Epigenetic Target Information

General Information of the Epigenetic Target (ID: EPITAR00170)

Target Name	Interleukin 6 (IL6)
Synonyms	IL-6; BSF2; HGF; HSF; IFNB2; interleukin 6 (interferon, beta 2) Click to Show/Hide
Gene Name	IL6
Sequence	MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM Click to Show/Hide
Family	IL-6 superfamily
Function	Cytokine with a wide variety of biological functions in immunity, tissue regeneration, and metabolism. Binds to IL6R, then the complex associates to the signaling subunit IL6ST/gp130 to trigger the intracellular IL6-signaling pathway (Probable). The interaction with the membrane-bound IL6R and IL6ST stimulates 'classic signaling', whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells (Probable). Click to Show/Hide
Gene ID	3569
HGNC ID	HGNC:6018
Ensembl Gene ID	ENSG00000136244
KEGG ID	hsa:3569
Chromosomal Location	7p15.3

RNA Modification Sequencing Data Associated with the Target (ID: EPITAR00170)

Interleukin 6 (IL6)

5-methylcytidine (m5C)

In total 2 m6A sequence/site(s) in this target gene
mod ID: M5CSITE004095		Click to Show/Hide the Full List
mod site	chr7:22727770-22727771:+
Sequence	AGATTTGAGGCCAACGGGGCCGACTAGACTGACTTCTGTAT
Cell/Tissue List	T24
Seq Type List	Bisulfite-seq
Transcript ID List	ENST00000401630.7; ENST00000401651.5; ENST00000426291.5; ENST00000258743.10; ENST00000404625.5; ENST00000407492.5; ENST00000485300.1; ENST00000406575.1
External Link	RMBase: m5C_site_39115
mod ID: M5CSITE004096		Click to Show/Hide the Full List
mod site	chr7:22730184-22730185:+		[1]
Sequence	CCAGTAGCTGGCTATTCAGACAGCAGGGAGTAGACTTGCTG
Cell/Tissue List	lung
Seq Type List	Bisulfite-seq
Transcript ID List	ENST00000485300.1; ENST00000407492.5; ENST00000404625.5; ENST00000401630.7; ENST00000258743.10
External Link	RMBase: m5C_site_39116

N6-methyladenosine (m6A)

