 1 (TIMP1)

N6-methyladenosine (m6A)

In total 14 m6A sequence/site(s) in this target gene
mod ID: M6ASITE091141		Click to Show/Hide the Full List
mod site	chrX:47582465-47582466:+		[1]
Sequence	CAGATCCAGCGCCCAGAGAGACACCAGAGGTAAGCAGGGCC
Motif Score	2.897386905
Cell/Tissue List	HeLa; hESC-HEK293T; HepG2; fibroblasts; A549; HEK293A-TOA; iSLK; MSC; TIME; endometrial
Seq Type List	m6A-seq; MeRIP-seq; MAZTER-seq
Transcript ID List	ENST00000377017.5; ENST00000456754.6; ENST00000218388.9
External Link	RMBase: m6A_site_858022
mod ID: M6ASITE091142		Click to Show/Hide the Full List
mod site	chrX:47584958-47584959:+		[2]
Sequence	TCAGGGCCAAGTTCGTGGGGACACCAGAAGTCAACCAGACC
Motif Score	3.643047619
Cell/Tissue List	A549; hESC-HEK293T; HepG2; HeLa; MT4; MM6; Huh7; CD4T; peripheral-blood; GSC-11; iSLK; MSC; TIME; endometrial; HEC-1-A; NB4
Seq Type List	MeRIP-seq; MAZTER-seq; m6A-seq
Transcript ID List	ENST00000441738.1; ENST00000456754.6; ENST00000218388.9; ENST00000377017.5
External Link	RMBase: m6A_site_858023
mod ID: M6ASITE091143		Click to Show/Hide the Full List
mod site	chrX:47584976-47584977:+		[2]
Sequence	GGACACCAGAAGTCAACCAGACCACCTTATACCAGCGTTAT
Motif Score	2.876744048
Cell/Tissue List	A549; HepG2; HeLa; MT4; MM6; Huh7; CD4T; peripheral-blood; GSC-11; iSLK; MSC; TIME; endometrial; HEC-1-A; NB4
Seq Type List	MeRIP-seq; m6A-seq
Transcript ID List	ENST00000218388.9; ENST00000456754.6; ENST00000441738.1; ENST00000377017.5
External Link	RMBase: m6A_site_858024
mod ID: M6ASITE091144		Click to Show/Hide the Full List
mod site	chrX:47585241-47585242:+		[3]
Sequence	AGCCTTAGGGGATGCCGCTGACATCCGGTTCGTCTACACCC
Motif Score	2.859755952
Cell/Tissue List	hESC-HEK293T
Seq Type List	MAZTER-seq
Transcript ID List	ENST00000377017.5; ENST00000218388.9; ENST00000441738.1; ENST00000456754.6
External Link	RMBase: m6A_site_858025
mod ID: M6ASITE091145		Click to Show/Hide the Full List
mod site	chrX:47585256-47585257:+		[4]
Sequence	CGCTGACATCCGGTTCGTCTACACCCCCGCCATGGAGAGTG
Motif Score	2.078666667
Cell/Tissue List	liver
Seq Type List	m6A-REF-seq
Transcript ID List	ENST00000377017.5; ENST00000218388.9; ENST00000456754.6
External Link	RMBase: m6A_site_858026
mod ID: M6ASITE091146		Click to Show/Hide the Full List
mod site	chrX:47585301-47585302:+		[3]
Sequence	CGGATACTTCCACAGGTCCCACAACCGCAGCGAGGAGTTTC
Motif Score	2.053113095
Cell/Tissue List	hESC-HEK293T
Seq Type List	MAZTER-seq
Transcript ID List	ENST00000218388.9; ENST00000456754.6; ENST00000377017.5
External Link	RMBase: m6A_site_858027
mod ID: M6ASITE091147		Click to Show/Hide the Full List
mod site	chrX:47585558-47585559:+		[5]
Sequence	TTAGGAAAACTGCAGGATGGACTCTTGCACATCACTACCTG
Motif Score	4.065041667
Cell/Tissue List	endometrial
Seq Type List	m6A-seq
Transcript ID List	ENST00000218388.9; ENST00000377017.5; ENST00000445623.1; ENST00000456754.6
External Link	RMBase: m6A_site_858028
mod ID: M6ASITE091148		Click to Show/Hide the Full List
mod site	chrX:47585566-47585567:+		[6]
Sequence	ACTGCAGGATGGACTCTTGCACATCACTACCTGCAGTTTTG
Motif Score	2.830589286
Cell/Tissue List	HEK293T; hESC-HEK293T
Seq Type List	DART-seq; MAZTER-seq
Transcript ID List	ENST00000456754.6; ENST00000445623.1; ENST00000218388.9; ENST00000377017.5
External Link	RMBase: m6A_site_858029
mod ID: M6ASITE091149		Click to Show/Hide the Full List
mod site	chrX:47585599-47585600:+		[4]
Sequence	CAGTTTTGTGGCTCCCTGGAACAGCCTGAGCTTAGCTCAGC
Motif Score	2.951386905
Cell/Tissue List	liver; HEK293T; endometrial
Seq Type List	m6A-REF-seq; DART-seq; m6A-seq
Transcript ID List	ENST00000445623.1; ENST00000377017.5; ENST00000456754.6; ENST00000218388.9
External Link	RMBase: m6A_site_858030
mod ID: M6ASITE091150		Click to Show/Hide the Full List
mod site	chrX:47585637-47585638:+		[5]
Sequence	AGCGCCGGGGCTTCACCAAGACCTACACTGTTGGCTGTGAG
Motif Score	2.876744048
Cell/Tissue List	endometrial
Seq Type List	m6A-seq
Transcript ID List	ENST00000456754.6; ENST00000218388.9; ENST00000445623.1; ENST00000377017.5
External Link	RMBase: m6A_site_858031
mod ID: M6ASITE091151		Click to Show/Hide the Full List
mod site	chrX:47585641-47585642:+		[3]
Sequence	CCGGGGCTTCACCAAGACCTACACTGTTGGCTGTGAGGAAT
Motif Score	2.078666667
Cell/Tissue List	hESC-HEK293T
Seq Type List	MAZTER-seq
Transcript ID List	ENST00000445623.1; ENST00000218388.9; ENST00000377017.5; ENST00000456754.6
External Link	RMBase: m6A_site_858032
mod ID: M6ASITE091152		Click to Show/Hide the Full List
mod site	chrX:47586581-47586582:+		[7]
Sequence	CACTCATTGCTTGTGGACGGACCAGCTCCTCCAAGGCTCTG
Motif Score	3.622404762
Cell/Tissue List	HepG2
Seq Type List	m6A-seq
Transcript ID List	ENST00000445623.1; ENST00000377017.5; ENST00000218388.9
External Link	RMBase: m6A_site_858033
mod ID: M6ASITE091153		Click to Show/Hide the Full List
mod site	chrX:47586721-47586722:+		[4]
Sequence	GAGTGGAAGCTGAAGCCTGCACAGTGTCCACCCTGTTCCCA
Motif Score	2.830589286
Cell/Tissue List	liver
Seq Type List	m6A-REF-seq
Transcript ID List	ENST00000218388.9; ENST00000377017.5; ENST00000445623.1
External Link	RMBase: m6A_site_858034
mod ID: M6ASITE091154		Click to Show/Hide the Full List
mod site	chrX:47586760-47586761:+		[8]
Sequence	CACTCCCATCTTTCTTCCGGACAATGAAATAAAGAGTTACC
Motif Score	3.643047619
Cell/Tissue List	Huh7; endometrial
Seq Type List	MeRIP-seq; m6A-seq
Transcript ID List	ENST00000218388.9; ENST00000445623.1; ENST00000377017.5
External Link	RMBase: m6A_site_858035

