Epigenetic Target Information

General Information of the Epigenetic Target (ID: EPITAR00108)
Target Name Interferon regulatory factor 9 (IRF9)
Synonyms
ISGF3G; interferon-stimulated transcription factor 3, gamma (48kD); interferon-stimulated transcription factor 3, gamma 48kDa
    Click to Show/Hide
Gene Name IRF9
Sequence
MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV
    Click to Show/Hide
Family IRF family
Function
Transcription factor that plays an essential role in anti-viral immunity. It mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. IRF9/ISGF3G associates with the phosphorylated STAT1:STAT2 dimer to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state.
    Click to Show/Hide
Gene ID 10379
HGNC ID HGNC:6131
Ensembl Gene ID ENSG00000213928
KEGG ID hsa:10379
Chromosomal Location 14q12
RNA Modification Sequencing Data Associated with the Target (ID: EPITAR00108)
Interferon regulatory factor 9 (IRF9)
N6-methyladenosine (m6A)
In total 1 m6A sequence/site(s) in this target gene
mod ID: M6ASITE019129 Click to Show/Hide the Full List
mod site chr14:24165953-24165954:+ [1]
Sequence ATACTCCACAGAATCTTATCACAGTGAAGGTGAGCTCGGAG
Motif Score 2.047297619
Cell/Tissue List kidney
Seq Type List m6A-REF-seq
Transcript ID List ENST00000558468.2; ENST00000560311.1; ENST00000324076.4; ENST00000396864.7; ENST00000561415.1; ENST00000557894.5
External Link RMBase: m6A_site_241185