In total 13 m6A sequence/site(s) in this target gene
mod ID: M6ASITE078886		Click to Show/Hide the Full List
mod site	chr7:22725977-22725978:+		[2]
Sequence	AGCTGTCTGGGTCTCTGGAGACTGGAGGGACAACCTAGTCT
Motif Score	3.319380952
Cell/Tissue List	HeLa; TIME
Seq Type List	m6A-seq; MeRIP-seq
Transcript ID List	rmsk_2181165; ENST00000404625.5
External Link	RMBase: m6A_site_749992
mod ID: M6ASITE078887		Click to Show/Hide the Full List
mod site	chr7:22725986-22725987:+		[2]
Sequence	GGTCTCTGGAGACTGGAGGGACAACCTAGTCTAGAGCCCAT
Motif Score	3.643047619
Cell/Tissue List	HeLa; TIME
Seq Type List	m6A-seq; MeRIP-seq
Transcript ID List	rmsk_2181165; ENST00000404625.5
External Link	RMBase: m6A_site_749993
mod ID: M6ASITE078888		Click to Show/Hide the Full List
mod site	chr7:22726016-22726017:+		[2]
Sequence	CTAGAGCCCATTTGCATGAGACCAAGGATCCTCCTGCAAGA
Motif Score	2.876744048
Cell/Tissue List	HeLa; TIME
Seq Type List	m6A-seq; MeRIP-seq
Transcript ID List	rmsk_2181165; ENST00000404625.5
External Link	RMBase: m6A_site_749995
mod ID: M6ASITE078889		Click to Show/Hide the Full List
mod site	chr7:22726038-22726039:+		[2]
Sequence	CAAGGATCCTCCTGCAAGAGACACCATCCTGAGGGAAGAGG
Motif Score	2.897386905
Cell/Tissue List	HeLa
Seq Type List	m6A-seq
Transcript ID List	rmsk_2181165; ENST00000404625.5
External Link	RMBase: m6A_site_749996
mod ID: M6ASITE078890		Click to Show/Hide the Full List
mod site	chr7:22726067-22726068:+		[2]
Sequence	TGAGGGAAGAGGGCTTCTGAACCAGCTTGACCCAATAAGAA
Motif Score	2.930744048
Cell/Tissue List	HeLa
Seq Type List	m6A-seq
Transcript ID List	rmsk_2181165; ENST00000404625.5
External Link	RMBase: m6A_site_749997
mod ID: M6ASITE078891		Click to Show/Hide the Full List
mod site	chr7:22726180-22726181:+		[3]
Sequence	TCTTTTGATTTCAAATCAAGACTTACAGGGAGAGGGAGCGA
Motif Score	3.319380952
Cell/Tissue List	TIME
Seq Type List	MeRIP-seq
Transcript ID List	ENST00000404625.5; rmsk_2181165
External Link	RMBase: m6A_site_749999
mod ID: M6ASITE078893		Click to Show/Hide the Full List
mod site	chr7:22727179-22727180:+		[4]
Sequence	CAACCCCCAATAAATATAGGACTGGAGATGTCTGAGGCTCA
Motif Score	4.065041667
Cell/Tissue List	HeLa
Seq Type List	MeRIP-seq
Transcript ID List	ENST00000401651.5; ENST00000404625.5; ENST00000426291.5
External Link	RMBase: m6A_site_750002
mod ID: M6ASITE078894		Click to Show/Hide the Full List
mod site	chr7:22727266-22727267:+		[4]
Sequence	CTCCAGGAGCCCAGCTATGAACTCCTTCTCCACAAGTAAGT
Motif Score	3.373380952
Cell/Tissue List	A549; iSLK; endometrial
Seq Type List	MeRIP-seq; m6A-seq
Transcript ID List	ENST00000407492.5; ENST00000401651.5; ENST00000406575.1; ENST00000404625.5; ENST00000485300.1; ENST00000401630.7; ENST00000258743.10; ENST00000426291.5
External Link	RMBase: m6A_site_750003
mod ID: M6ASITE078895		Click to Show/Hide the Full List
mod site	chr7:22727309-22727310:+		[4]
Sequence	AGGAAATCCTTAGCCCTGGAACTGCCAGCGGCGGTCGAGCC
Motif Score	3.373380952
Cell/Tissue List	A549; iSLK; endometrial
Seq Type List	MeRIP-seq; m6A-seq
Transcript ID List	ENST00000401630.7; ENST00000406575.1; ENST00000485300.1; ENST00000407492.5; ENST00000426291.5; ENST00000404625.5; ENST00000401651.5; ENST00000258743.10
External Link	RMBase: m6A_site_750004
mod ID: M6ASITE078896		Click to Show/Hide the Full List
mod site	chr7:22727555-22727556:+		[4]
Sequence	GATGTAGCCGCCCCACACAGACAGCCACTCACCTCTTCAGA
Motif Score	2.897386905
Cell/Tissue List	A549; endometrial
Seq Type List	MeRIP-seq; m6A-seq
Transcript ID List	ENST00000485300.1; ENST00000401651.5; ENST00000258743.10; ENST00000401630.7; ENST00000407492.5; ENST00000404625.5; ENST00000426291.5; ENST00000406575.1
External Link	RMBase: m6A_site_750005
mod ID: M6ASITE078897		Click to Show/Hide the Full List
mod site	chr7:22727588-22727589:+		[4]
Sequence	TCTTCAGAACGAATTGACAAACAAATTCGGTACATCCTCGA
Motif Score	2.20572619
Cell/Tissue List	A549; endometrial
Seq Type List	MeRIP-seq; m6A-seq
Transcript ID List	ENST00000258743.10; ENST00000401630.7; ENST00000426291.5; ENST00000401651.5; ENST00000485300.1; ENST00000407492.5; ENST00000404625.5; ENST00000406575.1
External Link	RMBase: m6A_site_750006
mod ID: M6ASITE078898		Click to Show/Hide the Full List
mod site	chr7:22729580-22729581:+		[5]
Sequence	ATACCTAGAGTACCTCCAGAACAGATTTGAGAGTAGTGAGG
Motif Score	2.951386905
Cell/Tissue List	endometrial
Seq Type List	m6A-seq
Transcript ID List	ENST00000401651.5; ENST00000401630.7; ENST00000426291.5; ENST00000464710.1; ENST00000258743.10; ENST00000406575.1; ENST00000404625.5; ENST00000407492.5; ENST00000485300.1
External Link	RMBase: m6A_site_750007
mod ID: M6ASITE078899		Click to Show/Hide the Full List
mod site	chr7:22729602-22729603:+		[5]
Sequence	AGATTTGAGAGTAGTGAGGAACAAGCCAGAGCTGTGCAGAT
Motif Score	2.951386905
Cell/Tissue List	endometrial
Seq Type List	m6A-seq
Transcript ID List	ENST00000407492.5; ENST00000401630.7; ENST00000485300.1; ENST00000401651.5; ENST00000406575.1; ENST00000258743.10; ENST00000464710.1; ENST00000426291.5; ENST00000404625.5
External Link	RMBase: m6A_site_750008

Ref 1	5-methylcytosine promotes mRNA export - NSUN2 as the methyltransferase and ALYREF as an m(5)C reader. Cell Res. 2017 May;27(5):606-625. doi: 10.1038/cr.2017.55. Epub 2017 Apr 18.
Ref 2	VIRMA mediates preferential m(6)A mRNA methylation in 3'UTR and near stop codon and associates with alternative polyadenylation. Cell Discov. 2018 Feb 27;4:10. doi: 10.1038/s41421-018-0019-0. eCollection 2018.
Ref 3	Viral and cellular N(6)-methyladenosine and N(6),2'-O-dimethyladenosine epitranscriptomes in the KSHV life cycle. Nat Microbiol. 2018 Jan;3(1):108-120. doi: 10.1038/s41564-017-0056-8. Epub 2017 Nov 6.
Ref 4	Viral N(6)-methyladenosine upregulates replication and pathogenesis of human respiratory syncytial virus. Nat Commun. 2019 Oct 9;10(1):4595. doi: 10.1038/s41467-019-12504-y.
Ref 5	m(6)A mRNA methylation regulates AKT activity to promote the proliferation and tumorigenicity of endometrial cancer. Nat Cell Biol. 2018 Sep;20(9):1074-1083. doi: 10.1038/s41556-018-0174-4. Epub 2018 Aug 27.

Epigenetic Target Information

Cite M6AREG

Correspondence

Prof. Feng ZHU

Prof. Shuiping Liu

Visitor Map