Ref 1	VIRMA mediates preferential m(6)A mRNA methylation in 3'UTR and near stop codon and associates with alternative polyadenylation. Cell Discov. 2018 Feb 27;4:10. doi: 10.1038/s41421-018-0019-0. eCollection 2018.
Ref 2	Viral N(6)-methyladenosine upregulates replication and pathogenesis of human respiratory syncytial virus. Nat Commun. 2019 Oct 9;10(1):4595. doi: 10.1038/s41467-019-12504-y.
Ref 3	Deciphering the "m(6)A Code" via Antibody-Independent Quantitative Profiling. Cell. 2019 Jul 25;178(3):731-747.e16. doi: 10.1016/j.cell.2019.06.013. Epub 2019 Jun 27.
Ref 4	Single-base mapping of m(6)A by an antibody-independent method. Sci Adv. 2019 Jul 3;5(7):eaax0250. doi: 10.1126/sciadv.aax0250. eCollection 2019 Jul.
Ref 5	m(6)A mRNA methylation regulates AKT activity to promote the proliferation and tumorigenicity of endometrial cancer. Nat Cell Biol. 2018 Sep;20(9):1074-1083. doi: 10.1038/s41556-018-0174-4. Epub 2018 Aug 27.
Ref 6	DART-seq: an antibody-free method for global m(6)A detection. Nat Methods. 2019 Dec;16(12):1275-1280. doi: 10.1038/s41592-019-0570-0. Epub 2019 Sep 23.
Ref 7	Topology of the human and mouse m6A RNA methylomes revealed by m6A-seq. Nature. 2012 Apr 29;485(7397):201-6. doi: 10.1038/nature11112.
Ref 8	N6-Methyladenosine in Flaviviridae Viral RNA Genomes Regulates Infection. Cell Host Microbe. 2016 Nov 9;20(5):654-665. doi: 10.1016/j.chom.2016.09.015. Epub 2016 Oct 20.

Epigenetic Target Information

Cite M6AREG

Correspondence

Prof. Feng ZHU

Prof. Shuiping Liu

Visitor Map