General Information of the Epigenetic Target (ID: EPITAR00311)
Target Name Caspase-1 (CASP1)
Synonyms
CASP-1; EC 3.4.22.36; Interleukin-1 beta convertase; IL-1BC; Interleukin-1 beta-converting enzyme; ICE; IL-1 beta-converting enzyme; p45
    Click to Show/Hide
Gene Name CASP1
Sequence
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
    Click to Show/Hide
Family Peptidase C14A family
Function
Thiol protease involved in a variety of inflammatory processes by proteolytically cleaving other proteins, such as the precursors of the inflammatory cytokines interleukin-1 beta (IL1B) and interleukin 18 (IL18) as well as the pyroptosis inducer Gasdermin-D (GSDMD), into active mature peptides (PubMed:15326478, PubMed:1574116, PubMed:7876192, PubMed:15498465, PubMed:26375003, PubMed:32051255). Plays a key role in cell immunity as an inflammatory response initiator: once activated through formation of an inflammasome complex, it initiates a pro-inflammatory response through the cleavage of the two inflammatory cytokines IL1B and IL18, releasing the mature cytokines which are involved in a variety of inflammatory processes (PubMed:1574116, PubMed:7876192, PubMed:15498465, PubMed:15326478, PubMed:32051255). Cleaves a tetrapeptide after an Asp residue at position P1 (PubMed:1574116, PubMed:7876192, PubMed:15498465). Also initiates pyroptosis, a programmed lytic cell death pathway, through cleavage of GSDMD (PubMed:26375003). In contrast to cleavage of interleukins IL1B and IL1B, recognition and cleavage of GSDMD is not strictly dependent on the consensus cleavage site but depends on an exosite interface on CASP1 that recognizes and binds the Gasdermin-D, C-terminal (GSDMD-CT) part (PubMed:32051255, PubMed:32109412, PubMed:32553275). Cleaves and activates CASP7 in response to bacterial infection, promoting plasma membrane repair (PubMed:22464733). Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive (PubMed:28314590). In apoptotic cells, cleaves SPHK2 which is released from cells and remains enzymatically active extracellularly (PubMed:20197547).
    Click to Show/Hide
Gene ID 834
HGNC ID HGNC:1499
Ensembl Gene ID ENSG00000137752
KEGG ID hsa:834
Chromosomal Location 11q22.3
RNA Modification Sequencing Data Associated with the Target (ID: EPITAR00311)
Caspase-1 (CASP1)
N6-methyladenosine (m6A)
In total 4 m6A sequence/site(s) in this target gene
mod ID: M6ASITE008366 Click to Show/Hide the Full List
mod site chr11:105034321-105034322:- [1]
Sequence ATGCTACAGTTATGGATAAGACCCGAGCTTTGATTGACTCC
Motif Score 2.876744048
Cell/Tissue List HeLa; MSC; TIME; TREX
Seq Type List MeRIP-seq
Transcript ID List ENST00000532520.1; ENST00000446369.5; ENST00000534497.5; ENST00000525825.5; ENST00000529871.1; ENST00000640184.1; ENST00000528974.1; ENST00000526511.5; ENST00000526568.5; ENST00000533400.6; ENST00000527979.5; ENST00000436863.7; ENST00000353247.9; ENST00000531166.5; ENST00000528424.1
External Link RMBase: m6A_site_161600
mod ID: M6ASITE008367 Click to Show/Hide the Full List
mod site chr11:105034374-105034375:- [1]
Sequence ATTACAGACAAGGGTGCTGAACAAGGAAGAGATGGAGAAAG
Motif Score 2.951386905
Cell/Tissue List HeLa; iSLK; MSC; TIME; TREX
Seq Type List MeRIP-seq
Transcript ID List ENST00000446369.5; ENST00000532520.1; ENST00000526568.5; ENST00000353247.9; ENST00000529871.1; ENST00000528974.1; ENST00000527979.5; ENST00000531166.5; ENST00000533400.6; ENST00000525825.5; ENST00000534497.5; ENST00000640184.1; ENST00000436863.7; ENST00000526511.5
External Link RMBase: m6A_site_161601
mod ID: M6ASITE008368 Click to Show/Hide the Full List
mod site chr11:105034387-105034388:- [1]
Sequence TACTGGATGAATTATTACAGACAAGGGTGCTGAACAAGGAA
Motif Score 2.897386905
Cell/Tissue List HeLa; iSLK; MSC; TIME; TREX
Seq Type List MeRIP-seq
Transcript ID List ENST00000436863.7; ENST00000640184.1; ENST00000529871.1; ENST00000446369.5; ENST00000531166.5; ENST00000526511.5; ENST00000526568.5; ENST00000525825.5; ENST00000528974.1; ENST00000527979.5; ENST00000534497.5; ENST00000532520.1; ENST00000533400.6; ENST00000353247.9
External Link RMBase: m6A_site_161602
mod ID: M6ASITE008369 Click to Show/Hide the Full List
mod site chr11:105034477-105034478:- [1]
Sequence GAGAAATCCTTGTGCTCTAAACAGACAAGGTCCTGAAGGAG
Motif Score 2.20572619
Cell/Tissue List HeLa; MSC; TIME; TREX
Seq Type List MeRIP-seq
Transcript ID List ENST00000533400.6; ENST00000446369.5; ENST00000526511.5; ENST00000528974.1; ENST00000525825.5; ENST00000534497.5; ENST00000529871.1; ENST00000526568.5; ENST00000532520.1; ENST00000436863.7; ENST00000531166.5; ENST00000353247.9; ENST00000527979.5
External Link RMBase: m6A_site_161603